Diaphorina citri psyllid: psy16600


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MSSTSTIQCYNCFDFGHYQYSCPQKSSADARGDKVGIVCYKCNNYGHFARECATESVTCYNCSGQGHVAKDCTVKSSIICYNCNSSGHFARNCPNDSSKRCYACHQAGHMAKECPGQTAGKSPEPVVDMSLTCYVCGHQGHLSYDCKLVQKS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
****STIQCYNCFDFGHYQYSCPQK**ADARGDKVGIVCYKCNNYGHFARECATESVTCYNCSGQGHVAKDCTVKSSIICYNCNSSGHFARNC*NDSSKRCYACHQAGHMA*******************LTCYVCGHQGHLSY*CKL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSTSTIQCYNCFDFGHYQYSCPQKSSADARGDKVGIVCYKCNNYGHFARECATESVTCYNCSGQGHVAKDCTVKSSIICYNCNSSGHFARNCPNDSSKRCYACHQAGHMAKECPGQTAGKSPEPVVDMSLTCYVCGHQGHLSYDCKLVQKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cellular nucleic acid-binding protein Single stranded DNA-binding protein, with specificity to the sterol regulatory element (SRE). Involved in sterol-mediated repression.confidentO42395
Cellular nucleic acid-binding protein Single stranded DNA-binding protein, with specificity to the sterol regulatory element (SRE). Involved in sterol-mediated repression.confidentP62634
Cellular nucleic acid-binding protein Single stranded DNA-binding protein, with specificity to the sterol regulatory element (SRE). Involved in sterol-mediated repression.confidentP62633

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0014036 [BP]neural crest cell fate specificationprobableGO:0030154, GO:0048468, GO:0009790, GO:0009792, GO:0009653, GO:0007275, GO:0044699, GO:0014033, GO:0000904, GO:0048864, GO:0000902, GO:0014034, GO:0048869, GO:0001708, GO:0016043, GO:0032989, GO:0048513, GO:0071840, GO:0043009, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0008150, GO:0048731, GO:0060485, GO:0014031, GO:0045165, GO:0044707, GO:0014029, GO:0048856, GO:0001837, GO:0044763
GO:0016070 [BP]RNA metabolic processprobableGO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0060322 [BP]head developmentprobableGO:0044767, GO:0032502, GO:0048856, GO:0008150, GO:0044699
GO:0045182 [MF]translation regulator activityprobableGO:0003674
GO:0045727 [BP]positive regulation of translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051216 [BP]cartilage developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0003727 [MF]single-stranded RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LLI, chain A
Confidence level:very confident
Coverage over the Query: 37-149
View the alignment between query and template
View the model in PyMOL
Template: 2LLI, chain A
Confidence level:very confident
Coverage over the Query: 6-25,38-117
View the alignment between query and template
View the model in PyMOL