Query         psy16601
Match_columns 177
No_of_seqs    131 out of 1126
Neff          11.0
Searched_HMMs 46136
Date          Fri Aug 16 17:08:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16601.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16601hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 5.4E-28 1.2E-32  164.3   7.0  129   45-174   126-265 (279)
  2 KOG2462|consensus               99.8 9.5E-22 2.1E-26  134.0   4.2   98   78-176   130-239 (279)
  3 KOG3576|consensus               99.8 2.1E-20 4.6E-25  122.0   4.0  113   46-176   114-236 (267)
  4 KOG1074|consensus               99.8 5.4E-20 1.2E-24  141.3   4.0   57   48-105   352-408 (958)
  5 KOG3623|consensus               99.7 7.2E-19 1.6E-23  133.6   4.0  121   48-173   209-330 (1007)
  6 KOG1074|consensus               99.7 6.1E-18 1.3E-22  130.2   5.7   52  124-176   880-931 (958)
  7 KOG3608|consensus               99.7 1.5E-17 3.2E-22  117.1   5.5  107   49-176   237-345 (467)
  8 KOG3608|consensus               99.7 9.5E-17 2.1E-21  113.1   7.0  112   48-177   262-377 (467)
  9 KOG3623|consensus               99.6   3E-17 6.6E-22  124.9   1.5   78   78-173   894-971 (1007)
 10 KOG3576|consensus               99.6 1.2E-16 2.5E-21  104.6   1.0   82   78-177   117-198 (267)
 11 KOG3993|consensus               99.5 1.8E-14 3.9E-19  103.8   1.4  130   46-176   264-482 (500)
 12 PHA00733 hypothetical protein   99.4 5.7E-13 1.2E-17   83.7   4.0   84   77-177    39-124 (128)
 13 PLN03086 PRLI-interacting fact  99.4   2E-12 4.4E-17   98.5   7.4  104   47-176   451-564 (567)
 14 PHA00733 hypothetical protein   99.2 1.5E-11 3.3E-16   77.3   4.0   85   45-148    36-124 (128)
 15 PHA02768 hypothetical protein;  99.2 7.7E-12 1.7E-16   65.4   2.0   44  123-169     5-48  (55)
 16 PHA02768 hypothetical protein;  99.0 1.2E-10 2.7E-15   60.9   1.7   43   50-95      6-48  (55)
 17 PLN03086 PRLI-interacting fact  98.9 1.1E-09 2.4E-14   83.9   4.5  103   49-175   407-537 (567)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.9 9.2E-10   2E-14   49.4   1.9   26  138-164     1-26  (26)
 19 PF05605 zf-Di19:  Drought indu  98.8 8.2E-09 1.8E-13   55.1   4.4   52  123-177     2-54  (54)
 20 KOG3993|consensus               98.8 1.1E-09 2.4E-14   79.6   0.2   81   79-176   268-380 (500)
 21 PHA00732 hypothetical protein   98.8 5.3E-09 1.1E-13   59.9   2.5   46  123-175     1-47  (79)
 22 PHA00616 hypothetical protein   98.6 1.4E-08   3E-13   50.7   1.6   26  152-177     1-26  (44)
 23 PF05605 zf-Di19:  Drought indu  98.6 7.2E-08 1.6E-12   51.4   4.3   52   79-148     3-54  (54)
 24 PF13465 zf-H2C2_2:  Zinc-finge  98.6 3.7E-08 7.9E-13   44.2   2.5   26   64-90      1-26  (26)
 25 PHA00616 hypothetical protein   98.6 2.5E-08 5.5E-13   49.8   1.6   35  123-158     1-35  (44)
 26 PHA00732 hypothetical protein   98.6 3.7E-08   8E-13   56.5   2.4   49   49-103     1-49  (79)
 27 PF00096 zf-C2H2:  Zinc finger,  98.5 6.3E-08 1.4E-12   42.2   1.4   22  153-174     1-22  (23)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.4 1.2E-07 2.5E-12   41.7   1.7   24  153-176     1-24  (24)
 29 PF12756 zf-C2H2_2:  C2H2 type   98.4 1.9E-07 4.2E-12   56.4   2.0   67   80-146     1-73  (100)
 30 PF00096 zf-C2H2:  Zinc finger,  98.3 6.2E-07 1.3E-11   38.9   2.3   23  124-146     1-23  (23)
 31 PF13912 zf-C2H2_6:  C2H2-type   98.3 3.9E-07 8.4E-12   41.3   1.4   25  152-176     1-25  (27)
 32 PF12756 zf-C2H2_2:  C2H2 type   98.2 1.6E-06 3.4E-11   52.4   2.8   51   51-101     1-73  (100)
 33 PF13909 zf-H2C2_5:  C2H2-type   98.1 2.1E-06 4.6E-11   37.6   1.6   24  153-177     1-24  (24)
 34 PF13894 zf-C2H2_4:  C2H2-type   98.1 4.2E-06 9.2E-11   36.5   2.5   24  124-147     1-24  (24)
 35 PF09237 GAGA:  GAGA factor;  I  98.0 2.1E-06 4.7E-11   43.8   1.0   32  145-176    17-48  (54)
 36 PF13912 zf-C2H2_6:  C2H2-type   98.0 4.4E-06 9.5E-11   37.7   1.8   26  123-148     1-26  (27)
 37 smart00355 ZnF_C2H2 zinc finge  97.8 1.8E-05 3.9E-10   35.0   2.0   23  153-175     1-23  (26)
 38 COG5189 SFP1 Putative transcri  97.8 1.2E-05 2.6E-10   57.1   1.9   67   77-143   348-418 (423)
 39 PF09237 GAGA:  GAGA factor;  I  97.7 2.7E-05 5.9E-10   39.8   1.7   32   72-103    18-49  (54)
 40 PF12874 zf-met:  Zinc-finger o  97.6 2.6E-05 5.6E-10   34.4   1.2   23  153-175     1-23  (25)
 41 KOG2231|consensus               97.5  0.0002 4.3E-09   56.5   5.6  107   50-176   100-236 (669)
 42 KOG1146|consensus               97.5 6.4E-05 1.4E-09   62.7   2.9  124   51-174   438-611 (1406)
 43 COG5189 SFP1 Putative transcri  97.5   4E-05 8.7E-10   54.5   0.9   53  121-173   347-419 (423)
 44 smart00355 ZnF_C2H2 zinc finge  97.4 0.00015 3.3E-09   31.9   2.2   24  124-147     1-24  (26)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  97.4 5.2E-05 1.1E-09   34.1   0.6   22  153-174     2-23  (27)
 46 PF13909 zf-H2C2_5:  C2H2-type   97.4 0.00021 4.6E-09   31.1   2.5   24  124-148     1-24  (24)
 47 PRK04860 hypothetical protein;  97.3  0.0005 1.1E-08   45.1   4.8   40  122-166   118-157 (160)
 48 PF12874 zf-met:  Zinc-finger o  97.2 0.00027 5.9E-09   31.0   1.8   23  124-146     1-23  (25)
 49 COG5236 Uncharacterized conser  96.9  0.0014 3.1E-08   47.5   4.1  101   50-175   152-274 (493)
 50 KOG2785|consensus               96.9  0.0016 3.6E-08   47.7   4.0   53  122-174   165-242 (390)
 51 KOG2893|consensus               96.7 0.00039 8.5E-09   47.7  -0.1   50  120-175     8-57  (341)
 52 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7 0.00052 1.1E-08   30.8   0.2   21   79-99      2-22  (27)
 53 PF13913 zf-C2HC_2:  zinc-finge  96.5  0.0022 4.9E-08   28.1   1.9   21  153-174     3-23  (25)
 54 KOG1146|consensus               96.5 0.00095 2.1E-08   56.1   0.9   54  121-174   463-540 (1406)
 55 PRK04860 hypothetical protein;  96.5  0.0022 4.9E-08   42.0   2.5   39   48-91    118-156 (160)
 56 PF12013 DUF3505:  Protein of u  96.4   0.017 3.7E-07   35.5   5.7   25  153-177    81-109 (109)
 57 PF12013 DUF3505:  Protein of u  96.3   0.011 2.4E-07   36.3   4.5   27  122-148    79-109 (109)
 58 KOG2482|consensus               96.3   0.014 2.9E-07   42.5   5.5  127   48-174   143-356 (423)
 59 KOG4173|consensus               96.2  0.0014   3E-08   43.9   0.4   49   50-102    80-130 (253)
 60 smart00451 ZnF_U1 U1-like zinc  96.1  0.0037   8E-08   29.7   1.4   21  153-173     4-24  (35)
 61 KOG2482|consensus               96.1   0.023 4.9E-07   41.4   5.7  113   64-176   130-303 (423)
 62 KOG2893|consensus               95.8   0.003 6.6E-08   43.4   0.5   49   50-103    11-59  (341)
 63 COG5236 Uncharacterized conser  95.6    0.01 2.2E-07   43.2   2.6   47   51-99    222-272 (493)
 64 smart00451 ZnF_U1 U1-like zinc  95.6   0.012 2.7E-07   27.8   2.0   25  122-146     2-26  (35)
 65 KOG2785|consensus               95.4   0.013 2.8E-07   43.2   2.4  129   49-177     3-191 (390)
 66 COG4049 Uncharacterized protei  94.7   0.026 5.6E-07   29.5   1.7   31   44-74     12-42  (65)
 67 cd00350 rubredoxin_like Rubred  94.6   0.018 3.9E-07   27.1   0.9   24   50-86      2-25  (33)
 68 KOG4173|consensus               94.4  0.0093   2E-07   40.1  -0.3   78   78-176    79-170 (253)
 69 KOG2186|consensus               94.3   0.023   5E-07   39.6   1.4   53   79-151     4-56  (276)
 70 COG4049 Uncharacterized protei  93.9   0.036 7.7E-07   29.0   1.2   29  120-148    14-42  (65)
 71 PF05443 ROS_MUCR:  ROS/MUCR tr  93.9   0.029 6.2E-07   35.6   1.0   22  124-148    73-94  (132)
 72 COG5048 FOG: Zn-finger [Genera  93.5   0.013 2.9E-07   44.4  -1.1   58   48-105   288-350 (467)
 73 KOG2186|consensus               93.2   0.055 1.2E-06   37.8   1.6   49   50-102     4-52  (276)
 74 PF06524 NOA36:  NOA36 protein;  93.2   0.036 7.7E-07   38.8   0.7   20  151-170   208-227 (314)
 75 PF09538 FYDLN_acid:  Protein o  92.8   0.082 1.8E-06   32.3   1.8   15  122-136    25-39  (108)
 76 PF02892 zf-BED:  BED zinc fing  92.8   0.071 1.5E-06   26.8   1.4   13  123-135    16-28  (45)
 77 KOG2231|consensus               92.8    0.15 3.3E-06   40.9   3.7   47   51-102   184-236 (669)
 78 COG5048 FOG: Zn-finger [Genera  92.2   0.024 5.2E-07   43.0  -1.3   55  122-176   288-347 (467)
 79 COG2888 Predicted Zn-ribbon RN  91.5    0.23   5E-06   26.5   2.3   30   50-90     10-39  (61)
 80 PF09986 DUF2225:  Uncharacteri  91.5    0.03 6.5E-07   38.8  -1.3   44   48-91      4-61  (214)
 81 cd00729 rubredoxin_SM Rubredox  91.2    0.11 2.4E-06   24.5   0.9   25   49-86      2-26  (34)
 82 COG4957 Predicted transcriptio  90.6    0.13 2.9E-06   32.3   1.1   21  124-147    77-97  (148)
 83 smart00614 ZnF_BED BED zinc fi  90.1    0.23   5E-06   25.7   1.6   12  124-135    19-30  (50)
 84 PF09986 DUF2225:  Uncharacteri  90.0   0.037 8.1E-07   38.3  -1.9   45  121-165     3-61  (214)
 85 smart00659 RPOLCX RNA polymera  89.7    0.25 5.5E-06   24.9   1.5   28   49-88      2-29  (44)
 86 PRK00398 rpoP DNA-directed RNA  89.1    0.36 7.9E-06   24.5   1.8   12   79-90      4-15  (46)
 87 smart00734 ZnF_Rad18 Rad18-lik  89.0     0.4 8.7E-06   21.1   1.7   20  153-173     2-21  (26)
 88 PF08274 PhnA_Zn_Ribbon:  PhnA   88.2    0.18 3.9E-06   23.1   0.3   26  125-162     4-29  (30)
 89 PF13717 zinc_ribbon_4:  zinc-r  88.2    0.32 6.9E-06   23.3   1.2   34  124-163     3-36  (36)
 90 PRK14890 putative Zn-ribbon RN  87.9    0.47   1E-05   25.4   1.8   33  122-161    24-57  (59)
 91 TIGR00373 conserved hypothetic  87.7     0.4 8.6E-06   31.6   1.8   32  121-162   107-138 (158)
 92 TIGR02300 FYDLN_acid conserved  87.6    0.45 9.7E-06   29.8   1.8   15  122-136    25-39  (129)
 93 COG1592 Rubrerythrin [Energy p  87.2    0.45 9.9E-06   31.4   1.8   23  123-159   134-156 (166)
 94 TIGR02098 MJ0042_CXXC MJ0042 f  87.2    0.57 1.2E-05   22.5   1.8   34   79-134     3-36  (38)
 95 PRK09678 DNA-binding transcrip  87.0    0.18   4E-06   28.3  -0.1   40  124-166     2-43  (72)
 96 PRK00464 nrdR transcriptional   86.1    0.11 2.5E-06   33.9  -1.4   14  153-166    29-42  (154)
 97 PF15269 zf-C2H2_7:  Zinc-finge  85.9    0.55 1.2E-05   23.4   1.3   20  124-143    21-40  (54)
 98 COG1997 RPL43A Ribosomal prote  85.5    0.59 1.3E-05   27.1   1.5   15  120-134    50-64  (89)
 99 PF05443 ROS_MUCR:  ROS/MUCR tr  85.4    0.62 1.4E-05   29.6   1.7   23   79-104    73-95  (132)
100 PRK06266 transcription initiat  85.3    0.56 1.2E-05   31.5   1.6   32  121-162   115-146 (178)
101 KOG4167|consensus               84.8    0.52 1.1E-05   38.2   1.4   30   46-75    789-818 (907)
102 PF03604 DNA_RNApol_7kD:  DNA d  84.7    0.88 1.9E-05   21.2   1.6   12  122-133    16-27  (32)
103 smart00531 TFIIE Transcription  84.3    0.58 1.3E-05   30.4   1.3   37   47-88     97-133 (147)
104 TIGR00373 conserved hypothetic  84.1    0.74 1.6E-05   30.3   1.7   32   47-88    107-138 (158)
105 PF09723 Zn-ribbon_8:  Zinc rib  84.1    0.42 9.1E-06   23.7   0.4   14   79-92      6-19  (42)
106 PF13719 zinc_ribbon_5:  zinc-r  83.2     1.3 2.8E-05   21.3   1.9   34   79-134     3-36  (37)
107 PF04959 ARS2:  Arsenite-resist  83.2    0.68 1.5E-05   32.1   1.3   25  121-145    75-99  (214)
108 smart00834 CxxC_CXXC_SSSS Puta  83.1    0.57 1.2E-05   22.8   0.7   13   79-91      6-18  (41)
109 PF04959 ARS2:  Arsenite-resist  82.9       1 2.2E-05   31.2   2.0   26   79-104    78-103 (214)
110 PRK06266 transcription initiat  82.6    0.77 1.7E-05   30.9   1.4   31   48-88    116-146 (178)
111 PF10571 UPF0547:  Uncharacteri  82.4    0.63 1.4E-05   20.5   0.6   11  153-163    15-25  (26)
112 TIGR02605 CxxC_CxxC_SSSS putat  81.9     0.5 1.1E-05   24.6   0.2   30  123-160     5-34  (52)
113 PF01780 Ribosomal_L37ae:  Ribo  81.1    0.76 1.6E-05   27.0   0.8   15  120-134    50-64  (90)
114 PF08790 zf-LYAR:  LYAR-type C2  80.0    0.47   1E-05   21.3  -0.2   21  124-145     1-21  (28)
115 COG1996 RPC10 DNA-directed RNA  79.5     1.4 3.1E-05   22.7   1.4   11   78-88      6-16  (49)
116 PTZ00255 60S ribosomal protein  78.5     1.1 2.4E-05   26.3   1.0   15  120-134    51-65  (90)
117 COG1198 PriA Primosomal protei  78.4    0.55 1.2E-05   38.6  -0.5   12  150-161   473-484 (730)
118 KOG3408|consensus               77.2     1.2 2.6E-05   27.6   0.9   22  152-173    57-78  (129)
119 PHA00626 hypothetical protein   76.5     1.1 2.3E-05   23.7   0.4   14  152-165    23-36  (59)
120 TIGR00280 L37a ribosomal prote  76.5     1.3 2.7E-05   26.1   0.8   15  120-134    50-64  (91)
121 PF02176 zf-TRAF:  TRAF-type zi  76.2     1.8 3.9E-05   23.1   1.3   47  122-171     8-60  (60)
122 COG1571 Predicted DNA-binding   76.1     1.6 3.6E-05   33.3   1.5   17  121-137   365-381 (421)
123 PF07754 DUF1610:  Domain of un  75.8     1.4 3.1E-05   19.0   0.7    7   79-85     17-23  (24)
124 COG5188 PRP9 Splicing factor 3  75.4     5.2 0.00011   29.8   3.7   23   49-71    238-260 (470)
125 PF12907 zf-met2:  Zinc-binding  74.5     2.1 4.6E-05   21.0   1.2   24  153-176     2-28  (40)
126 PF09963 DUF2197:  Uncharacteri  73.9     1.2 2.7E-05   23.6   0.3   41   50-90      3-43  (56)
127 PF13878 zf-C2H2_3:  zinc-finge  73.0     6.9 0.00015   19.3   2.8   24   50-73     14-39  (41)
128 PRK03976 rpl37ae 50S ribosomal  72.6     1.8 3.8E-05   25.5   0.7   15  120-134    51-65  (90)
129 COG4530 Uncharacterized protei  72.0     2.3 4.9E-05   25.9   1.1   14  121-134    24-37  (129)
130 KOG4167|consensus               71.3     1.1 2.5E-05   36.4  -0.3   24  152-175   792-815 (907)
131 PF14353 CpXC:  CpXC protein     70.8     4.1 8.9E-05   25.6   2.2   40  124-165     2-51  (128)
132 TIGR00686 phnA alkylphosphonat  70.3     2.1 4.7E-05   26.0   0.8   29  125-165     4-32  (109)
133 KOG4727|consensus               69.6     2.4 5.1E-05   28.1   0.9   20  153-172    76-95  (193)
134 KOG3408|consensus               68.2     6.6 0.00014   24.4   2.5   32   41-72     49-80  (129)
135 COG3357 Predicted transcriptio  68.0       3 6.4E-05   24.5   1.0   13   78-90     58-70  (97)
136 PF13451 zf-trcl:  Probable zin  67.8     4.2 9.2E-05   21.0   1.4   38  121-159     2-40  (49)
137 PRK10220 hypothetical protein;  65.8     3.3 7.1E-05   25.2   0.9   29  125-165     5-33  (111)
138 PF10276 zf-CHCC:  Zinc-finger   65.6     4.4 9.5E-05   19.9   1.2   13  121-133    27-39  (40)
139 PF07282 OrfB_Zn_ribbon:  Putat  63.7     5.1 0.00011   22.0   1.4   31  124-165    29-59  (69)
140 PRK00432 30S ribosomal protein  62.7     6.8 0.00015   20.3   1.6   12  122-133    36-47  (50)
141 TIGR01206 lysW lysine biosynth  62.6     2.1 4.4E-05   22.6  -0.3   10   79-88      3-12  (54)
142 PF06220 zf-U1:  U1 zinc finger  62.6     6.7 0.00015   19.0   1.5   10  153-162     4-13  (38)
143 KOG2593|consensus               62.3     4.8  0.0001   30.8   1.4   37   46-86    125-161 (436)
144 KOG1280|consensus               62.0     7.7 0.00017   28.9   2.3   27   78-104    79-105 (381)
145 PF04780 DUF629:  Protein of un  61.7     6.6 0.00014   30.7   2.1   28   78-105    57-84  (466)
146 COG1198 PriA Primosomal protei  59.8     3.1 6.7E-05   34.4   0.1   12  121-132   473-484 (730)
147 COG3677 Transposase and inacti  58.2      17 0.00037   23.1   3.2   16  121-136    51-66  (129)
148 PRK04023 DNA polymerase II lar  57.9      15 0.00033   31.6   3.7   12   47-58    624-635 (1121)
149 TIGR00100 hypA hydrogenase nic  57.4       6 0.00013   24.5   1.1   26  122-160    69-94  (115)
150 COG1656 Uncharacterized conser  57.1      10 0.00023   25.1   2.1   45   50-97     98-149 (165)
151 COG1655 Uncharacterized protei  56.7     1.5 3.1E-05   30.6  -1.9   42  120-161    16-71  (267)
152 TIGR00595 priA primosomal prot  56.2     5.2 0.00011   31.7   0.8    9   80-88    215-223 (505)
153 PRK03824 hypA hydrogenase nick  56.0     4.9 0.00011   25.7   0.5   39  122-160    69-115 (135)
154 PRK12380 hydrogenase nickel in  55.4     7.6 0.00016   24.0   1.3   26  122-160    69-94  (113)
155 PF04606 Ogr_Delta:  Ogr/Delta-  55.2     1.6 3.6E-05   22.2  -1.4   38  125-165     1-40  (47)
156 KOG0978|consensus               53.4     6.5 0.00014   32.3   0.9   49  123-172   643-698 (698)
157 PF01286 XPA_N:  XPA protein N-  53.4     4.7  0.0001   19.0   0.1   15  124-138     4-18  (34)
158 KOG2636|consensus               53.4     9.6 0.00021   29.5   1.7   29  144-173   394-423 (497)
159 PF13824 zf-Mss51:  Zinc-finger  53.0      11 0.00024   20.0   1.4   10   79-88     15-24  (55)
160 COG5151 SSL1 RNA polymerase II  52.9      26 0.00057   25.8   3.7   26  121-146   386-411 (421)
161 PRK14873 primosome assembly pr  52.3     3.8 8.2E-05   33.7  -0.5    9  123-131   422-430 (665)
162 smart00154 ZnF_AN1 AN1-like Zi  52.0     8.4 0.00018   18.7   0.9   14   78-91     12-25  (39)
163 PF07975 C1_4:  TFIIH C1-like d  51.5     2.3   5E-05   22.1  -1.2   26   47-72     19-44  (51)
164 PF04780 DUF629:  Protein of un  50.3      11 0.00025   29.4   1.8   21  124-144    58-78  (466)
165 KOG2071|consensus               50.2      12 0.00026   30.1   1.8   29  120-148   415-443 (579)
166 PF08209 Sgf11:  Sgf11 (transcr  50.2      27 0.00058   16.3   2.4   24   79-103     5-28  (33)
167 PF03811 Zn_Tnp_IS1:  InsA N-te  49.3     2.8   6E-05   20.1  -1.1   30   50-84      6-35  (36)
168 KOG1842|consensus               49.0     9.9 0.00021   29.4   1.2   24   50-73     16-39  (505)
169 cd00730 rubredoxin Rubredoxin;  48.5     8.5 0.00018   20.0   0.6   12  153-164     2-13  (50)
170 KOG3507|consensus               48.1      13 0.00028   19.9   1.2   13  122-134    36-48  (62)
171 COG1773 Rubredoxin [Energy pro  48.0     7.7 0.00017   20.6   0.4   11  153-163     4-14  (55)
172 PF01363 FYVE:  FYVE zinc finge  47.9      11 0.00025   20.6   1.1   29   50-91     10-38  (69)
173 PF13453 zf-TFIIB:  Transcripti  47.5      12 0.00027   18.2   1.1   18   79-96     20-37  (41)
174 KOG1280|consensus               47.2      16 0.00034   27.4   2.0   39  121-159    77-116 (381)
175 PF14446 Prok-RING_1:  Prokaryo  46.9      15 0.00033   19.4   1.4   12   79-90      6-17  (54)
176 PF01428 zf-AN1:  AN1-like Zinc  46.6     8.5 0.00018   19.1   0.4   14   78-91     13-26  (43)
177 KOG4124|consensus               45.9       3 6.4E-05   31.0  -1.8   52  121-172   347-418 (442)
178 TIGR00416 sms DNA repair prote  45.8      13 0.00029   29.1   1.6   11   49-59      7-17  (454)
179 PRK11823 DNA repair protein Ra  45.7      13 0.00029   29.0   1.6   24   48-86      6-29  (446)
180 KOG2907|consensus               45.3     9.1  0.0002   23.5   0.5   40  124-164    75-114 (116)
181 KOG0320|consensus               45.2      15 0.00033   24.7   1.5   48   41-88    123-177 (187)
182 KOG1842|consensus               45.2      13 0.00028   28.8   1.3   28  122-149    14-41  (505)
183 COG4896 Uncharacterized protei  44.8      12 0.00025   20.3   0.8   40   50-90      3-43  (68)
184 KOG4727|consensus               44.5      15 0.00033   24.4   1.4   25  120-144    72-96  (193)
185 KOG0717|consensus               44.4      14  0.0003   28.8   1.4   40   50-102   293-332 (508)
186 COG5112 UFD2 U1-like Zn-finger  44.1      21 0.00045   21.7   1.8   28   44-71     50-77  (126)
187 PF04423 Rad50_zn_hook:  Rad50   43.5      10 0.00023   19.8   0.5   13   80-92     22-34  (54)
188 PRK00564 hypA hydrogenase nick  43.5      13 0.00027   23.2   0.9   27  122-160    70-96  (117)
189 KOG0402|consensus               42.9     9.7 0.00021   22.0   0.3   14  121-134    52-65  (92)
190 PRK03681 hypA hydrogenase nick  42.7      17 0.00036   22.5   1.4   13   78-90     70-82  (114)
191 PF14311 DUF4379:  Domain of un  42.1      19 0.00041   18.8   1.4   16   50-65     29-44  (55)
192 PTZ00448 hypothetical protein;  41.8      20 0.00043   27.2   1.8   23   49-71    314-336 (373)
193 PF00301 Rubredoxin:  Rubredoxi  41.6     8.7 0.00019   19.6   0.0   11  153-163     2-12  (47)
194 PRK14892 putative transcriptio  41.3     9.1  0.0002   23.1   0.1   37  121-165    19-55  (99)
195 COG5152 Uncharacterized conser  41.2      62  0.0014   22.3   3.9   54   44-97    191-253 (259)
196 cd00924 Cyt_c_Oxidase_Vb Cytoc  41.0      17 0.00037   21.8   1.2   14   77-90     78-91  (97)
197 KOG4477|consensus               40.9      24 0.00053   23.8   2.0   29  116-159    17-45  (228)
198 PF10013 DUF2256:  Uncharacteri  40.6      18  0.0004   17.9   1.0   16  125-140    10-25  (42)
199 KOG2593|consensus               40.5      27 0.00058   27.1   2.3   35  121-159   126-160 (436)
200 KOG1701|consensus               40.5      14  0.0003   28.5   0.9   39   51-90    276-314 (468)
201 PF11781 RRN7:  RNA polymerase   39.8      20 0.00043   17.1   1.1   12  120-131    22-33  (36)
202 COG1998 RPS31 Ribosomal protei  39.5      16 0.00035   18.8   0.8   25  125-161    21-46  (51)
203 PF02748 PyrI_C:  Aspartate car  39.3      15 0.00032   19.2   0.6   18  118-135    30-47  (52)
204 KOG2807|consensus               39.2      77  0.0017   23.7   4.4   69   78-146   290-368 (378)
205 KOG0717|consensus               38.9      19 0.00042   28.1   1.4   22  124-145   293-314 (508)
206 COG2331 Uncharacterized protei  38.7     7.6 0.00017   22.0  -0.5   33  122-162    11-43  (82)
207 cd01121 Sms Sms (bacterial rad  38.7      18 0.00039   27.6   1.3    8   79-86     15-22  (372)
208 COG3091 SprT Zn-dependent meta  38.7      34 0.00075   22.4   2.3   36  120-161   114-149 (156)
209 KOG2636|consensus               38.4      25 0.00054   27.4   1.9   27   72-99    396-423 (497)
210 PLN02294 cytochrome c oxidase   38.3      16 0.00035   24.4   0.8   15  151-165   140-154 (174)
211 PF01155 HypA:  Hydrogenase exp  38.2      13 0.00029   22.9   0.4   26  123-161    70-95  (113)
212 PTZ00448 hypothetical protein;  37.9      23  0.0005   26.8   1.7   21  153-173   315-335 (373)
213 KOG1994|consensus               37.6      13 0.00029   25.9   0.4   22  150-172   238-259 (268)
214 COG4306 Uncharacterized protei  37.1     9.2  0.0002   23.9  -0.4   14  123-136    68-81  (160)
215 PRK12496 hypothetical protein;  37.1      26 0.00056   23.3   1.7   29  123-164   127-155 (164)
216 cd00065 FYVE FYVE domain; Zinc  35.8      29 0.00062   18.0   1.5   10  125-134     4-13  (57)
217 PF11931 DUF3449:  Domain of un  35.6      12 0.00027   25.6   0.0   24  150-173    99-123 (196)
218 COG1779 C4-type Zn-finger prot  35.1     4.9 0.00011   27.4  -1.9   43  121-165    12-56  (201)
219 PRK04351 hypothetical protein;  35.0      19 0.00042   23.5   0.8   34   48-90    111-144 (149)
220 PF01927 Mut7-C:  Mut7-C RNAse   35.0      24 0.00051   22.9   1.2   18  153-170   125-142 (147)
221 PRK00420 hypothetical protein;  34.2      35 0.00076   21.1   1.8   15  121-135    38-52  (112)
222 COG1675 TFA1 Transcription ini  33.8      27 0.00059   23.5   1.4   30  121-160   111-140 (176)
223 CHL00174 accD acetyl-CoA carbo  33.6      20 0.00043   26.4   0.8   33   50-92     39-71  (296)
224 PLN03238 probable histone acet  33.6      29 0.00063   25.4   1.6   22  122-143    47-68  (290)
225 PLN03238 probable histone acet  33.4      53  0.0011   24.1   2.8   25  150-174    46-70  (290)
226 PF07911 DUF1677:  Protein of u  33.3      28 0.00061   20.6   1.2   39   50-90      5-43  (91)
227 PRK14714 DNA polymerase II lar  33.1      35 0.00076   30.4   2.2   28  122-161   691-718 (1337)
228 PF07503 zf-HYPF:  HypF finger;  33.0     4.8  0.0001   19.1  -1.6   10   79-88     22-31  (35)
229 smart00064 FYVE Protein presen  32.4      32  0.0007   18.7   1.4   11  124-134    11-21  (68)
230 COG2879 Uncharacterized small   32.3      56  0.0012   17.8   2.1   17   61-77     24-40  (65)
231 PF06397 Desulfoferrod_N:  Desu  32.2      23  0.0005   17.0   0.6   11   78-88      6-16  (36)
232 TIGR00622 ssl1 transcription f  31.9      28  0.0006   21.6   1.1   20   79-98     82-101 (112)
233 PF13821 DUF4187:  Domain of un  31.3      49  0.0011   17.5   1.8   18   79-96     28-45  (55)
234 PHA02998 RNA polymerase subuni  31.2      14 0.00031   24.7  -0.2   40  122-165   142-184 (195)
235 PF05290 Baculo_IE-1:  Baculovi  30.9      39 0.00085   21.6   1.7   15  153-167   122-136 (140)
236 PRK03564 formate dehydrogenase  30.8      17 0.00037   26.9   0.1   11   48-58    186-196 (309)
237 KOG4118|consensus               30.7      28 0.00062   19.1   0.9   26   79-104    39-64  (74)
238 COG2956 Predicted N-acetylgluc  30.7      58  0.0013   24.6   2.7   16   72-87    348-363 (389)
239 KOG3214|consensus               30.7      26 0.00055   21.1   0.8   15  122-136    46-60  (109)
240 PF10263 SprT-like:  SprT-like   30.6      15 0.00032   23.9  -0.2   33   48-89    122-154 (157)
241 COG4391 Uncharacterized protei  30.5      30 0.00065   18.8   1.0   16  120-135    45-60  (62)
242 PRK00762 hypA hydrogenase nick  30.4      19 0.00042   22.6   0.3   31  122-159    69-99  (124)
243 COG4338 Uncharacterized protei  30.4      20 0.00043   18.3   0.2   19   79-97     13-31  (54)
244 PF03145 Sina:  Seven in absent  30.4      50  0.0011   22.5   2.3   51  123-177    14-72  (198)
245 KOG3556|consensus               30.0      43 0.00094   26.8   2.0   12   46-57    555-566 (724)
246 PRK05654 acetyl-CoA carboxylas  29.5      25 0.00054   25.8   0.8   33   50-92     28-60  (292)
247 smart00440 ZnF_C2C2 C2C2 Zinc   29.5      21 0.00045   17.4   0.2    9  124-132    29-37  (40)
248 COG0068 HypF Hydrogenase matur  29.4     7.6 0.00016   32.0  -2.0   11  122-132   172-182 (750)
249 PF09845 DUF2072:  Zn-ribbon co  29.2      26 0.00056   22.3   0.7   15   49-63      1-15  (131)
250 TIGR03826 YvyF flagellar opero  29.2      34 0.00074   22.0   1.2   17  119-135    77-93  (137)
251 COG1439 Predicted nucleic acid  29.1      37  0.0008   22.9   1.4   25  122-161   138-162 (177)
252 TIGR00515 accD acetyl-CoA carb  29.0      37 0.00081   24.9   1.5   32  124-165    27-58  (285)
253 KOG2071|consensus               28.8      35 0.00075   27.6   1.4   26  150-175   416-441 (579)
254 PF11789 zf-Nse:  Zinc-finger o  28.7      38 0.00083   18.0   1.2   32   48-84     23-54  (57)
255 COG4888 Uncharacterized Zn rib  28.6      10 0.00022   22.8  -1.1   12  123-134    46-57  (104)
256 PRK05452 anaerobic nitric oxid  28.6      20 0.00044   28.3   0.1   19   44-62    420-438 (479)
257 PF09416 UPF1_Zn_bind:  RNA hel  28.5      81  0.0018   20.7   2.8   39  122-160    13-68  (152)
258 smart00731 SprT SprT homologue  27.9      24 0.00051   22.8   0.4   34  122-163   111-144 (146)
259 PF10058 DUF2296:  Predicted in  27.7      53  0.0011   17.3   1.6   35   45-86     18-52  (54)
260 TIGR03831 YgiT_finger YgiT-typ  27.6      28 0.00061   17.0   0.5   11   79-89     33-43  (46)
261 PRK05978 hypothetical protein;  27.5      19 0.00041   23.5  -0.1   10  125-134    54-63  (148)
262 PLN03239 histone acetyltransfe  27.3      45 0.00097   25.2   1.7   25  121-145   104-128 (351)
263 KOG0782|consensus               27.0      15 0.00032   29.6  -0.8   15  123-137   276-290 (1004)
264 PF12760 Zn_Tnp_IS1595:  Transp  27.0      86  0.0019   15.6   2.3    7   79-85     19-25  (46)
265 PLN00104 MYST -like histone ac  26.9      43 0.00093   26.3   1.6   25  121-145   196-220 (450)
266 PF09332 Mcm10:  Mcm10 replicat  26.9      15 0.00032   27.6  -0.8   42  123-164   252-297 (344)
267 COG5188 PRP9 Splicing factor 3  26.8      30 0.00066   26.0   0.8   21  153-173   239-259 (470)
268 PTZ00064 histone acetyltransfe  26.5      49  0.0011   26.4   1.8   25  121-145   278-302 (552)
269 PF09082 DUF1922:  Domain of un  26.3      33 0.00072   19.1   0.7   15  120-135    17-31  (68)
270 PF11672 DUF3268:  Protein of u  26.3      19 0.00041   21.9  -0.3   35  122-159     1-38  (102)
271 TIGR01384 TFS_arch transcripti  25.9      30 0.00065   20.8   0.5    9  124-132    17-25  (104)
272 PF01215 COX5B:  Cytochrome c o  25.9      32 0.00069   22.1   0.7   15   77-91    111-125 (136)
273 PRK12722 transcriptional activ  25.7      43 0.00092   22.9   1.2   28   50-86    135-162 (187)
274 COG2824 PhnA Uncharacterized Z  25.2      18 0.00039   22.0  -0.5   11  153-163    21-31  (112)
275 PF15135 UPF0515:  Uncharacteri  25.0      54  0.0012   23.4   1.7   14  122-135   154-167 (278)
276 TIGR03829 YokU_near_AblA uncha  25.0      51  0.0011   19.5   1.3   21   77-97     34-54  (89)
277 PLN03239 histone acetyltransfe  24.7      42 0.00091   25.3   1.2   24  150-173   104-127 (351)
278 PF05191 ADK_lid:  Adenylate ki  24.6      34 0.00073   16.3   0.5   31  124-163     2-32  (36)
279 PF01096 TFIIS_C:  Transcriptio  24.3      25 0.00054   17.0  -0.0   10  124-133    29-38  (39)
280 KOG0562|consensus               23.9      44 0.00095   22.3   1.0   25  152-176   153-177 (184)
281 PTZ00064 histone acetyltransfe  23.6      47   0.001   26.5   1.3   23  152-174   280-302 (552)
282 PTZ00043 cytochrome c oxidase   23.5      44 0.00095   23.5   1.0   16  150-165   179-194 (268)
283 TIGR00627 tfb4 transcription f  23.5      70  0.0015   23.4   2.1   27  121-162   253-279 (279)
284 PLN00104 MYST -like histone ac  23.4      43 0.00094   26.3   1.1   25  150-174   196-220 (450)
285 PF10071 DUF2310:  Zn-ribbon-co  23.4      29 0.00062   25.0   0.1   37  121-165   218-254 (258)
286 PF12230 PRP21_like_P:  Pre-mRN  23.4      27 0.00058   24.5   0.0   22  152-174   168-189 (229)
287 PRK01343 zinc-binding protein;  22.8      52  0.0011   17.6   1.0   12  152-163     9-20  (57)
288 PF14255 Cys_rich_CPXG:  Cystei  22.7      39 0.00084   17.7   0.5   11   80-90      2-12  (52)
289 PF08792 A2L_zn_ribbon:  A2L zi  22.6      56  0.0012   15.2   1.0   14  121-134    19-32  (33)
290 PRK12860 transcriptional activ  22.5      53  0.0011   22.5   1.2   12   50-61    135-146 (189)
291 COG1326 Uncharacterized archae  22.3      75  0.0016   21.8   1.9   35   50-90      7-42  (201)
292 PLN02748 tRNA dimethylallyltra  22.1      59  0.0013   25.8   1.6   22   78-99    418-440 (468)
293 KOG1940|consensus               22.1      97  0.0021   22.7   2.5   58   79-143   197-254 (276)
294 PF11494 Ta0938:  Ta0938;  Inte  22.0      48   0.001   19.8   0.8   40  120-165    11-50  (105)
295 TIGR00244 transcriptional regu  21.8      40 0.00087   22.0   0.6   13  153-165    29-41  (147)
296 PF08271 TF_Zn_Ribbon:  TFIIB z  21.2      93   0.002   15.2   1.7   13  121-133    17-29  (43)
297 smart00661 RPOL9 RNA polymeras  21.1      39 0.00085   17.1   0.3   13  152-164    20-32  (52)
298 KOG2747|consensus               21.0      51  0.0011   25.4   1.0   21  124-144   159-179 (396)
299 COG0675 Transposase and inacti  20.7      58  0.0013   24.0   1.3   26   50-91    310-335 (364)
300 PF14205 Cys_rich_KTR:  Cystein  20.7      30 0.00066   18.3  -0.1   12  150-161    26-37  (55)
301 PF03107 C1_2:  C1 domain;  Int  20.3      56  0.0012   14.6   0.7    9  153-161     1-9   (30)
302 PF12773 DZR:  Double zinc ribb  20.3      43 0.00094   16.8   0.4   27  124-162    13-39  (50)
303 COG3364 Zn-ribbon containing p  20.2      44 0.00096   20.2   0.5   14   49-62      2-15  (112)
304 PF03966 Trm112p:  Trm112p-like  20.0      52  0.0011   18.0   0.7   17  119-135    49-65  (68)
305 PF13240 zinc_ribbon_2:  zinc-r  20.0      43 0.00092   14.1   0.3    6  155-160    16-21  (23)

No 1  
>KOG2462|consensus
Probab=99.95  E-value=5.4e-28  Score=164.27  Aligned_cols=129  Identities=26%  Similarity=0.507  Sum_probs=112.1

Q ss_pred             CCCCccccCccchhccChHHHHHHHHHHhCC--CCceeCCCCccccccchHHHhHHHHhcCCCCCCCCccccc-------
Q psy16601         45 AGEDVFACPKCSKTYLRQYTLNAHLRYECGK--RPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYR-------  115 (177)
Q Consensus        45 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~--~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~-------  115 (177)
                      .....|+|..||+.+.+..+|.+|.+.|...  ++-+.|+.|++.|.+...|.+|+++|.-.-.+..|.+.|.       
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             ccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhc
Confidence            3456699999999999999999999999753  3458999999999999999999988886667777776665       


Q ss_pred             --cccCCCCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccchhHHHHHHhh
Q psy16601        116 --RNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       116 --~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                        .++.+||||.|..|+|+|.++++|+.||++|.+.++ |+|..|+|.|+..+.|.+|...
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-HQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc-ccCcchhhHHHHHHHHHHhhhh
Confidence              688899999999999999999999999999998665 9999999999999999999863


No 2  
>KOG2462|consensus
Probab=99.84  E-value=9.5e-22  Score=134.04  Aligned_cols=98  Identities=23%  Similarity=0.465  Sum_probs=84.0

Q ss_pred             ceeCCCCccccccchHHHhHHHHhcCCC-----CCCCCcccccccc-------CCCCceecCCccccccChhHHHHHHHH
Q psy16601         78 KFKCPHCNKKCHQKCNLKSHIALKHDQL-----LAPLAPRSYRRNS-------QLNGSFICPKCSNRYVYKHNLKQHLKF  145 (177)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~-----~~~~~~~~~~~~~-------~~~~~~~C~~C~~~f~~~~~l~~H~~~  145 (177)
                      .|.|++||+.+.+..+|.+|...|....     .++.|++.+....       ..+-+.+|.+|||.|...+.|+.|+|+
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRT  209 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRT  209 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhccccc
Confidence            3999999999999999999998887653     3466666665322       223578999999999999999999999


Q ss_pred             hhCCCCCccCCCCcccccchhHHHHHHhhhc
Q psy16601        146 ECGVEPQFKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       146 h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                      |+| |+||.|+.|++.|++++||+.||++|-
T Consensus       210 HTG-EKPF~C~hC~kAFADRSNLRAHmQTHS  239 (279)
T KOG2462|consen  210 HTG-EKPFSCPHCGKAFADRSNLRAHMQTHS  239 (279)
T ss_pred             ccC-CCCccCCcccchhcchHHHHHHHHhhc
Confidence            999 777999999999999999999999985


No 3  
>KOG3576|consensus
Probab=99.81  E-value=2.1e-20  Score=121.97  Aligned_cols=113  Identities=26%  Similarity=0.513  Sum_probs=102.9

Q ss_pred             CCCccccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCcee
Q psy16601         46 GEDVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFI  125 (177)
Q Consensus        46 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~  125 (177)
                      +...|.|.+|++.|.-..-|.+|++.|...++ |.|..||+.|....+|.+|+++|.|                 -+||+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr-~lct~cgkgfndtfdlkrh~rthtg-----------------vrpyk  175 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKR-HLCTFCGKGFNDTFDLKRHTRTHTG-----------------VRPYK  175 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHH-HHHhhccCcccchhhhhhhhccccC-----------------ccccc
Confidence            45679999999999999999999999998877 9999999999999999999988876                 58999


Q ss_pred             cCCccccccChhHHHHHHHHhhCC----------CCCccCCCCcccccchhHHHHHHhhhc
Q psy16601        126 CPKCSNRYVYKHNLKQHLKFECGV----------EPQFKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       126 C~~C~~~f~~~~~l~~H~~~h~~~----------~~~~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                      |..|+++|..+-.|..|++.-||.          .+.|.|..||+.-.....+..|+..||
T Consensus       176 c~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~h  236 (267)
T KOG3576|consen  176 CSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHH  236 (267)
T ss_pred             hhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcC
Confidence            999999999999999999976664          446999999999999999999999887


No 4  
>KOG1074|consensus
Probab=99.79  E-value=5.4e-20  Score=141.29  Aligned_cols=57  Identities=32%  Similarity=0.620  Sum_probs=51.7

Q ss_pred             CccccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhcCCC
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKHDQL  105 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~  105 (177)
                      .+++|.+|.+.|....+|+.|.+.|+++.+ |+|++||..|.++++|+.|...|+...
T Consensus       352 ~khkCr~CakvfgS~SaLqiHlRSHTGERP-fqCnvCG~~FSTkGNLKvH~~rH~e~~  408 (958)
T KOG1074|consen  352 FKHKCRFCAKVFGSDSALQIHLRSHTGERP-FQCNVCGNRFSTKGNLKVHFQRHREKY  408 (958)
T ss_pred             ccchhhhhHhhcCchhhhhhhhhccCCCCC-eeecccccccccccceeeeeeeccccC
Confidence            346899999999999999999999999855 999999999999999999998887653


No 5  
>KOG3623|consensus
Probab=99.75  E-value=7.2e-19  Score=133.56  Aligned_cols=121  Identities=31%  Similarity=0.683  Sum_probs=100.2

Q ss_pred             CccccCccchhccChHHHHHHHHHHh-CCCCceeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceec
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYEC-GKRPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFIC  126 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~-~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C  126 (177)
                      ....|+.|++.+.+...|+.|++..+ .....|.|.+|...|.....|.+|+..|-......    ..-......+.|+|
T Consensus       209 qlltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa----~sltqsa~lRKFKC  284 (1007)
T KOG3623|consen  209 QLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQA----ISLTQSALLRKFKC  284 (1007)
T ss_pred             hhhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCccc----ccccchhhhccccc
Confidence            44789999999999999999988654 44456999999999999999999998776532211    11122234567999


Q ss_pred             CCccccccChhHHHHHHHHhhCCCCCccCCCCcccccchhHHHHHHh
Q psy16601        127 PKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLKGNLMSHIA  173 (177)
Q Consensus       127 ~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~  173 (177)
                      ..|+|+|+.+..|..|+|+|.| ++||.|+.|+|+|+.+..+..||-
T Consensus       285 tECgKAFKfKHHLKEHlRIHSG-EKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  285 TECGKAFKFKHHLKEHLRIHSG-EKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             cccchhhhhHHHHHhhheeecC-CCCcCCcccccccccCCccccccc
Confidence            9999999999999999999999 777999999999999999999985


No 6  
>KOG1074|consensus
Probab=99.72  E-value=6.1e-18  Score=130.18  Aligned_cols=52  Identities=23%  Similarity=0.634  Sum_probs=48.8

Q ss_pred             eecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccchhHHHHHHhhhc
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                      ..|..|++.|.....|..|+++|++ +++|.|.+|++.|..+.+|+.||.+|+
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg-~KPF~C~fC~~aFttrgnLKvHMgtH~  931 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTG-PKPFFCHFCEEAFTTRGNLKVHMGTHM  931 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCC-CCCccchhhhhhhhhhhhhhhhhcccc
Confidence            4599999999999999999999999 556999999999999999999999886


No 7  
>KOG3608|consensus
Probab=99.71  E-value=1.5e-17  Score=117.12  Aligned_cols=107  Identities=24%  Similarity=0.622  Sum_probs=53.9

Q ss_pred             ccccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCC
Q psy16601         49 VFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPK  128 (177)
Q Consensus        49 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~  128 (177)
                      +|.|..|.+.|.++..|..||..|..-   |+|+.|+-.....+.|.+|++..|.                .++||+|..
T Consensus       237 ~fqC~~C~KrFaTeklL~~Hv~rHvn~---ykCplCdmtc~~~ssL~~H~r~rHs----------------~dkpfKCd~  297 (467)
T KOG3608|consen  237 SFQCAQCFKRFATEKLLKSHVVRHVNC---YKCPLCDMTCSSASSLTTHIRYRHS----------------KDKPFKCDE  297 (467)
T ss_pred             chHHHHHHHHHhHHHHHHHHHHHhhhc---ccccccccCCCChHHHHHHHHhhhc----------------cCCCccccc
Confidence            344444444444444444444444322   4444444444444444444444443                456666666


Q ss_pred             ccccccChhHHHHHHHHhhCCCCCccCCC--CcccccchhHHHHHHhhhc
Q psy16601        129 CSNRYVYKHNLKQHLKFECGVEPQFKCPY--CDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       129 C~~~f~~~~~l~~H~~~h~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h  176 (177)
                      |++.|.+.+.|.+|...|.  +..|+|..  |.+.|.....|++|++.+|
T Consensus       298 Cd~~c~~esdL~kH~~~HS--~~~y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  298 CDTRCVRESDLAKHVQVHS--KTVYQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             hhhhhccHHHHHHHHHhcc--ccceecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            6666666666666666554  22245544  4444444444444444443


No 8  
>KOG3608|consensus
Probab=99.68  E-value=9.5e-17  Score=113.08  Aligned_cols=112  Identities=23%  Similarity=0.557  Sum_probs=100.5

Q ss_pred             CccccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecC
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICP  127 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~  127 (177)
                      .-|+|++|+......++|..|++..+.+.+||+|..|++.|....+|.+|...|.                  +..|.|.
T Consensus       262 n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS------------------~~~y~C~  323 (467)
T KOG3608|consen  262 NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS------------------KTVYQCE  323 (467)
T ss_pred             hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc------------------ccceecC
Confidence            3489999999999999999999998888888999999999999999999997542                  4569997


Q ss_pred             C--ccccccChhHHHHHHHHhhC--CCCCccCCCCcccccchhHHHHHHhhhcC
Q psy16601        128 K--CSNRYVYKHNLKQHLKFECG--VEPQFKCPYCDKRCKLKGNLMSHIALKHT  177 (177)
Q Consensus       128 ~--C~~~f~~~~~l~~H~~~h~~--~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  177 (177)
                      .  |..+|.+...+++|++.++.  ...+|.|..|++.|++..+|.+|++..|+
T Consensus       324 h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  324 HPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             CCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhc
Confidence            6  99999999999999998873  35579999999999999999999998875


No 9  
>KOG3623|consensus
Probab=99.65  E-value=3e-17  Score=124.89  Aligned_cols=78  Identities=26%  Similarity=0.585  Sum_probs=72.3

Q ss_pred             ceeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCCccccccChhHHHHHHHHhhCCCCCccCCC
Q psy16601         78 KFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPY  157 (177)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~  157 (177)
                      +|.|.+|++.|...+.|.+|.=.|.                 +.+||+|..|.|+|+.+..|..|+|.|.| ++||+|+.
T Consensus       894 myaCDqCDK~FqKqSSLaRHKYEHs-----------------GqRPyqC~iCkKAFKHKHHLtEHkRLHSG-EKPfQCdK  955 (1007)
T KOG3623|consen  894 MYACDQCDKAFQKQSSLARHKYEHS-----------------GQRPYQCIICKKAFKHKHHLTEHKRLHSG-EKPFQCDK  955 (1007)
T ss_pred             cchHHHHHHHHHhhHHHHHhhhhhc-----------------CCCCcccchhhHhhhhhhhhhhhhhhccC-CCcchhhh
Confidence            6999999999999999999984444                 57999999999999999999999999999 77799999


Q ss_pred             CcccccchhHHHHHHh
Q psy16601        158 CDKRCKLKGNLMSHIA  173 (177)
Q Consensus       158 C~~~f~~~~~l~~H~~  173 (177)
                      |+|+|+.+..+.+||.
T Consensus       956 ClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  956 CLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             hhhhcccccchHhhhc
Confidence            9999999999999984


No 10 
>KOG3576|consensus
Probab=99.61  E-value=1.2e-16  Score=104.65  Aligned_cols=82  Identities=28%  Similarity=0.564  Sum_probs=74.9

Q ss_pred             ceeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCCccccccChhHHHHHHHHhhCCCCCccCCC
Q psy16601         78 KFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPY  157 (177)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~  157 (177)
                      .|.|.+|++.|.-...|.+|++-|.                 .-+.+-|.+||+.|.+.-.|.+|+++|+|.++ |+|..
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~-----------------~vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~  178 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHS-----------------DVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSL  178 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhcc-----------------HHHHHHHhhccCcccchhhhhhhhccccCccc-cchhh
Confidence            4999999999999999999996554                 35789999999999999999999999999555 99999


Q ss_pred             CcccccchhHHHHHHhhhcC
Q psy16601        158 CDKRCKLKGNLMSHIALKHT  177 (177)
Q Consensus       158 C~~~f~~~~~l~~H~~~~h~  177 (177)
                      |++.|...-.|..|++..||
T Consensus       179 c~kaftqrcsleshl~kvhg  198 (267)
T KOG3576|consen  179 CEKAFTQRCSLESHLKKVHG  198 (267)
T ss_pred             hhHHHHhhccHHHHHHHHcC
Confidence            99999999999999998886


No 11 
>KOG3993|consensus
Probab=99.45  E-value=1.8e-14  Score=103.81  Aligned_cols=130  Identities=22%  Similarity=0.410  Sum_probs=99.3

Q ss_pred             CCCccccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhcCCCCCC-------CCc----ccc
Q psy16601         46 GEDVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAP-------LAP----RSY  114 (177)
Q Consensus        46 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~-------~~~----~~~  114 (177)
                      ..+.|.|.+|...|.....|.+|...-.-..- |+|++|++.|....+|..|.+.|-......       ...    ..-
T Consensus       264 ~iGdyiCqLCK~kYeD~F~LAQHrC~RIV~vE-YrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~  342 (500)
T KOG3993|consen  264 VIGDYICQLCKEKYEDAFALAQHRCPRIVHVE-YRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEV  342 (500)
T ss_pred             cHHHHHHHHHHHhhhhHHHHhhccCCeeEEee-ecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhh
Confidence            33459999999999999999999765433334 999999999999999999999887532111       100    000


Q ss_pred             -----ccccCCCCceecCCccccccChhHHHHHHHHhhCC----------------------------------------
Q psy16601        115 -----RRNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGV----------------------------------------  149 (177)
Q Consensus       115 -----~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~----------------------------------------  149 (177)
                           .-....++.|.|..|++.|.....|++|+.+|+..                                        
T Consensus       343 ~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl  422 (500)
T KOG3993|consen  343 QEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVL  422 (500)
T ss_pred             hhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhccccccccccccccccccccccccee
Confidence                 01113456899999999999999999999888653                                        


Q ss_pred             ---------------------------------CCCccCCCCcccccchhHHHHHHhhhc
Q psy16601        150 ---------------------------------EPQFKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       150 ---------------------------------~~~~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                                                       +.-|.|.+|.-.|-++.+|.+|+...|
T Consensus       423 ~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~H  482 (500)
T KOG3993|consen  423 YVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCH  482 (500)
T ss_pred             eeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcC
Confidence                                             114899999999999999999997765


No 12 
>PHA00733 hypothetical protein
Probab=99.37  E-value=5.7e-13  Score=83.71  Aligned_cols=84  Identities=20%  Similarity=0.390  Sum_probs=65.0

Q ss_pred             CceeCCCCccccccchHHHhH--HHHhcCCCCCCCCccccccccCCCCceecCCccccccChhHHHHHHHHhhCCCCCcc
Q psy16601         77 PKFKCPHCNKKCHQKCNLKSH--IALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFK  154 (177)
Q Consensus        77 ~~~~C~~C~~~f~~~~~l~~H--~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~  154 (177)
                      +++.|.+|...|.....|..+  +..+.              ....+++|.|..|++.|.....|..|++.|   ..+|.
T Consensus        39 ~~~~~~~~~~~~~~~~~l~~~~~l~~~~--------------~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h---~~~~~  101 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQLLDESSYLYKLL--------------TSKAVSPYVCPLCLMPFSSSVSLKQHIRYT---EHSKV  101 (128)
T ss_pred             hhHHHHHHhhhccChhhhcchHHHHhhc--------------ccCCCCCccCCCCCCcCCCHHHHHHHHhcC---CcCcc
Confidence            348888888888777777666  22211              112367899999999999999999999876   23599


Q ss_pred             CCCCcccccchhHHHHHHhhhcC
Q psy16601        155 CPYCDKRCKLKGNLMSHIALKHT  177 (177)
Q Consensus       155 C~~C~~~f~~~~~l~~H~~~~h~  177 (177)
                      |.+|++.|....+|.+|++..|+
T Consensus       102 C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        102 CPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCCccCCHHHHHHHHHHhcC
Confidence            99999999999999999998885


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.36  E-value=2e-12  Score=98.52  Aligned_cols=104  Identities=20%  Similarity=0.400  Sum_probs=84.4

Q ss_pred             CCccccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceec
Q psy16601         47 EDVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFIC  126 (177)
Q Consensus        47 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C  126 (177)
                      .+.+.|..|+..|. ...|..|+..++   .++.|+ ||..+ ....|..|+..+.                 ..+++.|
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H---kpv~Cp-Cg~~~-~R~~L~~H~~thC-----------------p~Kpi~C  507 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH---EPLQCP-CGVVL-EKEQMVQHQASTC-----------------PLRLITC  507 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC---CCccCC-CCCCc-chhHHHhhhhccC-----------------CCCceeC
Confidence            34578999999996 678999999986   449999 99755 5688999986655                 4689999


Q ss_pred             CCcccccc----------ChhHHHHHHHHhhCCCCCccCCCCcccccchhHHHHHHhhhc
Q psy16601        127 PKCSNRYV----------YKHNLKQHLKFECGVEPQFKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       127 ~~C~~~f~----------~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                      .+|++.|.          ....|..|.... | .+++.|..|++.+..+ .|..|+-..|
T Consensus       508 ~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G-~rt~~C~~Cgk~Vrlr-dm~~H~~~~h  564 (567)
T PLN03086        508 RFCGDMVQAGGSAMDVRDRLRGMSEHESIC-G-SRTAPCDSCGRSVMLK-EMDIHQIAVH  564 (567)
T ss_pred             CCCCCccccCccccchhhhhhhHHHHHHhc-C-CcceEccccCCeeeeh-hHHHHHHHhh
Confidence            99999985          235899999886 5 6669999999999876 6888987766


No 14 
>PHA00733 hypothetical protein
Probab=99.21  E-value=1.5e-11  Score=77.29  Aligned_cols=85  Identities=16%  Similarity=0.280  Sum_probs=67.5

Q ss_pred             CCCCccccCccchhccChHHHHHH--HHHH--hCCCCceeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCC
Q psy16601         45 AGEDVFACPKCSKTYLRQYTLNAH--LRYE--CGKRPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQL  120 (177)
Q Consensus        45 ~~~~~~~C~~C~~~f~~~~~l~~H--~~~h--~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~  120 (177)
                      ..++++.|.+|+..|.....|..+  ++.+  .....||.|+.|++.|.+...|..|+..+                   
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h-------------------   96 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT-------------------   96 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC-------------------
Confidence            345678999999999887777665  2221  12235699999999999999999998542                   


Q ss_pred             CCceecCCccccccChhHHHHHHHHhhC
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECG  148 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~  148 (177)
                      +.+|.|..|++.|.....|..|+...|+
T Consensus        97 ~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         97 EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            2458999999999999999999998765


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.20  E-value=7.7e-12  Score=65.42  Aligned_cols=44  Identities=20%  Similarity=0.558  Sum_probs=39.7

Q ss_pred             ceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccchhHHH
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLKGNLM  169 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~  169 (177)
                      .|.|+.||+.|...+.|..|+++|+   ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceecccceeE
Confidence            5899999999999999999999997   4599999999999877653


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.02  E-value=1.2e-10  Score=60.92  Aligned_cols=43  Identities=21%  Similarity=0.592  Sum_probs=38.6

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHH
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLK   95 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~   95 (177)
                      |.|+.||+.|....+|..|++.|.   ++|+|..|++.|...+.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceecccceeE
Confidence            899999999999999999999998   3599999999998776654


No 17 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.93  E-value=1.1e-09  Score=83.87  Aligned_cols=103  Identities=17%  Similarity=0.452  Sum_probs=76.8

Q ss_pred             ccccCccchhccChHHHHHHHHHHhCC------------------CCceeCCCCccccccchHHHhHHHHhcCCCCCCCC
Q psy16601         49 VFACPKCSKTYLRQYTLNAHLRYECGK------------------RPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLA  110 (177)
Q Consensus        49 ~~~C~~C~~~f~~~~~l~~H~~~h~~~------------------~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~  110 (177)
                      ...|.-|...... .+|..|...-...                  ...+.|+.|++.|. ...|..|+..+|        
T Consensus       407 ~V~C~NC~~~i~l-~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--------  476 (567)
T PLN03086        407 TVECRNCKHYIPS-RSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--------  476 (567)
T ss_pred             eEECCCCCCccch-hHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--------
Confidence            3468888877554 4777777543211                  12467899999885 577999987765        


Q ss_pred             ccccccccCCCCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCccccc----------chhHHHHHHhhh
Q psy16601        111 PRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCK----------LKGNLMSHIALK  175 (177)
Q Consensus       111 ~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~----------~~~~l~~H~~~~  175 (177)
                                 +++.|+ |++.+ .+..|..|+.+|.+ ++++.|.+|++.|.          ..+.|..|..+.
T Consensus       477 -----------kpv~Cp-Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C  537 (567)
T PLN03086        477 -----------EPLQCP-CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC  537 (567)
T ss_pred             -----------CCccCC-CCCCc-chhHHHhhhhccCC-CCceeCCCCCCccccCccccchhhhhhhHHHHHHhc
Confidence                       468999 99765 67899999999988 66699999999985          235899998753


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.90  E-value=9.2e-10  Score=49.43  Aligned_cols=26  Identities=42%  Similarity=0.982  Sum_probs=22.7

Q ss_pred             HHHHHHHHhhCCCCCccCCCCcccccc
Q psy16601        138 NLKQHLKFECGVEPQFKCPYCDKRCKL  164 (177)
Q Consensus       138 ~l~~H~~~h~~~~~~~~C~~C~~~f~~  164 (177)
                      +|..|+++|++ +++|.|++|++.|++
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcCeeCc
Confidence            48999999999 566999999999974


No 19 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.83  E-value=8.2e-09  Score=55.07  Aligned_cols=52  Identities=31%  Similarity=0.621  Sum_probs=42.6

Q ss_pred             ceecCCccccccChhHHHHHHHHhhC-CCCCccCCCCcccccchhHHHHHHhhhcC
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKFECG-VEPQFKCPYCDKRCKLKGNLMSHIALKHT  177 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~h~~-~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  177 (177)
                      .|.|++|++ ..+...|..|....|. +.+.+.|++|...+.  .+|.+||..+|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            489999999 5567889999886554 445699999998655  499999999986


No 20 
>KOG3993|consensus
Probab=98.78  E-value=1.1e-09  Score=79.56  Aligned_cols=81  Identities=21%  Similarity=0.488  Sum_probs=68.1

Q ss_pred             eeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCCccccccChhHHHHHHHHhhCC---------
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGV---------  149 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~---------  149 (177)
                      |+|.+|...|.....|.+|...-           .      .---|+|+.|+|.|.=..+|..|.+.|...         
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~R-----------I------V~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~  330 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPR-----------I------VHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSP  330 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCe-----------e------EEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCC
Confidence            89999999999999999996211           0      112499999999999999999999998541         


Q ss_pred             -----------------------CCCccCCCCcccccchhHHHHHHhhhc
Q psy16601        150 -----------------------EPQFKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       150 -----------------------~~~~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                                             .--|.|.+|++.|.+...|+.|+.+||
T Consensus       331 P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  331 PPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             ChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                                   013999999999999999999999887


No 21 
>PHA00732 hypothetical protein
Probab=98.76  E-value=5.3e-09  Score=59.94  Aligned_cols=46  Identities=35%  Similarity=0.582  Sum_probs=39.5

Q ss_pred             ceecCCccccccChhHHHHHHHH-hhCCCCCccCCCCcccccchhHHHHHHhhh
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKF-ECGVEPQFKCPYCDKRCKLKGNLMSHIALK  175 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  175 (177)
                      ||.|..|++.|.....|..|++. |.+    +.|+.|++.|.   +|.+|+.++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~----~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL----TKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC----CccCCCCCEeC---Chhhhhccc
Confidence            58999999999999999999985 543    68999999998   588888653


No 22 
>PHA00616 hypothetical protein
Probab=98.64  E-value=1.4e-08  Score=50.67  Aligned_cols=26  Identities=19%  Similarity=0.492  Sum_probs=21.8

Q ss_pred             CccCCCCcccccchhHHHHHHhhhcC
Q psy16601        152 QFKCPYCDKRCKLKGNLMSHIALKHT  177 (177)
Q Consensus       152 ~~~C~~C~~~f~~~~~l~~H~~~~h~  177 (177)
                      +|+|+.||+.|..+++|.+|++.|||
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg   26 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK   26 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC
Confidence            48888888888888888888888876


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.63  E-value=7.2e-08  Score=51.41  Aligned_cols=52  Identities=33%  Similarity=0.649  Sum_probs=41.9

Q ss_pred             eeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCCccccccChhHHHHHHHHhhC
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFECG  148 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  148 (177)
                      |.|+.|++ ..+...|..|....|..               ..+.+.|+.|...+.  .+|..|+..+|+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~---------------~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRS---------------ESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcC---------------CCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            89999999 55667899999888863               345789999998654  499999998764


No 24 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.62  E-value=3.7e-08  Score=44.17  Aligned_cols=26  Identities=38%  Similarity=0.947  Sum_probs=22.7

Q ss_pred             HHHHHHHHHhCCCCceeCCCCcccccc
Q psy16601         64 TLNAHLRYECGKRPKFKCPHCNKKCHQ   90 (177)
Q Consensus        64 ~l~~H~~~h~~~~~~~~C~~C~~~f~~   90 (177)
                      +|..|++.|.++++ |.|++|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~-~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKP-YKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSS-EEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCC-CCCCCCcCeeCc
Confidence            58899999998866 999999999863


No 25 
>PHA00616 hypothetical protein
Probab=98.58  E-value=2.5e-08  Score=49.75  Aligned_cols=35  Identities=17%  Similarity=0.360  Sum_probs=30.9

Q ss_pred             ceecCCccccccChhHHHHHHHHhhCCCCCccCCCC
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYC  158 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C  158 (177)
                      ||.|..||+.|...+.|..|++.||++ .+|.|+.=
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~-~~~~~~~~   35 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQ-NKLTLEYF   35 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCC-CccceeEE
Confidence            589999999999999999999999995 55888753


No 26 
>PHA00732 hypothetical protein
Probab=98.58  E-value=3.7e-08  Score=56.47  Aligned_cols=49  Identities=35%  Similarity=0.664  Sum_probs=40.2

Q ss_pred             ccccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhcC
Q psy16601         49 VFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKHD  103 (177)
Q Consensus        49 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  103 (177)
                      +|.|..|++.|.+..+|..|++.++.   ++.|+.|++.|.   .+..|+..+.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccCC
Confidence            47899999999999999999985433   278999999997   58888855443


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.49  E-value=6.3e-08  Score=42.16  Aligned_cols=22  Identities=41%  Similarity=0.818  Sum_probs=14.7

Q ss_pred             ccCCCCcccccchhHHHHHHhh
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                      |.|++|++.|++..+|.+|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666665


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.45  E-value=1.2e-07  Score=41.68  Aligned_cols=24  Identities=38%  Similarity=0.854  Sum_probs=16.6

Q ss_pred             ccCCCCcccccchhHHHHHHhhhc
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                      |.|++|++.|.+...|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            567777777777777777777766


No 29 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.37  E-value=1.9e-07  Score=56.41  Aligned_cols=67  Identities=21%  Similarity=0.455  Sum_probs=18.7

Q ss_pred             eCCCCccccccchHHHhHHHHhcCCCCCCCC-----ccc-cccccCCCCceecCCccccccChhHHHHHHHHh
Q psy16601         80 KCPHCNKKCHQKCNLKSHIALKHDQLLAPLA-----PRS-YRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFE  146 (177)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~-----~~~-~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h  146 (177)
                      .|..|+..|.+...|..|+...|+.......     ... ..........+.|..|++.|.+...|..||+.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            3777888888888888888777764322000     000 000111123578888888888888888888865


No 30 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.31  E-value=6.2e-07  Score=38.93  Aligned_cols=23  Identities=35%  Similarity=0.853  Sum_probs=21.6

Q ss_pred             eecCCccccccChhHHHHHHHHh
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFE  146 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h  146 (177)
                      |.|+.|++.|.++..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999875


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.28  E-value=3.9e-07  Score=41.26  Aligned_cols=25  Identities=24%  Similarity=0.387  Sum_probs=17.0

Q ss_pred             CccCCCCcccccchhHHHHHHhhhc
Q psy16601        152 QFKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       152 ~~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                      +|.|..|++.|.+..+|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            3667777777777777777776665


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.17  E-value=1.6e-06  Score=52.36  Aligned_cols=51  Identities=27%  Similarity=0.595  Sum_probs=21.2

Q ss_pred             ccCccchhccChHHHHHHHHHHhCCC----------------------CceeCCCCccccccchHHHhHHHHh
Q psy16601         51 ACPKCSKTYLRQYTLNAHLRYECGKR----------------------PKFKCPHCNKKCHQKCNLKSHIALK  101 (177)
Q Consensus        51 ~C~~C~~~f~~~~~l~~H~~~h~~~~----------------------~~~~C~~C~~~f~~~~~l~~H~~~~  101 (177)
                      +|.+|+..|.+...|..||...|+..                      ..+.|..|++.|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            48999999999999999997766421                      1489999999999999999999865


No 33 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=98.08  E-value=2.1e-06  Score=37.63  Aligned_cols=24  Identities=38%  Similarity=0.794  Sum_probs=17.9

Q ss_pred             ccCCCCcccccchhHHHHHHhhhcC
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIALKHT  177 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~~~h~  177 (177)
                      |+|..|++..+ ...|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            67888888887 7788888888875


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.07  E-value=4.2e-06  Score=36.47  Aligned_cols=24  Identities=33%  Similarity=0.798  Sum_probs=20.5

Q ss_pred             eecCCccccccChhHHHHHHHHhh
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFEC  147 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~  147 (177)
                      |.|..|++.|.+...|..|+.+|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999999875


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.02  E-value=2.1e-06  Score=43.77  Aligned_cols=32  Identities=25%  Similarity=0.526  Sum_probs=14.2

Q ss_pred             HhhCCCCCccCCCCcccccchhHHHHHHhhhc
Q psy16601        145 FECGVEPQFKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       145 ~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                      .+...+.|-.|++|+..+....+|++|+++.|
T Consensus        17 ~~~~S~~PatCP~C~a~~~~srnLrRHle~~H   48 (54)
T PF09237_consen   17 SKSQSEQPATCPICGAVIRQSRNLRRHLEIRH   48 (54)
T ss_dssp             CCCTTS--EE-TTT--EESSHHHHHHHHHHHT
T ss_pred             HhhccCCCCCCCcchhhccchhhHHHHHHHHh
Confidence            33334444555555555555555555555554


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.99  E-value=4.4e-06  Score=37.72  Aligned_cols=26  Identities=23%  Similarity=0.684  Sum_probs=23.8

Q ss_pred             ceecCCccccccChhHHHHHHHHhhC
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKFECG  148 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~h~~  148 (177)
                      +|.|..|++.|.+...|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            58999999999999999999998854


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.80  E-value=1.8e-05  Score=35.01  Aligned_cols=23  Identities=35%  Similarity=0.733  Sum_probs=18.5

Q ss_pred             ccCCCCcccccchhHHHHHHhhh
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIALK  175 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~~~  175 (177)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            57888888888888888888754


No 38 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.79  E-value=1.2e-05  Score=57.09  Aligned_cols=67  Identities=30%  Similarity=0.519  Sum_probs=45.7

Q ss_pred             CceeCCC--CccccccchHHHhHHHHhcCCCCC--CCCccccccccCCCCceecCCccccccChhHHHHHH
Q psy16601         77 PKFKCPH--CNKKCHQKCNLKSHIALKHDQLLA--PLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHL  143 (177)
Q Consensus        77 ~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~--~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  143 (177)
                      +||+|++  |.+.++....|+=|+..-|.....  ...+.........+|||.|.+|+|++++.-.|.-|+
T Consensus       348 KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         348 KPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             ceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            5699988  889999999999997655532211  111111112234568999999999999888887774


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.67  E-value=2.7e-05  Score=39.80  Aligned_cols=32  Identities=25%  Similarity=0.529  Sum_probs=13.8

Q ss_pred             HhCCCCceeCCCCccccccchHHHhHHHHhcC
Q psy16601         72 ECGKRPKFKCPHCNKKCHQKCNLKSHIALKHD  103 (177)
Q Consensus        72 h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  103 (177)
                      +.....|-.|++|+..+.+..+|++|+...|+
T Consensus        18 ~~~S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             CCTTS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             hhccCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            33333445555555555555555555555554


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.64  E-value=2.6e-05  Score=34.41  Aligned_cols=23  Identities=30%  Similarity=0.626  Sum_probs=16.9

Q ss_pred             ccCCCCcccccchhHHHHHHhhh
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIALK  175 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~~~  175 (177)
                      |.|.+|++.|++...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56777777777777777777653


No 41 
>KOG2231|consensus
Probab=97.55  E-value=0.0002  Score=56.49  Aligned_cols=107  Identities=22%  Similarity=0.493  Sum_probs=69.3

Q ss_pred             cccCccchhcc---------------ChHHHHHHHHHHhCCCCceeCCCCcc---------ccccchHHHhHHHHhcCCC
Q psy16601         50 FACPKCSKTYL---------------RQYTLNAHLRYECGKRPKFKCPHCNK---------KCHQKCNLKSHIALKHDQL  105 (177)
Q Consensus        50 ~~C~~C~~~f~---------------~~~~l~~H~~~h~~~~~~~~C~~C~~---------~f~~~~~l~~H~~~~~~~~  105 (177)
                      +.|.+|+..|.               ....|+.|+..-|..   +.|.+|-.         ...+...|..|++.-..  
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~~---~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~--  174 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHKL---HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDP--  174 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhhh---hccccccccceeeeeeeehehHHHHHHHHhcCCC--
Confidence            46777776662               566778888665543   55666521         22344566667643221  


Q ss_pred             CCCCCccccccccCCCCceecCCccccccChhHHHHHHHHhhCCCCCccCCCC------cccccchhHHHHHHhhhc
Q psy16601        106 LAPLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYC------DKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C------~~~f~~~~~l~~H~~~~h  176 (177)
                          +...      -.+--.|.+|...|.....|++|++.+|     |.|..|      +..|+..+.|..|.|..|
T Consensus       175 ----d~~s------~rGhp~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  175 ----DDES------CRGHPLCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             ----cccc------ccCCccchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhcC
Confidence                0111      0112479999999999999999998654     556666      356888899999999877


No 42 
>KOG1146|consensus
Probab=97.53  E-value=6.4e-05  Score=62.68  Aligned_cols=124  Identities=19%  Similarity=0.293  Sum_probs=91.5

Q ss_pred             ccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhcCCCCCCCCcc--------ccccccCCCC
Q psy16601         51 ACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPR--------SYRRNSQLNG  122 (177)
Q Consensus        51 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~--------~~~~~~~~~~  122 (177)
                      .|.-|+..+.+...+..|+..-+...+-|+|+.|+..|.....|..|++..|.......+..        .-..-..+.+
T Consensus       438 e~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~  517 (1406)
T KOG1146|consen  438 ELTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGK  517 (1406)
T ss_pred             cccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCC
Confidence            56677778887777777776654444559999999999999999999999775433311111        0011223457


Q ss_pred             ceecCCccccccChhHHHHHHHHh--hCC----------------------------------------CCCccCCCCcc
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKFE--CGV----------------------------------------EPQFKCPYCDK  160 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~h--~~~----------------------------------------~~~~~C~~C~~  160 (177)
                      +|.|..|...+....+|.+|+..-  ...                                        ++.+.|.+|++
T Consensus       518 p~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~y  597 (1406)
T KOG1146|consen  518 PYPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSY  597 (1406)
T ss_pred             cccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcc
Confidence            899999999999999999998852  111                                        34699999999


Q ss_pred             cccchhHHHHHHhh
Q psy16601        161 RCKLKGNLMSHIAL  174 (177)
Q Consensus       161 ~f~~~~~l~~H~~~  174 (177)
                      .-+-..+|+.||..
T Consensus       598 etniarnlrihmts  611 (1406)
T KOG1146|consen  598 ETNIARNLRIHMTA  611 (1406)
T ss_pred             hhhhhhcccccccc
Confidence            99999999999863


No 43 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.47  E-value=4e-05  Score=54.51  Aligned_cols=53  Identities=28%  Similarity=0.611  Sum_probs=43.8

Q ss_pred             CCceecCC--ccccccChhHHHHHHHHhhC------------------CCCCccCCCCcccccchhHHHHHHh
Q psy16601        121 NGSFICPK--CSNRYVYKHNLKQHLKFECG------------------VEPQFKCPYCDKRCKLKGNLMSHIA  173 (177)
Q Consensus       121 ~~~~~C~~--C~~~f~~~~~l~~H~~~h~~------------------~~~~~~C~~C~~~f~~~~~l~~H~~  173 (177)
                      ++||+|++  |.|.+++.-.|.-|+.--|.                  +.+||.|.+|+|+++....|+-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            58999975  99999999999999874221                  1468999999999999988888764


No 44 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.41  E-value=0.00015  Score=31.85  Aligned_cols=24  Identities=29%  Similarity=0.782  Sum_probs=21.8

Q ss_pred             eecCCccccccChhHHHHHHHHhh
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFEC  147 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~  147 (177)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999999764


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.41  E-value=5.2e-05  Score=34.12  Aligned_cols=22  Identities=32%  Similarity=0.597  Sum_probs=18.5

Q ss_pred             ccCCCCcccccchhHHHHHHhh
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                      |.|..|++.|++..+|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7888888888888888888864


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.39  E-value=0.00021  Score=31.07  Aligned_cols=24  Identities=46%  Similarity=0.762  Sum_probs=19.7

Q ss_pred             eecCCccccccChhHHHHHHHHhhC
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECG  148 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~  148 (177)
                      |.|..|+.... ...|.+|++.|++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999999998 8899999999864


No 47 
>PRK04860 hypothetical protein; Provisional
Probab=97.35  E-value=0.0005  Score=45.07  Aligned_cols=40  Identities=23%  Similarity=0.615  Sum_probs=33.8

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccchh
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLKG  166 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~  166 (177)
                      -+|.|. |+.   ....+++|.++|.+ +++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcC-CccEECCCCCceeEEec
Confidence            579998 987   67889999999999 55599999999887654


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.21  E-value=0.00027  Score=31.01  Aligned_cols=23  Identities=30%  Similarity=0.782  Sum_probs=21.2

Q ss_pred             eecCCccccccChhHHHHHHHHh
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFE  146 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h  146 (177)
                      |.|..|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            68999999999999999999865


No 49 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.93  E-value=0.0014  Score=47.46  Aligned_cols=101  Identities=24%  Similarity=0.483  Sum_probs=64.9

Q ss_pred             cccCc--cchhccChHHHHHHHHHHhCCCCceeCCCCc---cccccc------hHHHhHHHHhcCCCCCCCCcccccccc
Q psy16601         50 FACPK--CSKTYLRQYTLNAHLRYECGKRPKFKCPHCN---KKCHQK------CNLKSHIALKHDQLLAPLAPRSYRRNS  118 (177)
Q Consensus        50 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~---~~f~~~------~~l~~H~~~~~~~~~~~~~~~~~~~~~  118 (177)
                      |.|+.  |.........|..|.+..|+.   +.|.+|-   +.|+.+      ..|+.|...-                 
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~---~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G-----------------  211 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGF---VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGG-----------------  211 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCc---EEhHhhhcCcccCccceeeeecccccccccCC-----------------
Confidence            66755  666666667788888877764   7788873   345433      3455453111                 


Q ss_pred             CCCCce----ecCCccccccChhHHHHHHHHhhCCCCCccCCCCc-------ccccchhHHHHHHhhh
Q psy16601        119 QLNGSF----ICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCD-------KRCKLKGNLMSHIALK  175 (177)
Q Consensus       119 ~~~~~~----~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~-------~~f~~~~~l~~H~~~~  175 (177)
                      ..+.+|    .|.+|...|-+-+.|..|++..|.  +   |.+|+       +.|++...|.+|.+--
T Consensus       212 ~~e~GFKGHP~C~FC~~~FYdDDEL~~HcR~~HE--~---ChICD~v~p~~~QYFK~Y~~Le~HF~~~  274 (493)
T COG5236         212 LEEEGFKGHPLCIFCKIYFYDDDELRRHCRLRHE--A---CHICDMVGPIRYQYFKSYEDLEAHFRNA  274 (493)
T ss_pred             ccccCcCCCchhhhccceecChHHHHHHHHhhhh--h---hhhhhccCccchhhhhCHHHHHHHhhcC
Confidence            111123    699999999999999999996543  3   44443       3577777888887643


No 50 
>KOG2785|consensus
Probab=96.86  E-value=0.0016  Score=47.70  Aligned_cols=53  Identities=17%  Similarity=0.266  Sum_probs=46.4

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCC----------------------CCCccCCCCc---ccccchhHHHHHHhh
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGV----------------------EPQFKCPYCD---KRCKLKGNLMSHIAL  174 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~  174 (177)
                      .|-.|.+|++.+.+-..-..||..+||-                      ..-|.|..|.   +.|.+-.+.+.||+.
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            4567999999999999999999999885                      2248899998   999999999999974


No 51 
>KOG2893|consensus
Probab=96.69  E-value=0.00039  Score=47.65  Aligned_cols=50  Identities=26%  Similarity=0.440  Sum_probs=38.6

Q ss_pred             CCCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccchhHHHHHHhhh
Q psy16601        120 LNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLKGNLMSHIALK  175 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  175 (177)
                      ..++| |.+|++.|.+..-|++|++     -+.|+|.+|.+..-+--.|..|--..
T Consensus         8 ~~kpw-cwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsihcmqv   57 (341)
T KOG2893|consen    8 VDKPW-CWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIHCMQV   57 (341)
T ss_pred             cCCce-eeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceeehhhh
Confidence            34555 7899999999999999976     34499999998776666777665433


No 52 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.65  E-value=0.00052  Score=30.78  Aligned_cols=21  Identities=33%  Similarity=0.706  Sum_probs=14.6

Q ss_pred             eeCCCCccccccchHHHhHHH
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIA   99 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~   99 (177)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            567777777777777777663


No 53 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.55  E-value=0.0022  Score=28.12  Aligned_cols=21  Identities=24%  Similarity=0.615  Sum_probs=13.8

Q ss_pred             ccCCCCcccccchhHHHHHHhh
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                      ..|+.|++.| ..+.|.+|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4677777777 45567777653


No 54 
>KOG1146|consensus
Probab=96.51  E-value=0.00095  Score=56.10  Aligned_cols=54  Identities=24%  Similarity=0.509  Sum_probs=46.9

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCC------------------------CCCccCCCCcccccchhHHHHHHhh
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGV------------------------EPQFKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~------------------------~~~~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                      .+.|+|+.|+..|+....|-.||+..|.+                        .++|.|..|.+.++...+|.+|+..
T Consensus       463 ~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  463 FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             cccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            47899999999999999999999983322                        3369999999999999999999963


No 55 
>PRK04860 hypothetical protein; Provisional
Probab=96.50  E-value=0.0022  Score=42.03  Aligned_cols=39  Identities=26%  Similarity=0.569  Sum_probs=32.9

Q ss_pred             CccccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccc
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQK   91 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~   91 (177)
                      -+|.|. |+.   ...+++.|.++|.+..+ |.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEe
Confidence            458998 987   56789999999999876 9999999887654


No 56 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=96.37  E-value=0.017  Score=35.46  Aligned_cols=25  Identities=24%  Similarity=0.578  Sum_probs=17.2

Q ss_pred             ccC----CCCcccccchhHHHHHHhhhcC
Q psy16601        153 FKC----PYCDKRCKLKGNLMSHIALKHT  177 (177)
Q Consensus       153 ~~C----~~C~~~f~~~~~l~~H~~~~h~  177 (177)
                      |.|    ..|++.+.+...|.+|++.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            666    6677777777777777776665


No 57 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=96.28  E-value=0.011  Score=36.30  Aligned_cols=27  Identities=26%  Similarity=0.619  Sum_probs=22.3

Q ss_pred             Cceec----CCccccccChhHHHHHHHHhhC
Q psy16601        122 GSFIC----PKCSNRYVYKHNLKQHLKFECG  148 (177)
Q Consensus       122 ~~~~C----~~C~~~f~~~~~l~~H~~~h~~  148 (177)
                      .+|.|    ..|+..+.+...+.+|++.+||
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            35888    8898888888899999888765


No 58 
>KOG2482|consensus
Probab=96.28  E-value=0.014  Score=42.48  Aligned_cols=127  Identities=23%  Similarity=0.373  Sum_probs=84.1

Q ss_pred             CccccCccchhccC-hHHHHHHHHHHhCCC---C------------------ceeCCCCccccccchHHHhHHHHhcC-C
Q psy16601         48 DVFACPKCSKTYLR-QYTLNAHLRYECGKR---P------------------KFKCPHCNKKCHQKCNLKSHIALKHD-Q  104 (177)
Q Consensus        48 ~~~~C~~C~~~f~~-~~~l~~H~~~h~~~~---~------------------~~~C~~C~~~f~~~~~l~~H~~~~~~-~  104 (177)
                      ...+|-.|...+.. ++.+..|+-..|+-.   +                  .+.|-.|.+.|..+..|..||+...- .
T Consensus       143 fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrr  222 (423)
T KOG2482|consen  143 FSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRR  222 (423)
T ss_pred             eeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCcc
Confidence            34579999765544 566777765443211   0                  37899999999999999999976432 1


Q ss_pred             CCCC-------------CCcccccc-----------------------ccCCCCc--eecCCccccccChhHHHHHHHHh
Q psy16601        105 LLAP-------------LAPRSYRR-----------------------NSQLNGS--FICPKCSNRYVYKHNLKQHLKFE  146 (177)
Q Consensus       105 ~~~~-------------~~~~~~~~-----------------------~~~~~~~--~~C~~C~~~f~~~~~l~~H~~~h  146 (177)
                      +.+.             ..++++..                       ...+..+  ..|.+|.....+...|..||.+-
T Consensus       223 inPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~v  302 (423)
T KOG2482|consen  223 INPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKIV  302 (423)
T ss_pred             cCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHHH
Confidence            1110             00000000                       0001112  58999999999999999999975


Q ss_pred             hCC--------------------------CCCccCCCCcccccchhHHHHHHhh
Q psy16601        147 CGV--------------------------EPQFKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       147 ~~~--------------------------~~~~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                      |.-                          ...-.|..|.-.|.....|..||..
T Consensus       303 He~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  303 HEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             HHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            542                          2247789999999999999999963


No 59 
>KOG4173|consensus
Probab=96.23  E-value=0.0014  Score=43.95  Aligned_cols=49  Identities=24%  Similarity=0.448  Sum_probs=23.1

Q ss_pred             cccCc--cchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhc
Q psy16601         50 FACPK--CSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKH  102 (177)
Q Consensus        50 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  102 (177)
                      +.|++  |-..|.....+..|..+-|+    -.|..|.+.|.+...|..|+.+-|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E~H  130 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILEWH  130 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHHHH
Confidence            44444  44445444444444332221    455555555555555555554444


No 60 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.10  E-value=0.0037  Score=29.73  Aligned_cols=21  Identities=19%  Similarity=0.474  Sum_probs=16.4

Q ss_pred             ccCCCCcccccchhHHHHHHh
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIA  173 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~  173 (177)
                      |.|.+|+..|.+..++..|+.
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             eEccccCCccCCHHHHHHHHC
Confidence            778888888887777777775


No 61 
>KOG2482|consensus
Probab=96.05  E-value=0.023  Score=41.38  Aligned_cols=113  Identities=17%  Similarity=0.317  Sum_probs=71.6

Q ss_pred             HHHHHHHHHhCCCCceeCCCCcccc-ccchHHHhHHHHhcCCCCCCCCcccccc-----ccCCCCceecCCccccccChh
Q psy16601         64 TLNAHLRYECGKRPKFKCPHCNKKC-HQKCNLKSHIALKHDQLLAPLAPRSYRR-----NSQLNGSFICPKCSNRYVYKH  137 (177)
Q Consensus        64 ~l~~H~~~h~~~~~~~~C~~C~~~f-~~~~~l~~H~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~C~~C~~~f~~~~  137 (177)
                      .|.+|++.-.+......|-.|...+ ...+.+..|+-..|+....-...-++-.     -...-..+.|.+|.+.|.++-
T Consensus       130 aLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkn  209 (423)
T KOG2482|consen  130 ALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKN  209 (423)
T ss_pred             HHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcH
Confidence            3455555444443346799997654 5567788998888875322111111100     000112578999999999999


Q ss_pred             HHHHHHHH--hhCCCC-----------------------------------------------------CccCCCCcccc
Q psy16601        138 NLKQHLKF--ECGVEP-----------------------------------------------------QFKCPYCDKRC  162 (177)
Q Consensus       138 ~l~~H~~~--h~~~~~-----------------------------------------------------~~~C~~C~~~f  162 (177)
                      .|+.||+.  |....+                                                     ..+|-.|....
T Consensus       210 tLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~  289 (423)
T KOG2482|consen  210 TLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFY  289 (423)
T ss_pred             HHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccch
Confidence            99999995  322111                                                     14788888888


Q ss_pred             cchhHHHHHHhhhc
Q psy16601        163 KLKGNLMSHIALKH  176 (177)
Q Consensus       163 ~~~~~l~~H~~~~h  176 (177)
                      -+...|..||...|
T Consensus       290 en~~~l~eHmk~vH  303 (423)
T KOG2482|consen  290 ENPVFLFEHMKIVH  303 (423)
T ss_pred             hhHHHHHHHHHHHH
Confidence            87888888888776


No 62 
>KOG2893|consensus
Probab=95.81  E-value=0.003  Score=43.43  Aligned_cols=49  Identities=27%  Similarity=0.407  Sum_probs=40.2

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhcC
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKHD  103 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  103 (177)
                      -.|..|++.|....-|.+|++..|     |+|.+|.+...+--.|..|-...|.
T Consensus        11 pwcwycnrefddekiliqhqkakh-----fkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKAKH-----FKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             ceeeecccccchhhhhhhhhhhcc-----ceeeeehhhhccCCCceeehhhhhh
Confidence            369999999999999999998776     9999999987777677777555554


No 63 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.64  E-value=0.01  Score=43.19  Aligned_cols=47  Identities=17%  Similarity=0.283  Sum_probs=26.9

Q ss_pred             ccCccchhccChHHHHHHHHHHhCCCCceeCCCCc----cccccchHHHhHHH
Q psy16601         51 ACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCN----KKCHQKCNLKSHIA   99 (177)
Q Consensus        51 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~----~~f~~~~~l~~H~~   99 (177)
                      .|..|..-|.....|..|++..|..  .|+|..=+    .-|++..+|..|.+
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE~--ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHEA--CHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhhh--hhhhhccCccchhhhhCHHHHHHHhh
Confidence            4777777777777777777665532  13333222    23666666766663


No 64 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.57  E-value=0.012  Score=27.85  Aligned_cols=25  Identities=28%  Similarity=0.618  Sum_probs=21.8

Q ss_pred             CceecCCccccccChhHHHHHHHHh
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFE  146 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h  146 (177)
                      .+|.|..|++.|.+...+..|+...
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHChH
Confidence            4689999999999999999998753


No 65 
>KOG2785|consensus
Probab=95.38  E-value=0.013  Score=43.18  Aligned_cols=129  Identities=17%  Similarity=0.189  Sum_probs=75.2

Q ss_pred             ccccCccchhccChHHHHHHHHH--HhCC----------------------------------CCceeCCCCccccccch
Q psy16601         49 VFACPKCSKTYLRQYTLNAHLRY--ECGK----------------------------------RPKFKCPHCNKKCHQKC   92 (177)
Q Consensus        49 ~~~C~~C~~~f~~~~~l~~H~~~--h~~~----------------------------------~~~~~C~~C~~~f~~~~   92 (177)
                      .|.|.-|...|......+.|+++  |.-.                                  ..++.|..|.+.|.+..
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            38999999999998888888875  3200                                  11588999999999999


Q ss_pred             HHHhHHHHhcCCCCCCCCc-------cccc-----c-ccCCCCceecCCccccccChhHHHHHHH------Hh-----hC
Q psy16601         93 NLKSHIALKHDQLLAPLAP-------RSYR-----R-NSQLNGSFICPKCSNRYVYKHNLKQHLK------FE-----CG  148 (177)
Q Consensus        93 ~l~~H~~~~~~~~~~~~~~-------~~~~-----~-~~~~~~~~~C~~C~~~f~~~~~l~~H~~------~h-----~~  148 (177)
                      ....|+...-.........       ....     . .....++-.+..+............+..      +-     ..
T Consensus        83 a~~~hl~Sk~h~~~~~~~~r~~e~d~a~~~q~~~~~p~~l~~~~e~e~~~~E~~~~~d~~~e~~~dd~~Edi~~d~~~e~  162 (390)
T KOG2785|consen   83 AHENHLKSKKHVENLSNHQRSEEGDSAKISQLPSRRPSNLQNKGESELKWYEVDSDEDSSEEEEEDDEEEDIEEDGDDED  162 (390)
T ss_pred             hHHHHHHHhhcchhhhhhhccccccchhhhhccccCccccccCCCcccchhhcccccccchhhccCcchhhhhhccchhc
Confidence            9999987654321110000       0000     0 0011111012222222222111111111      11     11


Q ss_pred             CCCCccCCCCcccccchhHHHHHHhhhcC
Q psy16601        149 VEPQFKCPYCDKRCKLKGNLMSHIALKHT  177 (177)
Q Consensus       149 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  177 (177)
                      +..|-.|..|++.+.+-.....||..+||
T Consensus       163 e~~Pt~CLfC~~~~k~~e~~~~HM~~~Hg  191 (390)
T KOG2785|consen  163 ELIPTDCLFCDKKSKSLEENLKHMFKEHG  191 (390)
T ss_pred             ccCCcceeecCCCcccHHHHHHHHhhccC
Confidence            23358899999999999999999999997


No 66 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.68  E-value=0.026  Score=29.54  Aligned_cols=31  Identities=26%  Similarity=0.650  Sum_probs=24.4

Q ss_pred             CCCCCccccCccchhccChHHHHHHHHHHhC
Q psy16601         44 PAGEDVFACPKCSKTYLRQYTLNAHLRYECG   74 (177)
Q Consensus        44 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~   74 (177)
                      -+++..+.|+-|+..|....++.+|+...|+
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            4566678899999999888888888877654


No 67 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.58  E-value=0.018  Score=27.08  Aligned_cols=24  Identities=29%  Similarity=0.886  Sum_probs=18.2

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCcc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNK   86 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~   86 (177)
                      |.|.+||..+....             .++.|++||.
T Consensus         2 ~~C~~CGy~y~~~~-------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE-------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc-------------CCCcCcCCCC
Confidence            68999998766543             4589999985


No 68 
>KOG4173|consensus
Probab=94.42  E-value=0.0093  Score=40.14  Aligned_cols=78  Identities=22%  Similarity=0.439  Sum_probs=64.1

Q ss_pred             ceeCCC--CccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCCccccccChhHHHHHHHH----------
Q psy16601         78 KFKCPH--CNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKF----------  145 (177)
Q Consensus        78 ~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~----------  145 (177)
                      .|.|++  |-..|.+......|....|+                    ..|.+|.+.|.+...|-.|+..          
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~--------------------~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~v  138 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG--------------------NSCSFCKRAFPTGHLLDAHILEWHDSLFQALV  138 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc--------------------chhHHHHHhCCchhhhhHHHHHHHHHHHHHHH
Confidence            478887  67789888889999887776                    4899999999999888888763          


Q ss_pred             hhCCCCCccCCC--CcccccchhHHHHHHhhhc
Q psy16601        146 ECGVEPQFKCPY--CDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       146 h~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h  176 (177)
                      -.| ...|+|-+  |+-.|.+...-..|+-..|
T Consensus       139 eRG-~dMy~ClvEgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  139 ERG-QDMYQCLVEGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             HcC-ccHHHHHHHhhhhhhhhhhhhhhHHHHhc
Confidence            234 55599966  9999999999999997766


No 69 
>KOG2186|consensus
Probab=94.34  E-value=0.023  Score=39.59  Aligned_cols=53  Identities=19%  Similarity=0.478  Sum_probs=39.6

Q ss_pred             eeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCCccccccChhHHHHHHHHhhCCCC
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGVEP  151 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  151 (177)
                      |.|..||....-. .+.+|+...++                  ..|.|..|++.|.. ..+..|...-+..++
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn------------------~~fSCIDC~k~F~~-~sYknH~kCITEaQK   56 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN------------------AYFSCIDCGKTFER-VSYKNHTKCITEAQK   56 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC------------------CeeEEeeccccccc-chhhhhhhhcchHHH
Confidence            7899999887765 46779877664                  46899999999987 667888775544333


No 70 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.88  E-value=0.036  Score=29.02  Aligned_cols=29  Identities=17%  Similarity=0.447  Sum_probs=19.7

Q ss_pred             CCCceecCCccccccChhHHHHHHHHhhC
Q psy16601        120 LNGSFICPKCSNRYVYKHNLKQHLKFECG  148 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  148 (177)
                      ++.-+.|+.|+..|..+..+.+|...-|+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            44456777777777777777777765555


No 71 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=93.87  E-value=0.029  Score=35.56  Aligned_cols=22  Identities=36%  Similarity=0.866  Sum_probs=9.3

Q ss_pred             eecCCccccccChhHHHHHHHHhhC
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECG  148 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~  148 (177)
                      ..|-.||+.|+.   |.+|++.|+|
T Consensus        73 i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-
T ss_pred             eEEccCCcccch---HHHHHHHccC
Confidence            455556655543   2555555543


No 72 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.51  E-value=0.013  Score=44.45  Aligned_cols=58  Identities=29%  Similarity=0.515  Sum_probs=49.9

Q ss_pred             CccccCccchhccChHHHHHHHH--HHhCCC-CceeCC--CCccccccchHHHhHHHHhcCCC
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLR--YECGKR-PKFKCP--HCNKKCHQKCNLKSHIALKHDQL  105 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~~-~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~  105 (177)
                      .++.|..|...|.....|..|.+  .|.+.. .++.|+  .|++.|.....+..|...+.+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  350 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSIS  350 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCC
Confidence            35789999999999999999999  676662 559999  79999999999999998877654


No 73 
>KOG2186|consensus
Probab=93.20  E-value=0.055  Score=37.76  Aligned_cols=49  Identities=20%  Similarity=0.476  Sum_probs=38.6

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKH  102 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  102 (177)
                      |.|.+||...... .+.+|+-.-++ .. |.|-.|+..|.. .+...|..-..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~-fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AY-FSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-Ce-eEEeeccccccc-chhhhhhhhcc
Confidence            7899999987754 77789877665 35 999999999998 67888875443


No 74 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=93.17  E-value=0.036  Score=38.84  Aligned_cols=20  Identities=20%  Similarity=0.453  Sum_probs=11.9

Q ss_pred             CCccCCCCcccccchhHHHH
Q psy16601        151 PQFKCPYCDKRCKLKGNLMS  170 (177)
Q Consensus       151 ~~~~C~~C~~~f~~~~~l~~  170 (177)
                      +++.|+.|++...-...|..
T Consensus       208 k~~PCPKCg~et~eTkdLSm  227 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDLSM  227 (314)
T ss_pred             CCCCCCCCCCccccccccee
Confidence            45777777766555444443


No 75 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.81  E-value=0.082  Score=32.32  Aligned_cols=15  Identities=27%  Similarity=0.913  Sum_probs=10.7

Q ss_pred             CceecCCccccccCh
Q psy16601        122 GSFICPKCSNRYVYK  136 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~  136 (177)
                      .|..|++||..|...
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            567788888777655


No 76 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=92.81  E-value=0.071  Score=26.84  Aligned_cols=13  Identities=23%  Similarity=0.529  Sum_probs=4.4

Q ss_pred             ceecCCccccccC
Q psy16601        123 SFICPKCSNRYVY  135 (177)
Q Consensus       123 ~~~C~~C~~~f~~  135 (177)
                      ...|..|++.+..
T Consensus        16 ~a~C~~C~~~~~~   28 (45)
T PF02892_consen   16 KAKCKYCGKVIKY   28 (45)
T ss_dssp             -EEETTTTEE---
T ss_pred             eEEeCCCCeEEee
Confidence            3445555444433


No 77 
>KOG2231|consensus
Probab=92.79  E-value=0.15  Score=40.95  Aligned_cols=47  Identities=28%  Similarity=0.563  Sum_probs=31.2

Q ss_pred             ccCccchhccChHHHHHHHHHHhCCCCceeCCCC------ccccccchHHHhHHHHhc
Q psy16601         51 ACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHC------NKKCHQKCNLKSHIALKH  102 (177)
Q Consensus        51 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C------~~~f~~~~~l~~H~~~~~  102 (177)
                      .|..|...|.....|..|++.+|     |-|..|      +..|.....|..|.+..|
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            57777777777777777777665     556655      234666667777776655


No 78 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.17  E-value=0.024  Score=43.04  Aligned_cols=55  Identities=25%  Similarity=0.476  Sum_probs=48.7

Q ss_pred             CceecCCccccccChhHHHHHHH--HhhCCC-CCccCC--CCcccccchhHHHHHHhhhc
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLK--FECGVE-PQFKCP--YCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~~-~~~~C~--~C~~~f~~~~~l~~H~~~~h  176 (177)
                      .++.|..|...|.....|..|.+  .|.++. .++.|+  .|++.|.....+.+|...|.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  347 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHT  347 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccccc
Confidence            36889999999999999999999  687742 679999  79999999999999998775


No 79 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.49  E-value=0.23  Score=26.49  Aligned_cols=30  Identities=23%  Similarity=0.520  Sum_probs=17.3

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCcccccc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQ   90 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~   90 (177)
                      -.|.-||........          ... |.|+.||+.--.
T Consensus        10 ~~CtSCg~~i~p~e~----------~v~-F~CPnCGe~~I~   39 (61)
T COG2888          10 PVCTSCGREIAPGET----------AVK-FPCPNCGEVEIY   39 (61)
T ss_pred             ceeccCCCEeccCCc----------eeE-eeCCCCCceeee
Confidence            357778765422211          113 999999965433


No 80 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=91.47  E-value=0.03  Score=38.76  Aligned_cols=44  Identities=20%  Similarity=0.538  Sum_probs=28.2

Q ss_pred             CccccCccchhccChHHHHHHHHHH---------hCCCC-----ceeCCCCccccccc
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYE---------CGKRP-----KFKCPHCNKKCHQK   91 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h---------~~~~~-----~~~C~~C~~~f~~~   91 (177)
                      +...|++|+..|....-.....+.-         .....     ...|+.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            4578999999999875444443321         11112     24799999987654


No 81 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.25  E-value=0.11  Score=24.54  Aligned_cols=25  Identities=32%  Similarity=0.721  Sum_probs=17.7

Q ss_pred             ccccCccchhccChHHHHHHHHHHhCCCCceeCCCCcc
Q psy16601         49 VFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNK   86 (177)
Q Consensus        49 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~   86 (177)
                      .|.|.+||..+....             +|..|+.||.
T Consensus         2 ~~~C~~CG~i~~g~~-------------~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGEE-------------APEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECCc-------------CCCcCcCCCC
Confidence            378899987765431             4578999985


No 82 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=90.63  E-value=0.13  Score=32.27  Aligned_cols=21  Identities=29%  Similarity=0.586  Sum_probs=11.4

Q ss_pred             eecCCccccccChhHHHHHHHHhh
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFEC  147 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~  147 (177)
                      ..|..+|+.|+   .|.+|+.+|.
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~   97 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHY   97 (148)
T ss_pred             EEEeccCcchH---HHHHHHhccc
Confidence            34666666653   3555555553


No 83 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=90.08  E-value=0.23  Score=25.68  Aligned_cols=12  Identities=17%  Similarity=0.473  Sum_probs=6.3

Q ss_pred             eecCCccccccC
Q psy16601        124 FICPKCSNRYVY  135 (177)
Q Consensus       124 ~~C~~C~~~f~~  135 (177)
                      -.|..|++.+..
T Consensus        19 a~C~~C~~~l~~   30 (50)
T smart00614       19 AKCKYCGKKLSR   30 (50)
T ss_pred             EEecCCCCEeee
Confidence            355556555543


No 84 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=90.01  E-value=0.037  Score=38.31  Aligned_cols=45  Identities=22%  Similarity=0.603  Sum_probs=28.4

Q ss_pred             CCceecCCccccccChhHHHHHHHH---hh-------CCCC----CccCCCCcccccch
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKF---EC-------GVEP----QFKCPYCDKRCKLK  165 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~---h~-------~~~~----~~~C~~C~~~f~~~  165 (177)
                      ++.+.|++|+..|....-.....+.   ..       +..+    ...|+.||+.|...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            4668999999999876433333321   11       1111    26899999987644


No 85 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=89.69  E-value=0.25  Score=24.87  Aligned_cols=28  Identities=18%  Similarity=0.647  Sum_probs=20.1

Q ss_pred             ccccCccchhccChHHHHHHHHHHhCCCCceeCCCCcccc
Q psy16601         49 VFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKC   88 (177)
Q Consensus        49 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f   88 (177)
                      .|.|..||..|...           .. .+..|+.||...
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~-~~irC~~CG~rI   29 (44)
T smart00659        2 IYICGECGRENEIK-----------SK-DVVRCRECGYRI   29 (44)
T ss_pred             EEECCCCCCEeecC-----------CC-CceECCCCCceE
Confidence            37899999987744           22 348999998653


No 86 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=89.08  E-value=0.36  Score=24.45  Aligned_cols=12  Identities=25%  Similarity=0.980  Sum_probs=9.4

Q ss_pred             eeCCCCcccccc
Q psy16601         79 FKCPHCNKKCHQ   90 (177)
Q Consensus        79 ~~C~~C~~~f~~   90 (177)
                      |.|+.||..|..
T Consensus         4 y~C~~CG~~~~~   15 (46)
T PRK00398          4 YKCARCGREVEL   15 (46)
T ss_pred             EECCCCCCEEEE
Confidence            889999977644


No 87 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=88.99  E-value=0.4  Score=21.10  Aligned_cols=20  Identities=25%  Similarity=0.622  Sum_probs=15.0

Q ss_pred             ccCCCCcccccchhHHHHHHh
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIA  173 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~  173 (177)
                      ..|++|++.+ ....+..|+-
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            4688888887 5567788875


No 88 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=88.22  E-value=0.18  Score=23.09  Aligned_cols=26  Identities=35%  Similarity=0.860  Sum_probs=12.7

Q ss_pred             ecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccc
Q psy16601        125 ICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRC  162 (177)
Q Consensus       125 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  162 (177)
                      +|+.|+..+..           ..+.. |.|+.|+..+
T Consensus         4 ~Cp~C~se~~y-----------~D~~~-~vCp~C~~ew   29 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGEL-LVCPECGHEW   29 (30)
T ss_dssp             --TTT-----E-----------E-SSS-EEETTTTEEE
T ss_pred             CCCCCCCccee-----------ccCCE-EeCCcccccC
Confidence            68888877665           33244 9999998754


No 89 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=88.15  E-value=0.32  Score=23.30  Aligned_cols=34  Identities=18%  Similarity=0.504  Sum_probs=23.7

Q ss_pred             eecCCccccccChhHHHHHHHHhhCCCCCccCCCCccccc
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCK  163 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~  163 (177)
                      ..|+.|+..|.-......     .. ....+|+.|+..|.
T Consensus         3 i~Cp~C~~~y~i~d~~ip-----~~-g~~v~C~~C~~~f~   36 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKIP-----PK-GRKVRCSKCGHVFF   36 (36)
T ss_pred             EECCCCCCEEeCCHHHCC-----CC-CcEEECCCCCCEeC
Confidence            578999998877765432     12 33489999998773


No 90 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=87.91  E-value=0.47  Score=25.38  Aligned_cols=33  Identities=24%  Similarity=0.818  Sum_probs=20.3

Q ss_pred             CceecCCccccccCh-hHHHHHHHHhhCCCCCccCCCCccc
Q psy16601        122 GSFICPKCSNRYVYK-HNLKQHLKFECGVEPQFKCPYCDKR  161 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~-~~l~~H~~~h~~~~~~~~C~~C~~~  161 (177)
                      -.|.|+.||...-.+ ..-+    ..   ..+|.|+.||+.
T Consensus        24 ~~F~CPnCG~~~I~RC~~CR----k~---~~~Y~CP~CGF~   57 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCEKCR----KQ---SNPYTCPKCGFE   57 (59)
T ss_pred             CEeeCCCCCCeeEeechhHH----hc---CCceECCCCCCc
Confidence            358999999763222 1111    11   345999999963


No 91 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=87.69  E-value=0.4  Score=31.58  Aligned_cols=32  Identities=31%  Similarity=0.786  Sum_probs=25.2

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccc
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRC  162 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  162 (177)
                      ..-|.|+.|+..|..-..+.         . .|.|+.||...
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~-~F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------L-NFTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------c-CCcCCCCCCEe
Confidence            45699999999998777774         1 39999999653


No 92 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.56  E-value=0.45  Score=29.78  Aligned_cols=15  Identities=7%  Similarity=0.213  Sum_probs=9.5

Q ss_pred             CceecCCccccccCh
Q psy16601        122 GSFICPKCSNRYVYK  136 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~  136 (177)
                      .|..|++||..|...
T Consensus        25 ~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        25 RPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCccCCCcCCccCcc
Confidence            456777777666544


No 93 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=87.20  E-value=0.45  Score=31.45  Aligned_cols=23  Identities=35%  Similarity=0.949  Sum_probs=19.3

Q ss_pred             ceecCCccccccChhHHHHHHHHhhCCCCCccCCCCc
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCD  159 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~  159 (177)
                      .|.|++||..             +-+ +.|-+|++||
T Consensus       134 ~~vC~vCGy~-------------~~g-e~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEG-EAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccC-CCCCcCCCCC
Confidence            6999999865             446 8889999998


No 94 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=87.17  E-value=0.57  Score=22.54  Aligned_cols=34  Identities=21%  Similarity=0.541  Sum_probs=22.3

Q ss_pred             eeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCCcccccc
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYV  134 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~  134 (177)
                      +.|+.|+..|.-......                      .......|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~~----------------------~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLG----------------------ANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHcC----------------------CCCCEEECCCCCCEEE
Confidence            679999988766643321                      0223578999998774


No 95 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=87.04  E-value=0.18  Score=28.33  Aligned_cols=40  Identities=18%  Similarity=0.288  Sum_probs=24.1

Q ss_pred             eecCCccccccChhHHHHHHHHhhCCCCCccCC--CCcccccchh
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECGVEPQFKCP--YCDKRCKLKG  166 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~--~C~~~f~~~~  166 (177)
                      +.|+.|+..-.....-.....   ..+..++|.  .||.+|....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~---~~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDT---TKERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             ccCCCCCCccEEEEChhcChh---hheeeeecCCCCCCCEEEEEE
Confidence            578888866543332222211   226668998  8999887653


No 96 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=86.15  E-value=0.11  Score=33.87  Aligned_cols=14  Identities=29%  Similarity=0.439  Sum_probs=10.6

Q ss_pred             ccCCCCcccccchh
Q psy16601        153 FKCPYCDKRCKLKG  166 (177)
Q Consensus       153 ~~C~~C~~~f~~~~  166 (177)
                      ++|+.||++|....
T Consensus        29 ~~c~~c~~~f~~~e   42 (154)
T PRK00464         29 RECLACGKRFTTFE   42 (154)
T ss_pred             eeccccCCcceEeE
Confidence            78888888887654


No 97 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=85.85  E-value=0.55  Score=23.44  Aligned_cols=20  Identities=25%  Similarity=0.497  Sum_probs=11.1

Q ss_pred             eecCCccccccChhHHHHHH
Q psy16601        124 FICPKCSNRYVYKHNLKQHL  143 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~  143 (177)
                      |+|-+|...+..++.|..||
T Consensus        21 ykcfqcpftc~~kshl~nhm   40 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHM   40 (54)
T ss_pred             ceeecCCcccchHHHHHHHH
Confidence            45555555555555555554


No 98 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=85.55  E-value=0.59  Score=27.13  Aligned_cols=15  Identities=27%  Similarity=0.864  Sum_probs=12.5

Q ss_pred             CCCceecCCcccccc
Q psy16601        120 LNGSFICPKCSNRYV  134 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~  134 (177)
                      ..+.|.|..|+..|.
T Consensus        50 a~GIW~C~kCg~~fA   64 (89)
T COG1997          50 ATGIWKCRKCGAKFA   64 (89)
T ss_pred             ccCeEEcCCCCCeec
Confidence            456799999999885


No 99 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=85.45  E-value=0.62  Score=29.60  Aligned_cols=23  Identities=35%  Similarity=0.661  Sum_probs=15.2

Q ss_pred             eeCCCCccccccchHHHhHHHHhcCC
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHDQ  104 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~~  104 (177)
                      ..|-+||+.|+.   |.+|+..|||.
T Consensus        73 i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             eEEccCCcccch---HHHHHHHccCC
Confidence            679999988876   58899888875


No 100
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=85.29  E-value=0.56  Score=31.54  Aligned_cols=32  Identities=31%  Similarity=0.899  Sum_probs=24.4

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccc
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRC  162 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  162 (177)
                      ..-|.|+.|+..|..-..+.         . .|.|+.||...
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~-~F~Cp~Cg~~L  146 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------Y-GFRCPQCGEML  146 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------c-CCcCCCCCCCC
Confidence            35699999999998776652         2 39999999643


No 101
>KOG4167|consensus
Probab=84.82  E-value=0.52  Score=38.22  Aligned_cols=30  Identities=23%  Similarity=0.615  Sum_probs=25.5

Q ss_pred             CCCccccCccchhccChHHHHHHHHHHhCC
Q psy16601         46 GEDVFACPKCSKTYLRQYTLNAHLRYECGK   75 (177)
Q Consensus        46 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~   75 (177)
                      ...-|.|.+|++.|....++..||++|.-.
T Consensus       789 ~~giFpCreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  789 PTGIFPCRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             CCceeehHHHHHHHHHHhhhhHHHHHHHHH
Confidence            345589999999999999999999999744


No 102
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=84.68  E-value=0.88  Score=21.15  Aligned_cols=12  Identities=33%  Similarity=1.013  Sum_probs=7.9

Q ss_pred             CceecCCccccc
Q psy16601        122 GSFICPKCSNRY  133 (177)
Q Consensus       122 ~~~~C~~C~~~f  133 (177)
                      .+..|+.||...
T Consensus        16 ~~irC~~CG~RI   27 (32)
T PF03604_consen   16 DPIRCPECGHRI   27 (32)
T ss_dssp             STSSBSSSS-SE
T ss_pred             CcEECCcCCCeE
Confidence            457888888654


No 103
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=84.34  E-value=0.58  Score=30.39  Aligned_cols=37  Identities=24%  Similarity=0.671  Sum_probs=22.9

Q ss_pred             CCccccCccchhccChHHHHHHHHHHhCCCCceeCCCCcccc
Q psy16601         47 EDVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKC   88 (177)
Q Consensus        47 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f   88 (177)
                      ...|.|+.|+..|....++.. .  . .... |.|+.||...
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~-~--d-~~~~-f~Cp~Cg~~l  133 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL-L--D-MDGT-FTCPRCGEEL  133 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh-c--C-CCCc-EECCCCCCEE
Confidence            445888888888875444322 1  1 1223 8888888764


No 104
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.14  E-value=0.74  Score=30.33  Aligned_cols=32  Identities=22%  Similarity=0.600  Sum_probs=24.5

Q ss_pred             CCccccCccchhccChHHHHHHHHHHhCCCCceeCCCCcccc
Q psy16601         47 EDVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKC   88 (177)
Q Consensus        47 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f   88 (177)
                      ..-|.|+.|+..|+...++..         . |.|+.||...
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~~---------~-F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAMEL---------N-FTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHHc---------C-CcCCCCCCEe
Confidence            345889999998888877741         3 9999999763


No 105
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.06  E-value=0.42  Score=23.74  Aligned_cols=14  Identities=14%  Similarity=0.631  Sum_probs=11.3

Q ss_pred             eeCCCCccccccch
Q psy16601         79 FKCPHCNKKCHQKC   92 (177)
Q Consensus        79 ~~C~~C~~~f~~~~   92 (177)
                      |.|..||..|....
T Consensus         6 y~C~~Cg~~fe~~~   19 (42)
T PF09723_consen    6 YRCEECGHEFEVLQ   19 (42)
T ss_pred             EEeCCCCCEEEEEE
Confidence            88999998886653


No 106
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=83.18  E-value=1.3  Score=21.29  Aligned_cols=34  Identities=21%  Similarity=0.573  Sum_probs=22.7

Q ss_pred             eeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCCcccccc
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYV  134 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~  134 (177)
                      ..|+.|+..|.-..+-.                      ....+...|..|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~l----------------------~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKL----------------------PAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHHc----------------------ccCCcEEECCCCCcEee
Confidence            57888988887664321                      11345689999988774


No 107
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=83.16  E-value=0.68  Score=32.06  Aligned_cols=25  Identities=16%  Similarity=0.458  Sum_probs=14.0

Q ss_pred             CCceecCCccccccChhHHHHHHHH
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKF  145 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~  145 (177)
                      +..|.|..|+|.|+-..-.++|+..
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhh
Confidence            3346666666666666666666654


No 108
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=83.12  E-value=0.57  Score=22.84  Aligned_cols=13  Identities=15%  Similarity=0.713  Sum_probs=10.5

Q ss_pred             eeCCCCccccccc
Q psy16601         79 FKCPHCNKKCHQK   91 (177)
Q Consensus        79 ~~C~~C~~~f~~~   91 (177)
                      |.|+.||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (41)
T smart00834        6 YRCEDCGHTFEVL   18 (41)
T ss_pred             EEcCCCCCEEEEE
Confidence            7899999888654


No 109
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=82.85  E-value=1  Score=31.25  Aligned_cols=26  Identities=31%  Similarity=0.617  Sum_probs=18.7

Q ss_pred             eeCCCCccccccchHHHhHHHHhcCC
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHDQ  104 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~~  104 (177)
                      |.|++|++.|...--+..|+...|..
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCHH
Confidence            88888888888888888888888864


No 110
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=82.60  E-value=0.77  Score=30.88  Aligned_cols=31  Identities=26%  Similarity=0.759  Sum_probs=23.3

Q ss_pred             CccccCccchhccChHHHHHHHHHHhCCCCceeCCCCcccc
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKC   88 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f   88 (177)
                      .-|.|+.|+..|+...++.         .. |.|+.||...
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YG-FRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCC
Confidence            4588999998888877653         13 9999998753


No 111
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=82.45  E-value=0.63  Score=20.49  Aligned_cols=11  Identities=27%  Similarity=0.603  Sum_probs=6.0

Q ss_pred             ccCCCCccccc
Q psy16601        153 FKCPYCDKRCK  163 (177)
Q Consensus       153 ~~C~~C~~~f~  163 (177)
                      -.|+.||+.|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            34666666553


No 112
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=81.86  E-value=0.5  Score=24.55  Aligned_cols=30  Identities=23%  Similarity=0.790  Sum_probs=20.2

Q ss_pred             ceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcc
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDK  160 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  160 (177)
                      .|.|..|+..|.....+..        ...-.|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~~~--------~~~~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKMSD--------DPLATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEecCC--------CCCCCCCCCCC
Confidence            3899999998875432211        23367999985


No 113
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=81.13  E-value=0.76  Score=27.01  Aligned_cols=15  Identities=27%  Similarity=0.895  Sum_probs=12.3

Q ss_pred             CCCceecCCcccccc
Q psy16601        120 LNGSFICPKCSNRYV  134 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~  134 (177)
                      ..+.|.|..|++.|.
T Consensus        50 a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   50 ATGIWKCKKCGKKFA   64 (90)
T ss_dssp             ETTEEEETTTTEEEE
T ss_pred             eeEEeecCCCCCEEe
Confidence            456799999998885


No 114
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=79.96  E-value=0.47  Score=21.29  Aligned_cols=21  Identities=29%  Similarity=0.615  Sum_probs=10.5

Q ss_pred             eecCCccccccChhHHHHHHHH
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKF  145 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~  145 (177)
                      |.|..|++.| .......|-.-
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~C   21 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTSC   21 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT----
T ss_pred             CeeecCCCCc-CcCCcCCCCcc
Confidence            4677777777 44445555443


No 115
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=79.52  E-value=1.4  Score=22.68  Aligned_cols=11  Identities=27%  Similarity=1.141  Sum_probs=9.3

Q ss_pred             ceeCCCCcccc
Q psy16601         78 KFKCPHCNKKC   88 (177)
Q Consensus        78 ~~~C~~C~~~f   88 (177)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            38999999888


No 116
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=78.50  E-value=1.1  Score=26.31  Aligned_cols=15  Identities=20%  Similarity=0.525  Sum_probs=12.3

Q ss_pred             CCCceecCCcccccc
Q psy16601        120 LNGSFICPKCSNRYV  134 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~  134 (177)
                      ..+.|.|..|++.|.
T Consensus        51 a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         51 AVGIWRCKGCKKTVA   65 (90)
T ss_pred             eeEEEEcCCCCCEEe
Confidence            457799999998885


No 117
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=78.37  E-value=0.55  Score=38.58  Aligned_cols=12  Identities=25%  Similarity=0.631  Sum_probs=9.1

Q ss_pred             CCCccCCCCccc
Q psy16601        150 EPQFKCPYCDKR  161 (177)
Q Consensus       150 ~~~~~C~~C~~~  161 (177)
                      ..|..|+.||-.
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            566899999843


No 118
>KOG3408|consensus
Probab=77.25  E-value=1.2  Score=27.57  Aligned_cols=22  Identities=27%  Similarity=0.424  Sum_probs=13.7

Q ss_pred             CccCCCCcccccchhHHHHHHh
Q psy16601        152 QFKCPYCDKRCKLKGNLMSHIA  173 (177)
Q Consensus       152 ~~~C~~C~~~f~~~~~l~~H~~  173 (177)
                      .|.|-.|.+-|.+..+|..|.+
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHh
Confidence            3666666666666666666655


No 119
>PHA00626 hypothetical protein
Probab=76.49  E-value=1.1  Score=23.68  Aligned_cols=14  Identities=14%  Similarity=0.358  Sum_probs=10.9

Q ss_pred             CccCCCCcccccch
Q psy16601        152 QFKCPYCDKRCKLK  165 (177)
Q Consensus       152 ~~~C~~C~~~f~~~  165 (177)
                      .|.|+.||+.|+..
T Consensus        23 rYkCkdCGY~ft~~   36 (59)
T PHA00626         23 DYVCCDCGYNDSKD   36 (59)
T ss_pred             ceEcCCCCCeechh
Confidence            48898898888754


No 120
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=76.48  E-value=1.3  Score=26.14  Aligned_cols=15  Identities=27%  Similarity=0.877  Sum_probs=12.4

Q ss_pred             CCCceecCCcccccc
Q psy16601        120 LNGSFICPKCSNRYV  134 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~  134 (177)
                      ..+.|.|..|++.|.
T Consensus        50 a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        50 STGIWTCRKCGAKFA   64 (91)
T ss_pred             eeEEEEcCCCCCEEe
Confidence            457799999998885


No 121
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=76.19  E-value=1.8  Score=23.06  Aligned_cols=47  Identities=32%  Similarity=0.782  Sum_probs=27.6

Q ss_pred             CceecCC--ccccccChhHHHHHHHHhhCCCCCccCCC----CcccccchhHHHHH
Q psy16601        122 GSFICPK--CSNRYVYKHNLKQHLKFECGVEPQFKCPY----CDKRCKLKGNLMSH  171 (177)
Q Consensus       122 ~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~----C~~~f~~~~~l~~H  171 (177)
                      .+..|+.  |...+. +..|..|+...-. ..+..|.+    |+..+... .|.+|
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~-~~~v~C~~~~~GC~~~~~~~-~l~~H   60 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECP-KRPVPCPYSPYGCKERVPRE-DLEEH   60 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTST-TSEEE-SS----S--EEEHH-HHHHC
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCC-CCcEECCCCCCCCCCccchh-HHhCC
Confidence            4578887  545454 6679999986545 44589999    98887754 34443


No 122
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=76.07  E-value=1.6  Score=33.30  Aligned_cols=17  Identities=29%  Similarity=0.554  Sum_probs=12.4

Q ss_pred             CCceecCCccccccChh
Q psy16601        121 NGSFICPKCSNRYVYKH  137 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~  137 (177)
                      .+.|.|+.|+..+....
T Consensus       365 ~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         365 RNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCcccccccccCCccc
Confidence            33789999988876544


No 123
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=75.80  E-value=1.4  Score=18.97  Aligned_cols=7  Identities=57%  Similarity=1.834  Sum_probs=4.7

Q ss_pred             eeCCCCc
Q psy16601         79 FKCPHCN   85 (177)
Q Consensus        79 ~~C~~C~   85 (177)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            6666666


No 124
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=75.43  E-value=5.2  Score=29.85  Aligned_cols=23  Identities=26%  Similarity=0.530  Sum_probs=19.8

Q ss_pred             ccccCccchhccChHHHHHHHHH
Q psy16601         49 VFACPKCSKTYLRQYTLNAHLRY   71 (177)
Q Consensus        49 ~~~C~~C~~~f~~~~~l~~H~~~   71 (177)
                      .+-|..|++.|.....+..|...
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl~g  260 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHLEG  260 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHHhh
Confidence            36799999999998899998764


No 125
>PF12907 zf-met2:  Zinc-binding
Probab=74.47  E-value=2.1  Score=21.02  Aligned_cols=24  Identities=25%  Similarity=0.430  Sum_probs=15.1

Q ss_pred             ccCCCCccccc---chhHHHHHHhhhc
Q psy16601        153 FKCPYCDKRCK---LKGNLMSHIALKH  176 (177)
Q Consensus       153 ~~C~~C~~~f~---~~~~l~~H~~~~h  176 (177)
                      ++|.+|...|.   +...|..|....|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKH   28 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKH   28 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccC
Confidence            56777875443   3355777776555


No 126
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=73.87  E-value=1.2  Score=23.58  Aligned_cols=41  Identities=15%  Similarity=0.307  Sum_probs=24.6

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCcccccc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQ   90 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~   90 (177)
                      .+|.+|++.+.-..+-..-.+........|.|..|......
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~RI~~   43 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKERIRE   43 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHHHhH
Confidence            47899998776554433333333333345999999765433


No 127
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=72.99  E-value=6.9  Score=19.26  Aligned_cols=24  Identities=25%  Similarity=0.516  Sum_probs=16.8

Q ss_pred             cccCccchhccC--hHHHHHHHHHHh
Q psy16601         50 FACPKCSKTYLR--QYTLNAHLRYEC   73 (177)
Q Consensus        50 ~~C~~C~~~f~~--~~~l~~H~~~h~   73 (177)
                      -.|..||+.|..  ..+-..|.+-|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            579999988776  355666766653


No 128
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=72.56  E-value=1.8  Score=25.52  Aligned_cols=15  Identities=27%  Similarity=0.780  Sum_probs=12.3

Q ss_pred             CCCceecCCcccccc
Q psy16601        120 LNGSFICPKCSNRYV  134 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~  134 (177)
                      ..+.|.|..|++.|.
T Consensus        51 a~GIW~C~~C~~~~A   65 (90)
T PRK03976         51 GTGIWECRKCGAKFA   65 (90)
T ss_pred             EEEEEEcCCCCCEEe
Confidence            456799999998885


No 129
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=72.04  E-value=2.3  Score=25.89  Aligned_cols=14  Identities=14%  Similarity=0.406  Sum_probs=10.9

Q ss_pred             CCceecCCcccccc
Q psy16601        121 NGSFICPKCSNRYV  134 (177)
Q Consensus       121 ~~~~~C~~C~~~f~  134 (177)
                      ..|..|++||++|.
T Consensus        24 rdPiVsPytG~s~P   37 (129)
T COG4530          24 RDPIVSPYTGKSYP   37 (129)
T ss_pred             CCccccCcccccch
Confidence            35788899998883


No 130
>KOG4167|consensus
Probab=71.30  E-value=1.1  Score=36.39  Aligned_cols=24  Identities=21%  Similarity=0.290  Sum_probs=20.6

Q ss_pred             CccCCCCcccccchhHHHHHHhhh
Q psy16601        152 QFKCPYCDKRCKLKGNLMSHIALK  175 (177)
Q Consensus       152 ~~~C~~C~~~f~~~~~l~~H~~~~  175 (177)
                      -|.|.+|++.|-.-..+..||++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            389999999988888888898877


No 131
>PF14353 CpXC:  CpXC protein
Probab=70.81  E-value=4.1  Score=25.64  Aligned_cols=40  Identities=30%  Similarity=0.796  Sum_probs=23.7

Q ss_pred             eecCCccccccCh----------hHHHHHHHHhhCCCCCccCCCCcccccch
Q psy16601        124 FICPKCSNRYVYK----------HNLKQHLKFECGVEPQFKCPYCDKRCKLK  165 (177)
Q Consensus       124 ~~C~~C~~~f~~~----------~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  165 (177)
                      ..|+.|+..|...          ..|+.  ..-.|.--.|.|+.||..|.-.
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e--~il~g~l~~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKE--KILDGSLFSFTCPSCGHKFRLE   51 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHH--HHHcCCcCEEECCCCCCceecC
Confidence            3688888777542          22332  2224444458899998877543


No 132
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=70.35  E-value=2.1  Score=25.98  Aligned_cols=29  Identities=34%  Similarity=0.804  Sum_probs=17.9

Q ss_pred             ecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccch
Q psy16601        125 ICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLK  165 (177)
Q Consensus       125 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  165 (177)
                      .|+.|...|.+..           .. .|.|++|++.++..
T Consensus         4 ~CP~C~seytY~d-----------g~-~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYHD-----------GT-QLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEec-----------CC-eeECcccccccccc
Confidence            4777766665542           13 37788887777644


No 133
>KOG4727|consensus
Probab=69.59  E-value=2.4  Score=28.06  Aligned_cols=20  Identities=35%  Similarity=0.634  Sum_probs=10.8

Q ss_pred             ccCCCCcccccchhHHHHHH
Q psy16601        153 FKCPYCDKRCKLKGNLMSHI  172 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~  172 (177)
                      |.|.+|+..|..+.++..|+
T Consensus        76 yyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   76 YYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             eeeeecceeehhhHHHHHHh
Confidence            55555555555555555554


No 134
>KOG3408|consensus
Probab=68.18  E-value=6.6  Score=24.45  Aligned_cols=32  Identities=19%  Similarity=0.568  Sum_probs=25.0

Q ss_pred             CCCCCCCCccccCccchhccChHHHHHHHHHH
Q psy16601         41 EDKPAGEDVFACPKCSKTYLRQYTLNAHLRYE   72 (177)
Q Consensus        41 ~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h   72 (177)
                      .....|...|.|-.|.+-|.+...|..|.++.
T Consensus        49 D~dlPG~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   49 DPDLPGGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCCCCCCceeehhhhhhhhcchHHHHHHHhcc
Confidence            33445566688999999999999999998764


No 135
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=68.00  E-value=3  Score=24.48  Aligned_cols=13  Identities=15%  Similarity=0.559  Sum_probs=11.3

Q ss_pred             ceeCCCCcccccc
Q psy16601         78 KFKCPHCNKKCHQ   90 (177)
Q Consensus        78 ~~~C~~C~~~f~~   90 (177)
                      |-.|..||+.|..
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            5789999999976


No 136
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=67.78  E-value=4.2  Score=20.97  Aligned_cols=38  Identities=18%  Similarity=0.600  Sum_probs=22.8

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCC-CCCccCCCCc
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGV-EPQFKCPYCD  159 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~~~C~~C~  159 (177)
                      ++.+.|..||..|.....=+.-... .|- ..|-.|..|-
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~e-Kgf~n~p~RC~~CR   40 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYAE-KGFDNEPKRCPSCR   40 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHHh-cCCcCCCccCHHHH
Confidence            4678999999888765443333333 221 2346677664


No 137
>PRK10220 hypothetical protein; Provisional
Probab=65.79  E-value=3.3  Score=25.23  Aligned_cols=29  Identities=31%  Similarity=0.876  Sum_probs=17.4

Q ss_pred             ecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccch
Q psy16601        125 ICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLK  165 (177)
Q Consensus       125 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  165 (177)
                      .|+.|...|.+..            ...|.|++|++.++..
T Consensus         5 ~CP~C~seytY~d------------~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYED------------NGMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEcC------------CCeEECCcccCcCCcc
Confidence            4677766654433            2237777777776644


No 138
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=65.62  E-value=4.4  Score=19.92  Aligned_cols=13  Identities=46%  Similarity=1.311  Sum_probs=9.8

Q ss_pred             CCceecCCccccc
Q psy16601        121 NGSFICPKCSNRY  133 (177)
Q Consensus       121 ~~~~~C~~C~~~f  133 (177)
                      .++-.|++|+..|
T Consensus        27 ~~~~~CpYCg~~y   39 (40)
T PF10276_consen   27 PGPVVCPYCGTRY   39 (40)
T ss_dssp             TCEEEETTTTEEE
T ss_pred             CCeEECCCCCCEE
Confidence            3567889998776


No 139
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=63.65  E-value=5.1  Score=22.04  Aligned_cols=31  Identities=26%  Similarity=0.594  Sum_probs=20.9

Q ss_pred             eecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccch
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLK  165 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  165 (177)
                      -.|+.|+.....           ......|.|+.||..+...
T Consensus        29 q~C~~CG~~~~~-----------~~~~r~~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   29 QTCPRCGHRNKK-----------RRSGRVFTCPNCGFEMDRD   59 (69)
T ss_pred             cCccCccccccc-----------ccccceEEcCCCCCEECcH
Confidence            368889876544           1224459999999876654


No 140
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=62.73  E-value=6.8  Score=20.29  Aligned_cols=12  Identities=25%  Similarity=0.612  Sum_probs=8.2

Q ss_pred             CceecCCccccc
Q psy16601        122 GSFICPKCSNRY  133 (177)
Q Consensus       122 ~~~~C~~C~~~f  133 (177)
                      ..+.|..|+..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            457888887553


No 141
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=62.64  E-value=2.1  Score=22.65  Aligned_cols=10  Identities=40%  Similarity=1.308  Sum_probs=4.9

Q ss_pred             eeCCCCcccc
Q psy16601         79 FKCPHCNKKC   88 (177)
Q Consensus        79 ~~C~~C~~~f   88 (177)
                      |.|+.||..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            4455555443


No 142
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=62.58  E-value=6.7  Score=18.97  Aligned_cols=10  Identities=40%  Similarity=1.115  Sum_probs=3.8

Q ss_pred             ccCCCCcccc
Q psy16601        153 FKCPYCDKRC  162 (177)
Q Consensus       153 ~~C~~C~~~f  162 (177)
                      |.|++|..-|
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            7777777777


No 143
>KOG2593|consensus
Probab=62.33  E-value=4.8  Score=30.85  Aligned_cols=37  Identities=32%  Similarity=0.749  Sum_probs=22.1

Q ss_pred             CCCccccCccchhccChHHHHHHHHHHhCCCCceeCCCCcc
Q psy16601         46 GEDVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNK   86 (177)
Q Consensus        46 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~   86 (177)
                      ....|.|+.|.+.|..-.+++- +-.-.+  . |.|..|+-
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~L-~~~~~~--~-F~C~~C~g  161 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQL-LDNETG--E-FHCENCGG  161 (436)
T ss_pred             ccccccCCccccchhhhHHHHh-hcccCc--e-EEEecCCC
Confidence            3345888888888876554422 111122  2 88888864


No 144
>KOG1280|consensus
Probab=61.97  E-value=7.7  Score=28.90  Aligned_cols=27  Identities=22%  Similarity=0.578  Sum_probs=24.0

Q ss_pred             ceeCCCCccccccchHHHhHHHHhcCC
Q psy16601         78 KFKCPHCNKKCHQKCNLKSHIALKHDQ  104 (177)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~~~~  104 (177)
                      .|.|+.|++.-.+...|..|....|..
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpd  105 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPE  105 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcc
Confidence            489999999988999999999888875


No 145
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=61.73  E-value=6.6  Score=30.69  Aligned_cols=28  Identities=29%  Similarity=0.495  Sum_probs=24.2

Q ss_pred             ceeCCCCccccccchHHHhHHHHhcCCC
Q psy16601         78 KFKCPHCNKKCHQKCNLKSHIALKHDQL  105 (177)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~  105 (177)
                      =+.|+.|.+.|.....+..|+...|...
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            3679999999999999999999888653


No 146
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=59.79  E-value=3.1  Score=34.43  Aligned_cols=12  Identities=25%  Similarity=0.670  Sum_probs=8.7

Q ss_pred             CCceecCCcccc
Q psy16601        121 NGSFICPKCSNR  132 (177)
Q Consensus       121 ~~~~~C~~C~~~  132 (177)
                      ..|..|+.|+..
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            356788888855


No 147
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=58.19  E-value=17  Score=23.08  Aligned_cols=16  Identities=13%  Similarity=0.663  Sum_probs=12.2

Q ss_pred             CCceecCCccccccCh
Q psy16601        121 NGSFICPKCSNRYVYK  136 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~  136 (177)
                      ...|.|+.|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            4568899999888754


No 148
>PRK04023 DNA polymerase II large subunit; Validated
Probab=57.95  E-value=15  Score=31.63  Aligned_cols=12  Identities=33%  Similarity=0.722  Sum_probs=8.3

Q ss_pred             CCccccCccchh
Q psy16601         47 EDVFACPKCSKT   58 (177)
Q Consensus        47 ~~~~~C~~C~~~   58 (177)
                      .....|+.||..
T Consensus       624 Vg~RfCpsCG~~  635 (1121)
T PRK04023        624 IGRRKCPSCGKE  635 (1121)
T ss_pred             ccCccCCCCCCc
Confidence            344678888876


No 149
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=57.39  E-value=6  Score=24.53  Aligned_cols=26  Identities=23%  Similarity=0.640  Sum_probs=19.1

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcc
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDK  160 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  160 (177)
                      ....|..|+..|.....             .+.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~~-------------~~~CP~Cgs   94 (115)
T TIGR00100        69 VECECEDCSEEVSPEID-------------LYRCPKCHG   94 (115)
T ss_pred             cEEEcccCCCEEecCCc-------------CccCcCCcC
Confidence            35789999988765432             378999984


No 150
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=57.13  E-value=10  Score=25.07  Aligned_cols=45  Identities=18%  Similarity=0.444  Sum_probs=26.8

Q ss_pred             cccCccchhccChHH--HH-----HHHHHHhCCCCceeCCCCccccccchHHHhH
Q psy16601         50 FACPKCSKTYLRQYT--LN-----AHLRYECGKRPKFKCPHCNKKCHQKCNLKSH   97 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~--l~-----~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H   97 (177)
                      -.|+.|+........  ..     .+...+.   .-|.|+.||+.|+--+.+..=
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~---~f~~C~~CgkiYW~GsHw~~m  149 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYE---EFYRCPKCGKIYWKGSHWRRM  149 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhccc---ceeECCCCcccccCchHHHHH
Confidence            369999875544322  11     1222222   227799999999887766543


No 151
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.66  E-value=1.5  Score=30.59  Aligned_cols=42  Identities=19%  Similarity=0.539  Sum_probs=27.6

Q ss_pred             CCCceecCCccccccChhHHHHHHHHhhCC----------CC----CccCCCCccc
Q psy16601        120 LNGSFICPKCSNRYVYKHNLKQHLKFECGV----------EP----QFKCPYCDKR  161 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~----------~~----~~~C~~C~~~  161 (177)
                      -++.+.|++|+..|.....+..-.++-.+.          .+    ...|+.|.+.
T Consensus        16 ~kk~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~yA   71 (267)
T COG1655          16 YKKTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYYA   71 (267)
T ss_pred             hhceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhHH
Confidence            356789999999998766555444443332          11    2579999874


No 152
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=56.23  E-value=5.2  Score=31.73  Aligned_cols=9  Identities=22%  Similarity=0.538  Sum_probs=5.6

Q ss_pred             eCCCCcccc
Q psy16601         80 KCPHCNKKC   88 (177)
Q Consensus        80 ~C~~C~~~f   88 (177)
                      .|..||...
T Consensus       215 ~C~~Cg~~~  223 (505)
T TIGR00595       215 LCRSCGYIL  223 (505)
T ss_pred             EhhhCcCcc
Confidence            577777554


No 153
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=55.95  E-value=4.9  Score=25.73  Aligned_cols=39  Identities=23%  Similarity=0.520  Sum_probs=22.4

Q ss_pred             CceecCCccccccChh---HHH--HHHHHhhCC---CCCccCCCCcc
Q psy16601        122 GSFICPKCSNRYVYKH---NLK--QHLKFECGV---EPQFKCPYCDK  160 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~---~l~--~H~~~h~~~---~~~~~C~~C~~  160 (177)
                      ..+.|..|+..|....   .|.  .+...|--.   ...+.|+.||.
T Consensus        69 ~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs  115 (135)
T PRK03824         69 AVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGS  115 (135)
T ss_pred             eEEECCCCCCEEecccccccccccccccccccccccccCcCCcCCCC
Confidence            5689999998886642   110  011122111   33478999994


No 154
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=55.38  E-value=7.6  Score=24.00  Aligned_cols=26  Identities=23%  Similarity=0.524  Sum_probs=18.5

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcc
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDK  160 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  160 (177)
                      ..+.|..|+..|....             ..|.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~-------------~~~~CP~Cgs   94 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQ-------------HDAQCPHCHG   94 (113)
T ss_pred             cEEEcccCCCEEecCC-------------cCccCcCCCC
Confidence            4578999997775433             2367999983


No 155
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=55.17  E-value=1.6  Score=22.18  Aligned_cols=38  Identities=16%  Similarity=0.359  Sum_probs=19.9

Q ss_pred             ecCCccccccChhHHHHHHHHhhCCCCCccCCC--Ccccccch
Q psy16601        125 ICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPY--CDKRCKLK  165 (177)
Q Consensus       125 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~--C~~~f~~~  165 (177)
                      .|+.|+.....+.....+..   ..+..|+|..  ||..|...
T Consensus         1 ~CP~Cg~~a~ir~S~~~s~~---~~~~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQLSPL---TRELYCQCTNPECGHTFVAN   40 (47)
T ss_pred             CcCCCCCeeEEEEchhhCcc---eEEEEEEECCCcCCCEEEEE
Confidence            36777755544433322211   1245577766  88777643


No 156
>KOG0978|consensus
Probab=53.45  E-value=6.5  Score=32.30  Aligned_cols=49  Identities=20%  Similarity=0.314  Sum_probs=29.3

Q ss_pred             ceecCCccccccChhH-HHHHHH------HhhCCCCCccCCCCcccccchhHHHHHH
Q psy16601        123 SFICPKCSNRYVYKHN-LKQHLK------FECGVEPQFKCPYCDKRCKLKGNLMSHI  172 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~-l~~H~~------~h~~~~~~~~C~~C~~~f~~~~~l~~H~  172 (177)
                      ..+|+.|...+++.-- ..-|.-      .-.. -+.-+||.|+..|...+-+..|+
T Consensus       643 ~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~e-tRqRKCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  643 LLKCSVCNTRWKDAVITKCGHVFCEECVQTRYE-TRQRKCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             ceeCCCccCchhhHHHHhcchHHHHHHHHHHHH-HhcCCCCCCCCCCCcccccccCC
Confidence            4679999866655321 111211      1111 23378999999999887766553


No 157
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=53.42  E-value=4.7  Score=19.03  Aligned_cols=15  Identities=13%  Similarity=0.372  Sum_probs=7.3

Q ss_pred             eecCCccccccChhH
Q psy16601        124 FICPKCSNRYVYKHN  138 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~  138 (177)
                      -.|..|++.|..+..
T Consensus         4 ~~C~eC~~~f~dSyL   18 (34)
T PF01286_consen    4 PKCDECGKPFMDSYL   18 (34)
T ss_dssp             EE-TTT--EES-SSC
T ss_pred             chHhHhCCHHHHHHH
Confidence            367788888876653


No 158
>KOG2636|consensus
Probab=53.42  E-value=9.6  Score=29.46  Aligned_cols=29  Identities=17%  Similarity=0.344  Sum_probs=23.5

Q ss_pred             HHhhCCCCCccCCCCc-ccccchhHHHHHHh
Q psy16601        144 KFECGVEPQFKCPYCD-KRCKLKGNLMSHIA  173 (177)
Q Consensus       144 ~~h~~~~~~~~C~~C~-~~f~~~~~l~~H~~  173 (177)
                      +.|.- ...|.|.+|| +++.-..++.+|..
T Consensus       394 KLHGL-~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGL-DIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCC-CcccceeeccCccccCcHHHHHHhH
Confidence            44533 6669999999 89999999999985


No 159
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=52.95  E-value=11  Score=20.00  Aligned_cols=10  Identities=40%  Similarity=1.212  Sum_probs=7.5

Q ss_pred             eeCCCCcccc
Q psy16601         79 FKCPHCNKKC   88 (177)
Q Consensus        79 ~~C~~C~~~f   88 (177)
                      |.|+.||..+
T Consensus        15 ~~Cp~cGipt   24 (55)
T PF13824_consen   15 FECPDCGIPT   24 (55)
T ss_pred             CcCCCCCCcC
Confidence            8888888654


No 160
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=52.93  E-value=26  Score=25.84  Aligned_cols=26  Identities=15%  Similarity=0.496  Sum_probs=14.7

Q ss_pred             CCceecCCccccccChhHHHHHHHHh
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFE  146 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h  146 (177)
                      ...|.|..|...|-.--....|...|
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHh
Confidence            34566666666665555555554444


No 161
>PRK14873 primosome assembly protein PriA; Provisional
Probab=52.26  E-value=3.8  Score=33.68  Aligned_cols=9  Identities=33%  Similarity=1.342  Sum_probs=4.8

Q ss_pred             ceecCCccc
Q psy16601        123 SFICPKCSN  131 (177)
Q Consensus       123 ~~~C~~C~~  131 (177)
                      ++.|+.|+.
T Consensus       422 p~~Cp~Cgs  430 (665)
T PRK14873        422 DWRCPRCGS  430 (665)
T ss_pred             CccCCCCcC
Confidence            455666653


No 162
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=51.99  E-value=8.4  Score=18.73  Aligned_cols=14  Identities=36%  Similarity=0.819  Sum_probs=11.6

Q ss_pred             ceeCCCCccccccc
Q psy16601         78 KFKCPHCNKKCHQK   91 (177)
Q Consensus        78 ~~~C~~C~~~f~~~   91 (177)
                      ||.|..|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            58999999988764


No 163
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=51.48  E-value=2.3  Score=22.14  Aligned_cols=26  Identities=19%  Similarity=0.520  Sum_probs=13.4

Q ss_pred             CCccccCccchhccChHHHHHHHHHH
Q psy16601         47 EDVFACPKCSKTYLRQYTLNAHLRYE   72 (177)
Q Consensus        47 ~~~~~C~~C~~~f~~~~~l~~H~~~h   72 (177)
                      ...|.|+.|+..|--.-++-.|...|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            45588888888888777776665444


No 164
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=50.31  E-value=11  Score=29.43  Aligned_cols=21  Identities=29%  Similarity=0.879  Sum_probs=12.5

Q ss_pred             eecCCccccccChhHHHHHHH
Q psy16601        124 FICPKCSNRYVYKHNLKQHLK  144 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~  144 (177)
                      |.|+.|.+.|.+...+..|+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            456666666666666666654


No 165
>KOG2071|consensus
Probab=50.22  E-value=12  Score=30.06  Aligned_cols=29  Identities=14%  Similarity=0.327  Sum_probs=22.8

Q ss_pred             CCCceecCCccccccChhHHHHHHHHhhC
Q psy16601        120 LNGSFICPKCSNRYVYKHNLKQHLKFECG  148 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  148 (177)
                      ...+..|..||.+|........||..|-.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhhh
Confidence            35678999999999998877777776643


No 166
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=50.18  E-value=27  Score=16.33  Aligned_cols=24  Identities=17%  Similarity=0.552  Sum_probs=14.8

Q ss_pred             eeCCCCccccccchHHHhHHHHhcC
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHD  103 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~  103 (177)
                      +.|+.|++.+.. +.+..|+...-+
T Consensus         5 ~~C~nC~R~v~a-~RfA~HLekCmg   28 (33)
T PF08209_consen    5 VECPNCGRPVAA-SRFAPHLEKCMG   28 (33)
T ss_dssp             EE-TTTSSEEEG-GGHHHHHHHHTC
T ss_pred             EECCCCcCCcch-hhhHHHHHHHHc
Confidence            678888876544 457777755443


No 167
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=49.29  E-value=2.8  Score=20.07  Aligned_cols=30  Identities=23%  Similarity=0.771  Sum_probs=17.6

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCC
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHC   84 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C   84 (177)
                      ..|+.|+..    ..+.+|-....+..+ |.|..|
T Consensus         6 v~CP~C~s~----~~v~k~G~~~~G~qr-yrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQST----EGVKKNGKSPSGHQR-YRCKDC   35 (36)
T ss_pred             eeCCCCCCC----CcceeCCCCCCCCEe-EecCcC
Confidence            457777653    124455555555555 888777


No 168
>KOG1842|consensus
Probab=48.97  E-value=9.9  Score=29.40  Aligned_cols=24  Identities=38%  Similarity=0.606  Sum_probs=14.5

Q ss_pred             cccCccchhccChHHHHHHHHHHh
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYEC   73 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~   73 (177)
                      |.|++|...|.....|..|...-|
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhc
Confidence            556666666666666666655444


No 169
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=48.47  E-value=8.5  Score=19.95  Aligned_cols=12  Identities=17%  Similarity=0.584  Sum_probs=9.0

Q ss_pred             ccCCCCcccccc
Q psy16601        153 FKCPYCDKRCKL  164 (177)
Q Consensus       153 ~~C~~C~~~f~~  164 (177)
                      |+|..||+.+.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            788888877653


No 170
>KOG3507|consensus
Probab=48.11  E-value=13  Score=19.88  Aligned_cols=13  Identities=23%  Similarity=0.662  Sum_probs=7.5

Q ss_pred             CceecCCcccccc
Q psy16601        122 GSFICPKCSNRYV  134 (177)
Q Consensus       122 ~~~~C~~C~~~f~  134 (177)
                      ..+.|..||.+..
T Consensus        36 D~irCReCG~RIl   48 (62)
T KOG3507|consen   36 DVIRCRECGYRIL   48 (62)
T ss_pred             CcEehhhcchHHH
Confidence            4566666665543


No 171
>COG1773 Rubredoxin [Energy production and conversion]
Probab=48.00  E-value=7.7  Score=20.55  Aligned_cols=11  Identities=18%  Similarity=0.745  Sum_probs=7.2

Q ss_pred             ccCCCCccccc
Q psy16601        153 FKCPYCDKRCK  163 (177)
Q Consensus       153 ~~C~~C~~~f~  163 (177)
                      |+|..||+.|.
T Consensus         4 ~~C~~CG~vYd   14 (55)
T COG1773           4 WRCSVCGYVYD   14 (55)
T ss_pred             eEecCCceEec
Confidence            66777776653


No 172
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=47.92  E-value=11  Score=20.61  Aligned_cols=29  Identities=21%  Similarity=0.552  Sum_probs=13.1

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQK   91 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~   91 (177)
                      -.|.+|++.|.-.            ..+ +-|..||..|-..
T Consensus        10 ~~C~~C~~~F~~~------------~rr-hhCr~CG~~vC~~   38 (69)
T PF01363_consen   10 SNCMICGKKFSLF------------RRR-HHCRNCGRVVCSS   38 (69)
T ss_dssp             SB-TTT--B-BSS------------S-E-EE-TTT--EEECC
T ss_pred             CcCcCcCCcCCCc------------eee-EccCCCCCEECCc
Confidence            4699999999531            223 7788888776543


No 173
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=47.48  E-value=12  Score=18.19  Aligned_cols=18  Identities=22%  Similarity=0.464  Sum_probs=10.5

Q ss_pred             eeCCCCccccccchHHHh
Q psy16601         79 FKCPHCNKKCHQKCNLKS   96 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~   96 (177)
                      +.|+.|+-.+-....|..
T Consensus        20 d~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EECCCCCeEEccHHHHHH
Confidence            566666666555555543


No 174
>KOG1280|consensus
Probab=47.24  E-value=16  Score=27.36  Aligned_cols=39  Identities=23%  Similarity=0.491  Sum_probs=28.1

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCC-CCCccCCCCc
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGV-EPQFKCPYCD  159 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~~~C~~C~  159 (177)
                      ...|.|++|+++=-+...|..|...-|.+ .....|++|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            34799999998888888899998865552 2234566664


No 175
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=46.89  E-value=15  Score=19.36  Aligned_cols=12  Identities=50%  Similarity=1.068  Sum_probs=8.8

Q ss_pred             eeCCCCcccccc
Q psy16601         79 FKCPHCNKKCHQ   90 (177)
Q Consensus        79 ~~C~~C~~~f~~   90 (177)
                      .+|..||+.|..
T Consensus         6 ~~C~~Cg~~~~~   17 (54)
T PF14446_consen    6 CKCPVCGKKFKD   17 (54)
T ss_pred             ccChhhCCcccC
Confidence            468888887754


No 176
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=46.63  E-value=8.5  Score=19.06  Aligned_cols=14  Identities=50%  Similarity=0.980  Sum_probs=9.0

Q ss_pred             ceeCCCCccccccc
Q psy16601         78 KFKCPHCNKKCHQK   91 (177)
Q Consensus        78 ~~~C~~C~~~f~~~   91 (177)
                      ||.|..|+..|-..
T Consensus        13 ~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   13 PFKCKHCGKSFCLK   26 (43)
T ss_dssp             HEE-TTTS-EE-TT
T ss_pred             CeECCCCCcccCcc
Confidence            58999999988664


No 177
>KOG4124|consensus
Probab=45.94  E-value=3  Score=31.00  Aligned_cols=52  Identities=27%  Similarity=0.552  Sum_probs=36.4

Q ss_pred             CCceecC--CccccccChhHHHHHHHHhhC------------------CCCCccCCCCcccccchhHHHHHH
Q psy16601        121 NGSFICP--KCSNRYVYKHNLKQHLKFECG------------------VEPQFKCPYCDKRCKLKGNLMSHI  172 (177)
Q Consensus       121 ~~~~~C~--~C~~~f~~~~~l~~H~~~h~~------------------~~~~~~C~~C~~~f~~~~~l~~H~  172 (177)
                      .++|+|+  .|.+.+.+.-.|..|...-|.                  ..++|.|++|.+..+....|.-|.
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            4688995  499999887777766543221                  156799999998887665554443


No 178
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=45.83  E-value=13  Score=29.10  Aligned_cols=11  Identities=27%  Similarity=0.815  Sum_probs=7.2

Q ss_pred             ccccCccchhc
Q psy16601         49 VFACPKCSKTY   59 (177)
Q Consensus        49 ~~~C~~C~~~f   59 (177)
                      .|.|..||..+
T Consensus         7 ~y~C~~Cg~~~   17 (454)
T TIGR00416         7 KFVCQHCGADS   17 (454)
T ss_pred             eEECCcCCCCC
Confidence            47777777543


No 179
>PRK11823 DNA repair protein RadA; Provisional
Probab=45.69  E-value=13  Score=28.99  Aligned_cols=24  Identities=21%  Similarity=0.711  Sum_probs=15.5

Q ss_pred             CccccCccchhccChHHHHHHHHHHhCCCCceeCCCCcc
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNK   86 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~   86 (177)
                      ..|.|..||..+...              - ++|+.|+.
T Consensus         6 ~~y~C~~Cg~~~~~~--------------~-g~Cp~C~~   29 (446)
T PRK11823          6 TAYVCQECGAESPKW--------------L-GRCPECGA   29 (446)
T ss_pred             CeEECCcCCCCCccc--------------C-eeCcCCCC
Confidence            348888888654321              2 78888874


No 180
>KOG2907|consensus
Probab=45.27  E-value=9.1  Score=23.52  Aligned_cols=40  Identities=25%  Similarity=0.551  Sum_probs=23.0

Q ss_pred             eecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccc
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKL  164 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~  164 (177)
                      -+|+.|+-.=..-..|+- +..-.|.-.-|.|+.|++.|.-
T Consensus        75 ~kCpkCghe~m~Y~T~Ql-RSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQL-RSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhhc-ccccCCceEEEEcCccceeeec
Confidence            479999854332222221 1122233445999999999864


No 181
>KOG0320|consensus
Probab=45.22  E-value=15  Score=24.68  Aligned_cols=48  Identities=25%  Similarity=0.497  Sum_probs=25.8

Q ss_pred             CCCCCCCCccccCccchhccChHHH---HHHHH----HHhCCCCceeCCCCcccc
Q psy16601         41 EDKPAGEDVFACPKCSKTYLRQYTL---NAHLR----YECGKRPKFKCPHCNKKC   88 (177)
Q Consensus        41 ~~~~~~~~~~~C~~C~~~f~~~~~l---~~H~~----~h~~~~~~~~C~~C~~~f   88 (177)
                      .....++..|.|++|-..|..+...   -.|+-    .....+..-+|+.|++..
T Consensus       123 v~~~~~~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkI  177 (187)
T KOG0320|consen  123 VDPLRKEGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKI  177 (187)
T ss_pred             ccccccccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCccccc
Confidence            3344455669999998777665422   11221    111111236799998744


No 182
>KOG1842|consensus
Probab=45.21  E-value=13  Score=28.79  Aligned_cols=28  Identities=29%  Similarity=0.456  Sum_probs=24.3

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCC
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGV  149 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~  149 (177)
                      ..|.|+.|...|.+.+.|..|...-|++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhccc
Confidence            4689999999999999999999876654


No 183
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.77  E-value=12  Score=20.26  Aligned_cols=40  Identities=18%  Similarity=0.487  Sum_probs=21.2

Q ss_pred             cccCccchh-ccChHHHHHHHHHHhCCCCceeCCCCcccccc
Q psy16601         50 FACPKCSKT-YLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQ   90 (177)
Q Consensus        50 ~~C~~C~~~-f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~   90 (177)
                      .+|.+|+.. +.....+.. .+.......-|-|++|......
T Consensus         3 vkCiiCd~v~~iD~rt~~t-KrLrN~PIrtymC~eC~~Rva~   43 (68)
T COG4896           3 VKCIICDRVDEIDNRTFKT-KRLRNKPIRTYMCPECEHRVAI   43 (68)
T ss_pred             ceEEEecceeeecchhHHH-HHhhCCCceeEechhhHhhhch
Confidence            468888754 333333433 2222223334889999755433


No 184
>KOG4727|consensus
Probab=44.53  E-value=15  Score=24.43  Aligned_cols=25  Identities=20%  Similarity=0.460  Sum_probs=22.2

Q ss_pred             CCCceecCCccccccChhHHHHHHH
Q psy16601        120 LNGSFICPKCSNRYVYKHNLKQHLK  144 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~~~~~l~~H~~  144 (177)
                      ...+|-|.+|+=.|...-++..|+.
T Consensus        72 q~~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   72 QKGGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ccCceeeeecceeehhhHHHHHHhc
Confidence            3567999999999999999999976


No 185
>KOG0717|consensus
Probab=44.36  E-value=14  Score=28.81  Aligned_cols=40  Identities=18%  Similarity=0.376  Sum_probs=26.3

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccchHHHhHHHHhc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKCNLKSHIALKH  102 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  102 (177)
                      +-|.+|+++|.+..++..|....             +.-.....|..+|....
T Consensus       293 lyC~vCnKsFKseKq~kNHEnSK-------------KHkenv~eLrqemEEEe  332 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENSK-------------KHKENVAELRQEMEEEE  332 (508)
T ss_pred             eEEeeccccccchHHHHhhHHHH-------------HHHHHHHHHHHHHHHhh
Confidence            67888888888888888775332             23333455667776653


No 186
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=44.12  E-value=21  Score=21.72  Aligned_cols=28  Identities=18%  Similarity=0.405  Sum_probs=22.6

Q ss_pred             CCCCCccccCccchhccChHHHHHHHHH
Q psy16601         44 PAGEDVFACPKCSKTYLRQYTLNAHLRY   71 (177)
Q Consensus        44 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~   71 (177)
                      ..|-..+-|-.|.+-|.+...|..|.+.
T Consensus        50 lPGlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          50 LPGLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCCCceeeeehhHHHHHHHHHHHHHhcc
Confidence            3445568899999999999999998764


No 187
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=43.53  E-value=10  Score=19.76  Aligned_cols=13  Identities=23%  Similarity=0.741  Sum_probs=7.3

Q ss_pred             eCCCCccccccch
Q psy16601         80 KCPHCNKKCHQKC   92 (177)
Q Consensus        80 ~C~~C~~~f~~~~   92 (177)
                      .||+|++.|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            8999999987654


No 188
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=43.50  E-value=13  Score=23.19  Aligned_cols=27  Identities=19%  Similarity=0.364  Sum_probs=18.0

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcc
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDK  160 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  160 (177)
                      -.+.|..|+..|.....            ..+.|+.||.
T Consensus        70 ~~~~C~~Cg~~~~~~~~------------~~~~CP~Cgs   96 (117)
T PRK00564         70 VELECKDCSHVFKPNAL------------DYGVCEKCHS   96 (117)
T ss_pred             CEEEhhhCCCccccCCc------------cCCcCcCCCC
Confidence            45789999977755422            2135999984


No 189
>KOG0402|consensus
Probab=42.87  E-value=9.7  Score=21.96  Aligned_cols=14  Identities=21%  Similarity=0.560  Sum_probs=11.1

Q ss_pred             CCceecCCcccccc
Q psy16601        121 NGSFICPKCSNRYV  134 (177)
Q Consensus       121 ~~~~~C~~C~~~f~  134 (177)
                      .+.|.|..|.+.+.
T Consensus        52 vGiW~C~~C~kv~a   65 (92)
T KOG0402|consen   52 VGIWKCGSCKKVVA   65 (92)
T ss_pred             eeEEecCCccceec
Confidence            46799999988874


No 190
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=42.72  E-value=17  Score=22.54  Aligned_cols=13  Identities=15%  Similarity=0.445  Sum_probs=9.5

Q ss_pred             ceeCCCCcccccc
Q psy16601         78 KFKCPHCNKKCHQ   90 (177)
Q Consensus        78 ~~~C~~C~~~f~~   90 (177)
                      .+.|..||..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (114)
T PRK03681         70 ECWCETCQQYVTL   82 (114)
T ss_pred             EEEcccCCCeeec
Confidence            3789999976644


No 191
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=42.08  E-value=19  Score=18.83  Aligned_cols=16  Identities=25%  Similarity=0.727  Sum_probs=12.0

Q ss_pred             cccCccchhccChHHH
Q psy16601         50 FACPKCSKTYLRQYTL   65 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l   65 (177)
                      +.|..|+..|....+.
T Consensus        29 W~C~~Cgh~w~~~v~~   44 (55)
T PF14311_consen   29 WKCPKCGHEWKASVND   44 (55)
T ss_pred             EECCCCCCeeEccHhh
Confidence            6899998888776443


No 192
>PTZ00448 hypothetical protein; Provisional
Probab=41.79  E-value=20  Score=27.17  Aligned_cols=23  Identities=22%  Similarity=0.592  Sum_probs=19.5

Q ss_pred             ccccCccchhccChHHHHHHHHH
Q psy16601         49 VFACPKCSKTYLRQYTLNAHLRY   71 (177)
Q Consensus        49 ~~~C~~C~~~f~~~~~l~~H~~~   71 (177)
                      .|.|..|+..|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999888888888875


No 193
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=41.64  E-value=8.7  Score=19.61  Aligned_cols=11  Identities=27%  Similarity=0.972  Sum_probs=7.5

Q ss_pred             ccCCCCccccc
Q psy16601        153 FKCPYCDKRCK  163 (177)
Q Consensus       153 ~~C~~C~~~f~  163 (177)
                      |+|.+|++.+.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            67777776654


No 194
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=41.27  E-value=9.1  Score=23.08  Aligned_cols=37  Identities=19%  Similarity=0.466  Sum_probs=22.3

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccch
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLK  165 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  165 (177)
                      ..-|.|++|+. ....-.+.      .+ .....|..||+.+...
T Consensus        19 pt~f~CP~Cge-~~v~v~~~------k~-~~h~~C~~CG~y~~~~   55 (99)
T PRK14892         19 PKIFECPRCGK-VSISVKIK------KN-IAIITCGNCGLYTEFE   55 (99)
T ss_pred             CcEeECCCCCC-eEeeeecC------CC-cceEECCCCCCccCEE
Confidence            35689999993 21111111      13 5558999999876643


No 195
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=41.21  E-value=62  Score=22.27  Aligned_cols=54  Identities=20%  Similarity=0.354  Sum_probs=29.6

Q ss_pred             CCCCCccccCccchhccChHHH--HHHHHHHh---CCCCceeCCCCccc----cccchHHHhH
Q psy16601         44 PAGEDVFACPKCSKTYLRQYTL--NAHLRYEC---GKRPKFKCPHCNKK----CHQKCNLKSH   97 (177)
Q Consensus        44 ~~~~~~~~C~~C~~~f~~~~~l--~~H~~~h~---~~~~~~~C~~C~~~----f~~~~~l~~H   97 (177)
                      .....||.|.+|.+.|.+...-  ..|...-.   .-++.-.|-+||+.    |+...+|.+-
T Consensus       191 ~~e~IPF~C~iCKkdy~spvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G~f~V~~d~~km  253 (259)
T COG5152         191 PGEKIPFLCGICKKDYESPVVTECGHSFCSLCAIRKYQKGDECGVCGKATYGRFWVVSDLQKM  253 (259)
T ss_pred             CCCCCceeehhchhhccchhhhhcchhHHHHHHHHHhccCCcceecchhhccceeHHhhHHHH
Confidence            4455789999999988876331  11111100   00112468899875    4444555443


No 196
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=41.02  E-value=17  Score=21.84  Aligned_cols=14  Identities=21%  Similarity=0.636  Sum_probs=11.6

Q ss_pred             CceeCCCCcccccc
Q psy16601         77 PKFKCPHCNKKCHQ   90 (177)
Q Consensus        77 ~~~~C~~C~~~f~~   90 (177)
                      ++++|++||..|.-
T Consensus        78 ~~~rC~eCG~~fkL   91 (97)
T cd00924          78 KPKRCPECGHVFKL   91 (97)
T ss_pred             CceeCCCCCcEEEE
Confidence            45999999998864


No 197
>KOG4477|consensus
Probab=40.93  E-value=24  Score=23.78  Aligned_cols=29  Identities=31%  Similarity=0.763  Sum_probs=18.5

Q ss_pred             cccCCCCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCc
Q psy16601        116 RNSQLNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCD  159 (177)
Q Consensus       116 ~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~  159 (177)
                      .....++-|-|..|  .|.++.            +. |.|-+|+
T Consensus        17 kp~~Deg~WdCsvC--TFrNsA------------eA-fkC~vCd   45 (228)
T KOG4477|consen   17 KPNDDEGKWDCSVC--TFRNSA------------EA-FKCFVCD   45 (228)
T ss_pred             CCccccCceeeeee--eecchh------------hh-hheeeec
Confidence            33445677889988  444433            33 8888886


No 198
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=40.59  E-value=18  Score=17.92  Aligned_cols=16  Identities=25%  Similarity=0.935  Sum_probs=12.9

Q ss_pred             ecCCccccccChhHHH
Q psy16601        125 ICPKCSNRYVYKHNLK  140 (177)
Q Consensus       125 ~C~~C~~~f~~~~~l~  140 (177)
                      .|..|++.|..+....
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            7999999998766554


No 199
>KOG2593|consensus
Probab=40.50  E-value=27  Score=27.05  Aligned_cols=35  Identities=23%  Similarity=0.779  Sum_probs=22.6

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCc
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCD  159 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~  159 (177)
                      -..|.|+.|.+.|.....++-   .- -..-.|.|..|+
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L---~~-~~~~~F~C~~C~  160 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQL---LD-NETGEFHCENCG  160 (436)
T ss_pred             cccccCCccccchhhhHHHHh---hc-ccCceEEEecCC
Confidence            346889999888877665532   11 112348888886


No 200
>KOG1701|consensus
Probab=40.45  E-value=14  Score=28.50  Aligned_cols=39  Identities=21%  Similarity=0.312  Sum_probs=25.7

Q ss_pred             ccCccchhccChHHHHHHHHHHhCCCCceeCCCCcccccc
Q psy16601         51 ACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQ   90 (177)
Q Consensus        51 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~   90 (177)
                      .|..|++.......-..-|..-....- |.|..|++...-
T Consensus       276 iC~~C~K~V~g~~~ac~Am~~~fHv~C-FtC~~C~r~L~G  314 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAMDQLFHVQC-FTCRTCRRQLAG  314 (468)
T ss_pred             hhhhcCCcccCcchHHHHhhhhhcccc-eehHhhhhhhcc
Confidence            799999887776555454544333334 999999865443


No 201
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=39.79  E-value=20  Score=17.08  Aligned_cols=12  Identities=25%  Similarity=0.916  Sum_probs=7.7

Q ss_pred             CCCceecCCccc
Q psy16601        120 LNGSFICPKCSN  131 (177)
Q Consensus       120 ~~~~~~C~~C~~  131 (177)
                      .++-|.|..|+-
T Consensus        22 ~dG~~yC~~cG~   33 (36)
T PF11781_consen   22 DDGFYYCDRCGH   33 (36)
T ss_pred             cCCEEEhhhCce
Confidence            456677777763


No 202
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=39.54  E-value=16  Score=18.82  Aligned_cols=25  Identities=24%  Similarity=0.895  Sum_probs=16.6

Q ss_pred             ecCCccc-cccChhHHHHHHHHhhCCCCCccCCCCccc
Q psy16601        125 ICPKCSN-RYVYKHNLKQHLKFECGVEPQFKCPYCDKR  161 (177)
Q Consensus       125 ~C~~C~~-~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  161 (177)
                      .|+.|+. +|     |..|     . ++ +.|..||++
T Consensus        21 ~CPrCG~gvf-----mA~H-----~-dR-~~CGkCgyT   46 (51)
T COG1998          21 FCPRCGPGVF-----MADH-----K-DR-WACGKCGYT   46 (51)
T ss_pred             cCCCCCCcch-----hhhc-----C-ce-eEeccccce
Confidence            6888875 33     3333     2 45 899999986


No 203
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=39.31  E-value=15  Score=19.23  Aligned_cols=18  Identities=11%  Similarity=0.150  Sum_probs=10.7

Q ss_pred             cCCCCceecCCccccccC
Q psy16601        118 SQLNGSFICPKCSNRYVY  135 (177)
Q Consensus       118 ~~~~~~~~C~~C~~~f~~  135 (177)
                      ......|.|.+|++.+..
T Consensus        30 ~~~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   30 DKEPIKLRCHYCERIITE   47 (52)
T ss_dssp             ETTTCEEEETTT--EEEH
T ss_pred             eCCCCEEEeeCCCCEecc
Confidence            344566888888877754


No 204
>KOG2807|consensus
Probab=39.20  E-value=77  Score=23.75  Aligned_cols=69  Identities=14%  Similarity=0.260  Sum_probs=35.6

Q ss_pred             ceeCCCCccccccchHHHhHHHHhcCCCCC---CCCc-------cccccccCCCCceecCCccccccChhHHHHHHHHh
Q psy16601         78 KFKCPHCNKKCHQKCNLKSHIALKHDQLLA---PLAP-------RSYRRNSQLNGSFICPKCSNRYVYKHNLKQHLKFE  146 (177)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~---~~~~-------~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h  146 (177)
                      |..|+.|+-..-+...|.+-..-.-...+-   +...       ........+...|.|..|...|-.--....|...|
T Consensus       290 P~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccccCCCCcEEchhccceeeccchHHHHhhhh
Confidence            478899988887777777654221111000   0000       00012223445677777777766555555554443


No 205
>KOG0717|consensus
Probab=38.95  E-value=19  Score=28.11  Aligned_cols=22  Identities=23%  Similarity=0.537  Sum_probs=20.2

Q ss_pred             eecCCccccccChhHHHHHHHH
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKF  145 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~  145 (177)
                      +-|..|.+.|.+.-.|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            8899999999999999998875


No 206
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.74  E-value=7.6  Score=21.99  Aligned_cols=33  Identities=30%  Similarity=0.731  Sum_probs=22.1

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccc
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRC  162 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  162 (177)
                      -.|.|..|+..|    .+.+||.    ..+.-.|+.|+-.+
T Consensus        11 Y~Y~c~~cg~~~----dvvq~~~----ddplt~ce~c~a~~   43 (82)
T COG2331          11 YSYECTECGNRF----DVVQAMT----DDPLTTCEECGARL   43 (82)
T ss_pred             eEEeecccchHH----HHHHhcc----cCccccChhhChHH
Confidence            358999998776    4555544    24556788887544


No 207
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=38.73  E-value=18  Score=27.58  Aligned_cols=8  Identities=50%  Similarity=1.273  Sum_probs=6.2

Q ss_pred             eeCCCCcc
Q psy16601         79 FKCPHCNK   86 (177)
Q Consensus        79 ~~C~~C~~   86 (177)
                      .+|+.|+.
T Consensus        15 g~cp~c~~   22 (372)
T cd01121          15 GKCPECGE   22 (372)
T ss_pred             EECcCCCC
Confidence            78888875


No 208
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=38.71  E-value=34  Score=22.40  Aligned_cols=36  Identities=22%  Similarity=0.707  Sum_probs=24.1

Q ss_pred             CCCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCccc
Q psy16601        120 LNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKR  161 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  161 (177)
                      ..-+|.|. |+..|.+   .++|-..-.| + .|.|..|+-.
T Consensus       114 ~~~~Y~C~-C~q~~l~---~RRhn~~~~g-~-~YrC~~C~gk  149 (156)
T COG3091         114 TTYPYRCQ-CQQHYLR---IRRHNTVRRG-E-VYRCGKCGGK  149 (156)
T ss_pred             cceeEEee-cCCccch---hhhccccccc-c-eEEeccCCce
Confidence            45689999 9987643   3344444445 5 4999999854


No 209
>KOG2636|consensus
Probab=38.39  E-value=25  Score=27.36  Aligned_cols=27  Identities=11%  Similarity=0.274  Sum_probs=17.8

Q ss_pred             HhCCCCceeCCCCc-cccccchHHHhHHH
Q psy16601         72 ECGKRPKFKCPHCN-KKCHQKCNLKSHIA   99 (177)
Q Consensus        72 h~~~~~~~~C~~C~-~~f~~~~~l~~H~~   99 (177)
                      |.-... |.|.+|| ++++....+.+|..
T Consensus       396 HGL~~e-y~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIE-YNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcc-cceeeccCccccCcHHHHHHhH
Confidence            433434 8888887 66777777777764


No 210
>PLN02294 cytochrome c oxidase subunit Vb
Probab=38.28  E-value=16  Score=24.36  Aligned_cols=15  Identities=33%  Similarity=0.946  Sum_probs=11.6

Q ss_pred             CCccCCCCcccccch
Q psy16601        151 PQFKCPYCDKRCKLK  165 (177)
Q Consensus       151 ~~~~C~~C~~~f~~~  165 (177)
                      +++.|++||..|..+
T Consensus       140 kp~RCpeCG~~fkL~  154 (174)
T PLN02294        140 KSFECPVCTQYFELE  154 (174)
T ss_pred             CceeCCCCCCEEEEE
Confidence            458899999888754


No 211
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=38.22  E-value=13  Score=22.90  Aligned_cols=26  Identities=23%  Similarity=0.668  Sum_probs=16.9

Q ss_pred             ceecCCccccccChhHHHHHHHHhhCCCCCccCCCCccc
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKR  161 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  161 (177)
                      .+.|..|+..|.....            . +.|+.|+..
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~-~~CP~Cgs~   95 (113)
T PF01155_consen   70 RARCRDCGHEFEPDEF------------D-FSCPRCGSP   95 (113)
T ss_dssp             EEEETTTS-EEECHHC------------C-HH-SSSSSS
T ss_pred             cEECCCCCCEEecCCC------------C-CCCcCCcCC
Confidence            4789999998865442            2 559999854


No 212
>PTZ00448 hypothetical protein; Provisional
Probab=37.87  E-value=23  Score=26.81  Aligned_cols=21  Identities=14%  Similarity=0.331  Sum_probs=13.7

Q ss_pred             ccCCCCcccccchhHHHHHHh
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIA  173 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~  173 (177)
                      |.|..|+-.|.+....+.|++
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~K  335 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYR  335 (373)
T ss_pred             ccccccccccCCHHHHHHHhh
Confidence            666666666666666666665


No 213
>KOG1994|consensus
Probab=37.65  E-value=13  Score=25.93  Aligned_cols=22  Identities=27%  Similarity=0.617  Sum_probs=19.4

Q ss_pred             CCCccCCCCcccccchhHHHHHH
Q psy16601        150 EPQFKCPYCDKRCKLKGNLMSHI  172 (177)
Q Consensus       150 ~~~~~C~~C~~~f~~~~~l~~H~  172 (177)
                      +. |.|-.||..|.+...|..|-
T Consensus       238 eh-~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  238 EH-YYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             cc-eEEEEeccccCCHHHHHHhC
Confidence            55 99999999999999998885


No 214
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.10  E-value=9.2  Score=23.95  Aligned_cols=14  Identities=21%  Similarity=0.828  Sum_probs=8.2

Q ss_pred             ceecCCccccccCh
Q psy16601        123 SFICPKCSNRYVYK  136 (177)
Q Consensus       123 ~~~C~~C~~~f~~~  136 (177)
                      |--|..|++.|.+.
T Consensus        68 psfchncgs~fpwt   81 (160)
T COG4306          68 PSFCHNCGSRFPWT   81 (160)
T ss_pred             cchhhcCCCCCCcH
Confidence            33466677666553


No 215
>PRK12496 hypothetical protein; Provisional
Probab=37.06  E-value=26  Score=23.29  Aligned_cols=29  Identities=21%  Similarity=0.470  Sum_probs=19.2

Q ss_pred             ceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccc
Q psy16601        123 SFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKL  164 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~  164 (177)
                      .|.|..|++.|....            .. -.|++||.....
T Consensus       127 ~~~C~gC~~~~~~~~------------~~-~~C~~CG~~~~r  155 (164)
T PRK12496        127 RKVCKGCKKKYPEDY------------PD-DVCEICGSPVKR  155 (164)
T ss_pred             eEECCCCCccccCCC------------CC-CcCCCCCChhhh
Confidence            478999998884311            11 459999965443


No 216
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=35.85  E-value=29  Score=18.01  Aligned_cols=10  Identities=20%  Similarity=0.770  Sum_probs=4.8

Q ss_pred             ecCCcccccc
Q psy16601        125 ICPKCSNRYV  134 (177)
Q Consensus       125 ~C~~C~~~f~  134 (177)
                      .|..|++.|.
T Consensus         4 ~C~~C~~~F~   13 (57)
T cd00065           4 SCMGCGKPFT   13 (57)
T ss_pred             cCcccCcccc
Confidence            3445555554


No 217
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=35.62  E-value=12  Score=25.60  Aligned_cols=24  Identities=21%  Similarity=0.516  Sum_probs=0.0

Q ss_pred             CCCccCCCCc-ccccchhHHHHHHh
Q psy16601        150 EPQFKCPYCD-KRCKLKGNLMSHIA  173 (177)
Q Consensus       150 ~~~~~C~~C~-~~f~~~~~l~~H~~  173 (177)
                      .+.|.|.+|| +.+.-+.++.+|..
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -------------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHhcC
Confidence            3449999998 46777777877764


No 218
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=35.14  E-value=4.9  Score=27.41  Aligned_cols=43  Identities=19%  Similarity=0.212  Sum_probs=24.7

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCC--CCCccCCCCcccccch
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGV--EPQFKCPYCDKRCKLK  165 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~--~~~~~C~~C~~~f~~~  165 (177)
                      +....|+.|+..+.....+..  .-|-|.  ...+.|..|||+++.-
T Consensus        12 ~~~~~CPvCg~~l~~~~~~~~--IPyFG~V~i~t~~C~~CgYR~~DV   56 (201)
T COG1779          12 ETRIDCPVCGGTLKAHMYLYD--IPYFGEVLISTGVCERCGYRSTDV   56 (201)
T ss_pred             eeeecCCcccceeeEEEeeec--CCccceEEEEEEEccccCCcccce
Confidence            345689999875443332211  112221  2247899999988753


No 219
>PRK04351 hypothetical protein; Provisional
Probab=35.04  E-value=19  Score=23.50  Aligned_cols=34  Identities=24%  Similarity=0.712  Sum_probs=22.3

Q ss_pred             CccccCccchhccChHHHHHHHHHHhCCCCceeCCCCcccccc
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQ   90 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~   90 (177)
                      -.|.|..|+..+.+..       .+ ...+ |.|..|+-.+.-
T Consensus       111 y~Y~C~~Cg~~~~r~R-------r~-n~~~-yrCg~C~g~L~~  144 (149)
T PRK04351        111 YLYECQSCGQQYLRKR-------RI-NTKR-YRCGKCRGKLKL  144 (149)
T ss_pred             EEEECCCCCCEeeeee-------ec-CCCc-EEeCCCCcEeee
Confidence            4488999997765432       12 2335 999999876543


No 220
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=34.96  E-value=24  Score=22.90  Aligned_cols=18  Identities=22%  Similarity=0.462  Sum_probs=10.5

Q ss_pred             ccCCCCcccccchhHHHH
Q psy16601        153 FKCPYCDKRCKLKGNLMS  170 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~  170 (177)
                      +.|+.|++.|...++..+
T Consensus       125 ~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen  125 WRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             EECCCCCCEecccccHHH
Confidence            666666666665554443


No 221
>PRK00420 hypothetical protein; Validated
Probab=34.15  E-value=35  Score=21.14  Aligned_cols=15  Identities=27%  Similarity=0.829  Sum_probs=10.8

Q ss_pred             CCceecCCccccccC
Q psy16601        121 NGSFICPKCSNRYVY  135 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~  135 (177)
                      ++...|+.|+....-
T Consensus        38 ~g~~~Cp~Cg~~~~v   52 (112)
T PRK00420         38 DGEVVCPVHGKVYIV   52 (112)
T ss_pred             CCceECCCCCCeeee
Confidence            356789999976653


No 222
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=33.83  E-value=27  Score=23.52  Aligned_cols=30  Identities=37%  Similarity=1.144  Sum_probs=20.2

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcc
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDK  160 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  160 (177)
                      ...|.|+.|...|..-..+      ..+    |.|+.||-
T Consensus       111 ~~~y~C~~~~~r~sfdeA~------~~~----F~Cp~Cg~  140 (176)
T COG1675         111 NNYYVCPNCHVKYSFDEAM------ELG----FTCPKCGE  140 (176)
T ss_pred             CCceeCCCCCCcccHHHHH------HhC----CCCCCCCc
Confidence            4568998887666443332      223    99999984


No 223
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=33.61  E-value=20  Score=26.39  Aligned_cols=33  Identities=15%  Similarity=0.396  Sum_probs=22.1

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccch
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKC   92 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~   92 (177)
                      .+|+.|+..+..+ .|..         ..+.|+.|+..|.-..
T Consensus        39 ~kc~~C~~~~~~~-~l~~---------~~~vcp~c~~h~rltA   71 (296)
T CHL00174         39 VQCENCYGLNYKK-FLKS---------KMNICEQCGYHLKMSS   71 (296)
T ss_pred             eECCCccchhhHH-HHHH---------cCCCCCCCCCCcCCCH
Confidence            3799999876544 2322         1289999998876543


No 224
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=33.60  E-value=29  Score=25.38  Aligned_cols=22  Identities=32%  Similarity=0.561  Sum_probs=12.5

Q ss_pred             CceecCCccccccChhHHHHHH
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHL  143 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~  143 (177)
                      .-|.|..|-+-|.+...|.+|+
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~   68 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHL   68 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHH
Confidence            3455666666666666655553


No 225
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=33.41  E-value=53  Score=24.11  Aligned_cols=25  Identities=32%  Similarity=0.624  Sum_probs=22.2

Q ss_pred             CCCccCCCCcccccchhHHHHHHhh
Q psy16601        150 EPQFKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       150 ~~~~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                      ...|.|..|-+-|.+...|.+|+..
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHh
Confidence            4459999999999999999999863


No 226
>PF07911 DUF1677:  Protein of unknown function (DUF1677);  InterPro: IPR012876 The sequences found in this family are all derived from hypothetical plant proteins of unknown function. The region features a number of highly conserved cysteine residues. 
Probab=33.34  E-value=28  Score=20.60  Aligned_cols=39  Identities=21%  Similarity=0.350  Sum_probs=27.1

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCcccccc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQ   90 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~   90 (177)
                      -+|.-||..=.--..+...++....+ + |.|.+|..+.+.
T Consensus         5 akCeCCG~~EECT~~YI~~VR~ry~G-r-WvCGLC~EAVke   43 (91)
T PF07911_consen    5 AKCECCGLTEECTPEYIARVRERYGG-R-WVCGLCSEAVKE   43 (91)
T ss_pred             eeecCCCCchhccHHHHHHHHHHhCC-e-ehhhcCHHHHHH
Confidence            46888887666556666777665544 5 999999876543


No 227
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=33.11  E-value=35  Score=30.44  Aligned_cols=28  Identities=25%  Similarity=0.790  Sum_probs=16.6

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCCCccCCCCccc
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKR  161 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  161 (177)
                      ..|.|+.|+.......         +  . ...|+.|+..
T Consensus       691 ~vy~CPsCGaev~~de---------s--~-a~~CP~CGtp  718 (1337)
T PRK14714        691 PVYVCPDCGAEVPPDE---------S--G-RVECPRCDVE  718 (1337)
T ss_pred             CceeCccCCCccCCCc---------c--c-cccCCCCCCc
Confidence            3578888887543210         1  1 2569999843


No 228
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=33.01  E-value=4.8  Score=19.13  Aligned_cols=10  Identities=20%  Similarity=0.913  Sum_probs=4.8

Q ss_pred             eeCCCCcccc
Q psy16601         79 FKCPHCNKKC   88 (177)
Q Consensus        79 ~~C~~C~~~f   88 (177)
                      ..|..||-.+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            5677777554


No 229
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG2879 Uncharacterized small protein [Function unknown]
Probab=32.35  E-value=56  Score=17.84  Aligned_cols=17  Identities=18%  Similarity=0.276  Sum_probs=12.3

Q ss_pred             ChHHHHHHHHHHhCCCC
Q psy16601         61 RQYTLNAHLRYECGKRP   77 (177)
Q Consensus        61 ~~~~l~~H~~~h~~~~~   77 (177)
                      .-.++..||+.+|+.++
T Consensus        24 dYdnYVehmr~~hPd~p   40 (65)
T COG2879          24 DYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             cHHHHHHHHHHhCcCCC
Confidence            34677888888887765


No 231
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=32.21  E-value=23  Score=16.96  Aligned_cols=11  Identities=36%  Similarity=0.987  Sum_probs=5.9

Q ss_pred             ceeCCCCcccc
Q psy16601         78 KFKCPHCNKKC   88 (177)
Q Consensus        78 ~~~C~~C~~~f   88 (177)
                      -|+|..||...
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            38899998654


No 232
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.86  E-value=28  Score=21.56  Aligned_cols=20  Identities=20%  Similarity=0.600  Sum_probs=10.2

Q ss_pred             eeCCCCccccccchHHHhHH
Q psy16601         79 FKCPHCNKKCHQKCNLKSHI   98 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~   98 (177)
                      |.|+.|...|--.-++-.|-
T Consensus        82 y~C~~C~~~FC~dCD~fiHe  101 (112)
T TIGR00622        82 YVCAVCKNVFCVDCDVFVHE  101 (112)
T ss_pred             eeCCCCCCccccccchhhhh
Confidence            55555555555444444443


No 233
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=31.28  E-value=49  Score=17.50  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=13.7

Q ss_pred             eeCCCCccccccchHHHh
Q psy16601         79 FKCPHCNKKCHQKCNLKS   96 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~   96 (177)
                      +-|-.||..|.+...|..
T Consensus        28 ~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   28 NYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             ceeeeeCCccCCHHHHHh
Confidence            568888888888877753


No 234
>PHA02998 RNA polymerase subunit; Provisional
Probab=31.15  E-value=14  Score=24.75  Aligned_cols=40  Identities=23%  Similarity=0.465  Sum_probs=23.5

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCC---CccCCCCcccccch
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEP---QFKCPYCDKRCKLK  165 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~---~~~C~~C~~~f~~~  165 (177)
                      ....|+.|+..=.....+    ++....|+   -|.|..|++.|...
T Consensus       142 t~v~CPkCg~~~A~f~ql----QTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        142 YNTPCPNCKSKNTTPMMI----QTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             cCCCCCCCCCCceEEEEE----eeccCCCCceEEEEcCCCCCccCCc
Confidence            456899997443332222    22333344   38999999887643


No 235
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=30.95  E-value=39  Score=21.60  Aligned_cols=15  Identities=27%  Similarity=0.580  Sum_probs=12.2

Q ss_pred             ccCCCCcccccchhH
Q psy16601        153 FKCPYCDKRCKLKGN  167 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~  167 (177)
                      -+|+.|..+|+++..
T Consensus       122 pvCPvCkTSFKss~~  136 (140)
T PF05290_consen  122 PVCPVCKTSFKSSSS  136 (140)
T ss_pred             CCCCccccccccccc
Confidence            579999999988753


No 236
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=30.82  E-value=17  Score=26.88  Aligned_cols=11  Identities=27%  Similarity=0.691  Sum_probs=7.1

Q ss_pred             CccccCccchh
Q psy16601         48 DVFACPKCSKT   58 (177)
Q Consensus        48 ~~~~C~~C~~~   58 (177)
                      ..-.|++||..
T Consensus       186 ~~~~CPvCGs~  196 (309)
T PRK03564        186 QRQFCPVCGSM  196 (309)
T ss_pred             CCCCCCCCCCc
Confidence            34568888853


No 237
>KOG4118|consensus
Probab=30.74  E-value=28  Score=19.07  Aligned_cols=26  Identities=27%  Similarity=0.478  Sum_probs=18.2

Q ss_pred             eeCCCCccccccchHHHhHHHHhcCC
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHDQ  104 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~~  104 (177)
                      |.|.+|--.......+..|....|..
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk   64 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPK   64 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCC
Confidence            66777776666677777777776664


No 238
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=30.73  E-value=58  Score=24.57  Aligned_cols=16  Identities=19%  Similarity=0.914  Sum_probs=11.2

Q ss_pred             HhCCCCceeCCCCccc
Q psy16601         72 ECGKRPKFKCPHCNKK   87 (177)
Q Consensus        72 h~~~~~~~~C~~C~~~   87 (177)
                      -....+.|+|..||..
T Consensus       348 ~l~~~~~YRC~~CGF~  363 (389)
T COG2956         348 QLRRKPRYRCQNCGFT  363 (389)
T ss_pred             HHhhcCCceecccCCc
Confidence            3444567999999954


No 239
>KOG3214|consensus
Probab=30.67  E-value=26  Score=21.10  Aligned_cols=15  Identities=20%  Similarity=0.563  Sum_probs=11.0

Q ss_pred             CceecCCccccccCh
Q psy16601        122 GSFICPKCSNRYVYK  136 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~  136 (177)
                      +...|..|+.+|...
T Consensus        46 G~~sC~iC~esFqt~   60 (109)
T KOG3214|consen   46 GKASCRICEESFQTT   60 (109)
T ss_pred             ceeeeeehhhhhccc
Confidence            456888888888653


No 240
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=30.63  E-value=15  Score=23.88  Aligned_cols=33  Identities=24%  Similarity=0.756  Sum_probs=21.1

Q ss_pred             CccccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccc
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCH   89 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~   89 (177)
                      -.|.|..|+..+.....      .  .... |.|..|+..+.
T Consensus       122 ~~~~C~~C~~~~~r~~~------~--~~~~-~~C~~C~~~l~  154 (157)
T PF10263_consen  122 YVYRCPSCGREYKRHRR------S--KRKR-YRCGRCGGPLV  154 (157)
T ss_pred             eEEEcCCCCCEeeeecc------c--chhh-EECCCCCCEEE
Confidence            45789999987644322      2  1123 89999986553


No 241
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.53  E-value=30  Score=18.76  Aligned_cols=16  Identities=44%  Similarity=1.012  Sum_probs=12.0

Q ss_pred             CCCceecCCccccccC
Q psy16601        120 LNGSFICPKCSNRYVY  135 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~~  135 (177)
                      .++-..|++|++.|..
T Consensus        45 ~~gev~CPYC~t~y~l   60 (62)
T COG4391          45 DEGEVVCPYCSTRYRL   60 (62)
T ss_pred             CCCcEecCccccEEEe
Confidence            3455789999988863


No 242
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=30.45  E-value=19  Score=22.63  Aligned_cols=31  Identities=23%  Similarity=0.525  Sum_probs=18.7

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCCCccCCCCc
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCD  159 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~  159 (177)
                      ..+.| .|+..|.....-..|     - ...+.|+.||
T Consensus        69 ~~~~C-~Cg~~~~~~~~~~~~-----~-~~~~~CP~Cg   99 (124)
T PRK00762         69 VEIEC-ECGYEGVVDEDEIDH-----Y-AAVIECPVCG   99 (124)
T ss_pred             eeEEe-eCcCcccccccchhc-----c-ccCCcCcCCC
Confidence            45789 999887654311111     0 1236899998


No 243
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.38  E-value=20  Score=18.33  Aligned_cols=19  Identities=16%  Similarity=0.359  Sum_probs=13.3

Q ss_pred             eeCCCCccccccchHHHhH
Q psy16601         79 FKCPHCNKKCHQKCNLKSH   97 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H   97 (177)
                      -+|+.|++-|.....+.+-
T Consensus        13 KICpvCqRPFsWRkKW~~c   31 (54)
T COG4338          13 KICPVCQRPFSWRKKWARC   31 (54)
T ss_pred             hhhhhhcCchHHHHHHHHH
Confidence            3689999888766555543


No 244
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=30.35  E-value=50  Score=22.52  Aligned_cols=51  Identities=25%  Similarity=0.583  Sum_probs=25.4

Q ss_pred             ceecCC----ccccccChhHHHHHHHHhhCCCCCccCCC----CcccccchhHHHHHHhhhcC
Q psy16601        123 SFICPK----CSNRYVYKHNLKQHLKFECGVEPQFKCPY----CDKRCKLKGNLMSHIALKHT  177 (177)
Q Consensus       123 ~~~C~~----C~~~f~~~~~l~~H~~~h~~~~~~~~C~~----C~~~f~~~~~l~~H~~~~h~  177 (177)
                      .+.|+.    |...+.. .....|.....  -+|+.|+.    |+..=. ...|..|+...|.
T Consensus        14 ~~pC~~~~~GC~~~~~~-~~~~~HE~~C~--~~p~~CP~~~~~C~~~G~-~~~l~~Hl~~~H~   72 (198)
T PF03145_consen   14 KFPCKNAKYGCTETFPY-SEKREHEEECP--FRPCSCPFPGSGCDWQGS-YKELLDHLRDKHS   72 (198)
T ss_dssp             -EE-CCGGGT---EE-G-GGHHHHHHT-T--TSEEE-SSSSTT---EEE-CCCHHHHHHHHTT
T ss_pred             eecCCCCCCCCcccccc-cChhhHhccCC--CcCCcCCCCCCCccccCC-HHHHHHHHHHHCC
Confidence            366765    7666544 35677776553  33488888    665443 3478888887763


No 245
>KOG3556|consensus
Probab=29.96  E-value=43  Score=26.79  Aligned_cols=12  Identities=17%  Similarity=0.387  Sum_probs=7.1

Q ss_pred             CCCccccCccch
Q psy16601         46 GEDVFACPKCSK   57 (177)
Q Consensus        46 ~~~~~~C~~C~~   57 (177)
                      ...+-+|.+||.
T Consensus       555 e~~prQcsicg~  566 (724)
T KOG3556|consen  555 EVNPRQCSICGL  566 (724)
T ss_pred             cCCcceeeeccc
Confidence            344556777764


No 246
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=29.55  E-value=25  Score=25.84  Aligned_cols=33  Identities=27%  Similarity=0.694  Sum_probs=21.7

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccch
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQKC   92 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~   92 (177)
                      .+|+.|+..+..+ .|...        . +.|+.|+..|.-..
T Consensus        28 ~~c~~c~~~~~~~-~l~~~--------~-~vc~~c~~h~rl~a   60 (292)
T PRK05654         28 TKCPSCGQVLYRK-ELEAN--------L-NVCPKCGHHMRISA   60 (292)
T ss_pred             eECCCccchhhHH-HHHhc--------C-CCCCCCCCCeeCCH
Confidence            3799999865543 22221        2 78999999886443


No 247
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=29.46  E-value=21  Score=17.39  Aligned_cols=9  Identities=44%  Similarity=1.508  Sum_probs=4.7

Q ss_pred             eecCCcccc
Q psy16601        124 FICPKCSNR  132 (177)
Q Consensus       124 ~~C~~C~~~  132 (177)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            455555543


No 248
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=29.41  E-value=7.6  Score=31.95  Aligned_cols=11  Identities=36%  Similarity=1.014  Sum_probs=7.9

Q ss_pred             CceecCCcccc
Q psy16601        122 GSFICPKCSNR  132 (177)
Q Consensus       122 ~~~~C~~C~~~  132 (177)
                      .|..|+.||-.
T Consensus       172 Qp~aCp~CGP~  182 (750)
T COG0068         172 QPIACPKCGPH  182 (750)
T ss_pred             ccccCcccCCC
Confidence            45689999853


No 249
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=29.22  E-value=26  Score=22.32  Aligned_cols=15  Identities=20%  Similarity=0.587  Sum_probs=11.9

Q ss_pred             ccccCccchhccChH
Q psy16601         49 VFACPKCSKTYLRQY   63 (177)
Q Consensus        49 ~~~C~~C~~~f~~~~   63 (177)
                      |++|..||..|....
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            478999999998753


No 250
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=29.16  E-value=34  Score=22.02  Aligned_cols=17  Identities=18%  Similarity=0.352  Sum_probs=11.6

Q ss_pred             CCCCceecCCccccccC
Q psy16601        119 QLNGSFICPKCSNRYVY  135 (177)
Q Consensus       119 ~~~~~~~C~~C~~~f~~  135 (177)
                      ...-.|.|..||.....
T Consensus        77 ~~nl~~~CE~CG~~I~~   93 (137)
T TIGR03826        77 FPNLGYPCERCGTSIRE   93 (137)
T ss_pred             CCCCcCcccccCCcCCC
Confidence            34556889999876544


No 251
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=29.12  E-value=37  Score=22.91  Aligned_cols=25  Identities=20%  Similarity=0.479  Sum_probs=18.6

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCCCccCCCCccc
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKR  161 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  161 (177)
                      ..+.|..|.+.|.              .+. -.|++||-.
T Consensus       138 w~~rC~GC~~~f~--------------~~~-~~Cp~CG~~  162 (177)
T COG1439         138 WRLRCHGCKRIFP--------------EPK-DFCPICGSP  162 (177)
T ss_pred             eeEEEecCceecC--------------CCC-CcCCCCCCc
Confidence            3578999999996              133 569999854


No 252
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=29.04  E-value=37  Score=24.87  Aligned_cols=32  Identities=31%  Similarity=0.690  Sum_probs=20.5

Q ss_pred             eecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccch
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLK  165 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  165 (177)
                      .+|+.|+...-.+. |.         +..+.|+.|++-|...
T Consensus        27 ~~c~~c~~~~~~~~-l~---------~~~~vc~~c~~h~rl~   58 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-LE---------RNLEVCPKCDHHMRMD   58 (285)
T ss_pred             eECCCCcchhhHHH-HH---------hhCCCCCCCCCcCcCC
Confidence            47999987653333 21         2238999999877643


No 253
>KOG2071|consensus
Probab=28.85  E-value=35  Score=27.60  Aligned_cols=26  Identities=15%  Similarity=0.367  Sum_probs=22.6

Q ss_pred             CCCccCCCCcccccchhHHHHHHhhh
Q psy16601        150 EPQFKCPYCDKRCKLKGNLMSHIALK  175 (177)
Q Consensus       150 ~~~~~C~~C~~~f~~~~~l~~H~~~~  175 (177)
                      ..+-+|..||.+|.+......||-.|
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhh
Confidence            55699999999999999988888766


No 254
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=28.68  E-value=38  Score=18.00  Aligned_cols=32  Identities=19%  Similarity=0.473  Sum_probs=16.8

Q ss_pred             CccccCccchhccChHHHHHHHHHHhCCCCceeCCCC
Q psy16601         48 DVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHC   84 (177)
Q Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C   84 (177)
                      .|+....|+-.|... ++...+    .......|+.-
T Consensus        23 ~PV~s~~C~H~fek~-aI~~~i----~~~~~~~CPv~   54 (57)
T PF11789_consen   23 DPVKSKKCGHTFEKE-AILQYI----QRNGSKRCPVA   54 (57)
T ss_dssp             SEEEESSS--EEEHH-HHHHHC----TTTS-EE-SCC
T ss_pred             CCcCcCCCCCeecHH-HHHHHH----HhcCCCCCCCC
Confidence            456667788888754 555555    22233788873


No 255
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=28.65  E-value=10  Score=22.80  Aligned_cols=12  Identities=17%  Similarity=0.692  Sum_probs=8.6

Q ss_pred             ceecCCcccccc
Q psy16601        123 SFICPKCSNRYV  134 (177)
Q Consensus       123 ~~~C~~C~~~f~  134 (177)
                      ...|..|+-+|.
T Consensus        46 ~~~Cg~CGls~e   57 (104)
T COG4888          46 TAVCGNCGLSFE   57 (104)
T ss_pred             EEEcccCcceEE
Confidence            457888887774


No 256
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=28.61  E-value=20  Score=28.34  Aligned_cols=19  Identities=16%  Similarity=0.247  Sum_probs=14.5

Q ss_pred             CCCCCccccCccchhccCh
Q psy16601         44 PAGEDVFACPKCSKTYLRQ   62 (177)
Q Consensus        44 ~~~~~~~~C~~C~~~f~~~   62 (177)
                      ......|.|..|+..+...
T Consensus       420 ~~~~~~~~c~~c~~~yd~~  438 (479)
T PRK05452        420 ADLGPRMQCSVCQWIYDPA  438 (479)
T ss_pred             cCCCCeEEECCCCeEECCC
Confidence            3455679999999888764


No 257
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=28.49  E-value=81  Score=20.75  Aligned_cols=39  Identities=15%  Similarity=0.404  Sum_probs=20.4

Q ss_pred             CceecCCccccccC------hhHHHHHHHH-hhCC----------CCCccCCCCcc
Q psy16601        122 GSFICPKCSNRYVY------KHNLKQHLKF-ECGV----------EPQFKCPYCDK  160 (177)
Q Consensus       122 ~~~~C~~C~~~f~~------~~~l~~H~~~-h~~~----------~~~~~C~~C~~  160 (177)
                      .-.+|..|++.|=+      .+.+..|+.. .|.+          +..+.|..||-
T Consensus        13 ~vv~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~   68 (152)
T PF09416_consen   13 CVVKCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGS   68 (152)
T ss_dssp             CEEEETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT--
T ss_pred             cEeEcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCC
Confidence            44689889988843      5677888763 2221          23488988874


No 258
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=27.90  E-value=24  Score=22.82  Aligned_cols=34  Identities=21%  Similarity=0.588  Sum_probs=21.7

Q ss_pred             CceecCCccccccChhHHHHHHHHhhCCCCCccCCCCccccc
Q psy16601        122 GSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCK  163 (177)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~  163 (177)
                      -.|.|..|+..+..      +.+ +....+ |.|..|+-.+.
T Consensus       111 ~~y~C~~C~~~~~~------~rr-~~~~~~-y~C~~C~g~l~  144 (146)
T smart00731      111 YPYRCTGCGQRYLR------VRR-SNNVSR-YRCGKCGGKLI  144 (146)
T ss_pred             EEEECCCCCCCCce------Ecc-ccCcce-EEcCCCCCEEE
Confidence            47899989977642      211 212144 99999986653


No 259
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=27.65  E-value=53  Score=17.30  Aligned_cols=35  Identities=20%  Similarity=0.488  Sum_probs=18.5

Q ss_pred             CCCCccccCccchhccChHHHHHHHHHHhCCCCceeCCCCcc
Q psy16601         45 AGEDVFACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNK   86 (177)
Q Consensus        45 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~   86 (177)
                      ....+..|..|..-.....      ..-.... .|+|+.||.
T Consensus        18 ~~r~aLIC~~C~~hNGla~------~~~~~~i-~y~C~~Cg~   52 (54)
T PF10058_consen   18 SNRYALICSKCFSHNGLAP------KEEFEEI-QYRCPYCGA   52 (54)
T ss_pred             cCceeEECcccchhhcccc------cccCCce-EEEcCCCCC
Confidence            3344567888875433221      1111222 399999984


No 260
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=27.56  E-value=28  Score=17.00  Aligned_cols=11  Identities=27%  Similarity=0.984  Sum_probs=6.9

Q ss_pred             eeCCCCccccc
Q psy16601         79 FKCPHCNKKCH   89 (177)
Q Consensus        79 ~~C~~C~~~f~   89 (177)
                      +.|+.||..+.
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            56777776553


No 261
>PRK05978 hypothetical protein; Provisional
Probab=27.55  E-value=19  Score=23.49  Aligned_cols=10  Identities=20%  Similarity=0.893  Sum_probs=5.7

Q ss_pred             ecCCcccccc
Q psy16601        125 ICPKCSNRYV  134 (177)
Q Consensus       125 ~C~~C~~~f~  134 (177)
                      .|..|+..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            5666665554


No 262
>PLN03239 histone acetyltransferase; Provisional
Probab=27.31  E-value=45  Score=25.19  Aligned_cols=25  Identities=12%  Similarity=0.168  Sum_probs=22.0

Q ss_pred             CCceecCCccccccChhHHHHHHHH
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKF  145 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~  145 (177)
                      +.-|.|.+|.+-|.+...|.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            4579999999999999999999763


No 263
>KOG0782|consensus
Probab=27.04  E-value=15  Score=29.60  Aligned_cols=15  Identities=27%  Similarity=0.609  Sum_probs=10.6

Q ss_pred             ceecCCccccccChh
Q psy16601        123 SFICPKCSNRYVYKH  137 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~  137 (177)
                      ...|.+|...|..+-
T Consensus       276 AisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  276 AISCSWCKQAYHLKV  290 (1004)
T ss_pred             EEEehHHHHHhhcch
Confidence            357888887776654


No 264
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=26.97  E-value=86  Score=15.60  Aligned_cols=7  Identities=71%  Similarity=2.010  Sum_probs=3.5

Q ss_pred             eeCCCCc
Q psy16601         79 FKCPHCN   85 (177)
Q Consensus        79 ~~C~~C~   85 (177)
                      +.|+.||
T Consensus        19 ~~CP~Cg   25 (46)
T PF12760_consen   19 FVCPHCG   25 (46)
T ss_pred             CCCCCCC
Confidence            4455555


No 265
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=26.95  E-value=43  Score=26.26  Aligned_cols=25  Identities=24%  Similarity=0.465  Sum_probs=22.2

Q ss_pred             CCceecCCccccccChhHHHHHHHH
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKF  145 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~  145 (177)
                      ..-|.|.+|.+-|.....|.+|+..
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhc
Confidence            3468999999999999999999973


No 266
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=26.92  E-value=15  Score=27.64  Aligned_cols=42  Identities=21%  Similarity=0.409  Sum_probs=20.4

Q ss_pred             ceecCCccccccChhHHHH---HHH-HhhCCCCCccCCCCcccccc
Q psy16601        123 SFICPKCSNRYVYKHNLKQ---HLK-FECGVEPQFKCPYCDKRCKL  164 (177)
Q Consensus       123 ~~~C~~C~~~f~~~~~l~~---H~~-~h~~~~~~~~C~~C~~~f~~  164 (177)
                      .+.|..|.++.-.....-.   |-. .|...++-|+|..|++...+
T Consensus       252 av~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~Rt~s  297 (344)
T PF09332_consen  252 AVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNRTIS  297 (344)
T ss_dssp             EEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-EEEE
T ss_pred             EEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCeeee
Confidence            5789999877655544332   221 23345667999999987554


No 267
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=26.85  E-value=30  Score=26.02  Aligned_cols=21  Identities=14%  Similarity=0.336  Sum_probs=15.5

Q ss_pred             ccCCCCcccccchhHHHHHHh
Q psy16601        153 FKCPYCDKRCKLKGNLMSHIA  173 (177)
Q Consensus       153 ~~C~~C~~~f~~~~~l~~H~~  173 (177)
                      +.|..|++-|+....+..|+.
T Consensus       239 ~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         239 VYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             eeeHhhhhHhhhhHHHHHHHh
Confidence            677777777777777777764


No 268
>PTZ00064 histone acetyltransferase; Provisional
Probab=26.51  E-value=49  Score=26.38  Aligned_cols=25  Identities=20%  Similarity=0.537  Sum_probs=22.3

Q ss_pred             CCceecCCccccccChhHHHHHHHH
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKF  145 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~  145 (177)
                      +.-|.|.+|-+-|.....|.+|+..
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhc
Confidence            4568999999999999999999884


No 269
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=26.34  E-value=33  Score=19.07  Aligned_cols=15  Identities=13%  Similarity=0.219  Sum_probs=8.9

Q ss_pred             CCCceecCCccccccC
Q psy16601        120 LNGSFICPKCSNRYVY  135 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~~  135 (177)
                      +.+.-+| .||+..+-
T Consensus        17 ~~kTkkC-~CG~~l~v   31 (68)
T PF09082_consen   17 GAKTKKC-VCGKTLKV   31 (68)
T ss_dssp             T-SEEEE-TTTEEEE-
T ss_pred             CcceeEe-cCCCeeee
Confidence            3455678 88877653


No 270
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=26.30  E-value=19  Score=21.87  Aligned_cols=35  Identities=29%  Similarity=0.605  Sum_probs=17.2

Q ss_pred             CceecCCccccc--cChhHHHHHHHHhhCCCCC-ccCCCCc
Q psy16601        122 GSFICPKCSNRY--VYKHNLKQHLKFECGVEPQ-FKCPYCD  159 (177)
Q Consensus       122 ~~~~C~~C~~~f--~~~~~l~~H~~~h~~~~~~-~~C~~C~  159 (177)
                      +|-.|++|+..-  .+.+.+.-+...+   .+. |.|..|+
T Consensus         1 ~p~~CpYCg~~~~l~~~~~iYg~~~~~---~~~~y~C~~C~   38 (102)
T PF11672_consen    1 KPIICPYCGGPAELVDGSEIYGHRYDD---GPYLYVCTPCD   38 (102)
T ss_pred             CCcccCCCCCeeEEcccchhcCccCCC---CceeEECCCCC
Confidence            356788887432  2223333221111   232 7888886


No 271
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=25.93  E-value=30  Score=20.79  Aligned_cols=9  Identities=33%  Similarity=1.416  Sum_probs=4.3

Q ss_pred             eecCCcccc
Q psy16601        124 FICPKCSNR  132 (177)
Q Consensus       124 ~~C~~C~~~  132 (177)
                      +.|..|+..
T Consensus        17 ~~C~~C~~~   25 (104)
T TIGR01384        17 YVCPSCGYE   25 (104)
T ss_pred             EECcCCCCc
Confidence            445555443


No 272
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=25.86  E-value=32  Score=22.12  Aligned_cols=15  Identities=27%  Similarity=0.700  Sum_probs=12.1

Q ss_pred             CceeCCCCccccccc
Q psy16601         77 PKFKCPHCNKKCHQK   91 (177)
Q Consensus        77 ~~~~C~~C~~~f~~~   91 (177)
                      ++.+|++||..|.-.
T Consensus       111 ~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  111 KPQRCPECGQVFKLK  125 (136)
T ss_dssp             SEEEETTTEEEEEEE
T ss_pred             CccCCCCCCeEEEEE
Confidence            358999999988654


No 273
>PRK12722 transcriptional activator FlhC; Provisional
Probab=25.68  E-value=43  Score=22.88  Aligned_cols=28  Identities=18%  Similarity=0.460  Sum_probs=15.2

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCcc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNK   86 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~   86 (177)
                      ..|..|+..|.....        .. ...|.|+.|.-
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~-~~~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHAH--------DP-VGSFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeecccc--------cc-CCCCcCCCCCC
Confidence            357777776664321        11 12377777753


No 274
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=25.17  E-value=18  Score=22.01  Aligned_cols=11  Identities=27%  Similarity=0.857  Sum_probs=7.5

Q ss_pred             ccCCCCccccc
Q psy16601        153 FKCPYCDKRCK  163 (177)
Q Consensus       153 ~~C~~C~~~f~  163 (177)
                      |.|+.|++.++
T Consensus        21 ~~cpec~~ew~   31 (112)
T COG2824          21 LICPECAHEWN   31 (112)
T ss_pred             EeCchhccccc
Confidence            67777776665


No 275
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=25.00  E-value=54  Score=23.45  Aligned_cols=14  Identities=36%  Similarity=0.944  Sum_probs=9.4

Q ss_pred             CceecCCccccccC
Q psy16601        122 GSFICPKCSNRYVY  135 (177)
Q Consensus       122 ~~~~C~~C~~~f~~  135 (177)
                      .-|.|+.|+..|.-
T Consensus       154 aef~C~~C~h~F~G  167 (278)
T PF15135_consen  154 AEFHCPKCRHNFRG  167 (278)
T ss_pred             eeeecccccccchh
Confidence            45677777777754


No 276
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=24.99  E-value=51  Score=19.47  Aligned_cols=21  Identities=24%  Similarity=0.691  Sum_probs=15.4

Q ss_pred             CceeCCCCccccccchHHHhH
Q psy16601         77 PKFKCPHCNKKCHQKCNLKSH   97 (177)
Q Consensus        77 ~~~~C~~C~~~f~~~~~l~~H   97 (177)
                      +...|+.||..|-+...+..-
T Consensus        34 Pa~~C~~CGe~y~~dev~~eI   54 (89)
T TIGR03829        34 PSISCSHCGMEYQDDTTVKEI   54 (89)
T ss_pred             CcccccCCCcEeecHHHHHHH
Confidence            457899999998877655443


No 277
>PLN03239 histone acetyltransferase; Provisional
Probab=24.68  E-value=42  Score=25.32  Aligned_cols=24  Identities=17%  Similarity=0.254  Sum_probs=21.3

Q ss_pred             CCCccCCCCcccccchhHHHHHHh
Q psy16601        150 EPQFKCPYCDKRCKLKGNLMSHIA  173 (177)
Q Consensus       150 ~~~~~C~~C~~~f~~~~~l~~H~~  173 (177)
                      ...|.|..|-+-|.+...|.+|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            345999999999999999999985


No 278
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=24.63  E-value=34  Score=16.28  Aligned_cols=31  Identities=29%  Similarity=0.539  Sum_probs=19.6

Q ss_pred             eecCCccccccChhHHHHHHHHhhCCCCCccCCCCccccc
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCK  163 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~  163 (177)
                      +.|+.|++.|.....-         .+..=.|+.||-.+-
T Consensus         2 r~C~~Cg~~Yh~~~~p---------P~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen    2 RICPKCGRIYHIEFNP---------PKVEGVCDNCGGELV   32 (36)
T ss_dssp             EEETTTTEEEETTTB-----------SSTTBCTTTTEBEB
T ss_pred             cCcCCCCCccccccCC---------CCCCCccCCCCCeeE
Confidence            5788999888643322         244467888886543


No 279
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=24.31  E-value=25  Score=16.98  Aligned_cols=10  Identities=30%  Similarity=1.308  Sum_probs=6.5

Q ss_pred             eecCCccccc
Q psy16601        124 FICPKCSNRY  133 (177)
Q Consensus       124 ~~C~~C~~~f  133 (177)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6677776654


No 280
>KOG0562|consensus
Probab=23.86  E-value=44  Score=22.30  Aligned_cols=25  Identities=16%  Similarity=0.256  Sum_probs=16.1

Q ss_pred             CccCCCCcccccchhHHHHHHhhhc
Q psy16601        152 QFKCPYCDKRCKLKGNLMSHIALKH  176 (177)
Q Consensus       152 ~~~C~~C~~~f~~~~~l~~H~~~~h  176 (177)
                      ...|..|+..-..-..|+.|++.++
T Consensus       153 dLrC~~Cq~~~~~~~kLK~Hl~~~~  177 (184)
T KOG0562|consen  153 DLRCWRCQTFGPHFPKLKAHLREEY  177 (184)
T ss_pred             ceeehhhhhcccccHHHHHHHHHHH
Confidence            3778888733344477777877654


No 281
>PTZ00064 histone acetyltransferase; Provisional
Probab=23.56  E-value=47  Score=26.48  Aligned_cols=23  Identities=22%  Similarity=0.482  Sum_probs=21.1

Q ss_pred             CccCCCCcccccchhHHHHHHhh
Q psy16601        152 QFKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       152 ~~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                      .|.|..|-+-|.+...|.+|+..
T Consensus       280 LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        280 LHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             EEEccchhhhhCCHHHHHHHHhc
Confidence            59999999999999999999863


No 282
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=23.53  E-value=44  Score=23.53  Aligned_cols=16  Identities=25%  Similarity=0.505  Sum_probs=12.8

Q ss_pred             CCCccCCCCcccccch
Q psy16601        150 EPQFKCPYCDKRCKLK  165 (177)
Q Consensus       150 ~~~~~C~~C~~~f~~~  165 (177)
                      .++..|++||..|...
T Consensus       179 GkpqRCpECGqVFKLV  194 (268)
T PTZ00043        179 GFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCccCCCCCcEEEEE
Confidence            4569999999988753


No 283
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.45  E-value=70  Score=23.42  Aligned_cols=27  Identities=19%  Similarity=0.426  Sum_probs=17.9

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccc
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRC  162 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  162 (177)
                      +.+|.|+.|...|-.               .+-.|+.|+-.|
T Consensus       253 ~~GyvCs~Clsi~C~---------------~p~~C~~Cgt~f  279 (279)
T TIGR00627       253 SIGFVCSVCLSVLCQ---------------YTPICKTCKTAF  279 (279)
T ss_pred             cceEECCCccCCcCC---------------CCCCCCCCCCCC
Confidence            456888888766532               224788888665


No 284
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=23.44  E-value=43  Score=26.26  Aligned_cols=25  Identities=28%  Similarity=0.473  Sum_probs=22.0

Q ss_pred             CCCccCCCCcccccchhHHHHHHhh
Q psy16601        150 EPQFKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       150 ~~~~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                      ...|.|..|-+-|.+...|.+|+..
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhc
Confidence            3359999999999999999999863


No 285
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=23.43  E-value=29  Score=25.00  Aligned_cols=37  Identities=30%  Similarity=0.597  Sum_probs=25.0

Q ss_pred             CCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccch
Q psy16601        121 NGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLK  165 (177)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  165 (177)
                      +..-.|+.||........|  |     + --.|+|+.|--..+-+
T Consensus       218 e~~r~CP~Cg~~W~L~~pl--h-----~-iFdFKCD~CRLVSnls  254 (258)
T PF10071_consen  218 EQARKCPSCGGDWRLKEPL--H-----D-IFDFKCDPCRLVSNLS  254 (258)
T ss_pred             hhCCCCCCCCCccccCCch--h-----h-ceeccCCcceeecccc
Confidence            3345899999877666655  2     2 4459999998655433


No 286
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=23.41  E-value=27  Score=24.52  Aligned_cols=22  Identities=14%  Similarity=0.368  Sum_probs=0.0

Q ss_pred             CccCCCCcccccchhHHHHHHhh
Q psy16601        152 QFKCPYCDKRCKLKGNLMSHIAL  174 (177)
Q Consensus       152 ~~~C~~C~~~f~~~~~l~~H~~~  174 (177)
                      ...|++||....- +.|..|||+
T Consensus       168 ~~~cPitGe~IP~-~e~~eHmRi  189 (229)
T PF12230_consen  168 MIICPITGEMIPA-DEMDEHMRI  189 (229)
T ss_dssp             -----------------------
T ss_pred             ccccccccccccc-ccccccccc
Confidence            3667777766553 356666664


No 287
>PRK01343 zinc-binding protein; Provisional
Probab=22.81  E-value=52  Score=17.61  Aligned_cols=12  Identities=33%  Similarity=0.742  Sum_probs=6.9

Q ss_pred             CccCCCCccccc
Q psy16601        152 QFKCPYCDKRCK  163 (177)
Q Consensus       152 ~~~C~~C~~~f~  163 (177)
                      ...|++|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            355666666543


No 288
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=22.72  E-value=39  Score=17.69  Aligned_cols=11  Identities=27%  Similarity=0.857  Sum_probs=7.4

Q ss_pred             eCCCCcccccc
Q psy16601         80 KCPHCNKKCHQ   90 (177)
Q Consensus        80 ~C~~C~~~f~~   90 (177)
                      .|+.||..+.-
T Consensus         2 ~CPyCge~~~~   12 (52)
T PF14255_consen    2 QCPYCGEPIEI   12 (52)
T ss_pred             CCCCCCCeeEE
Confidence            58888876543


No 289
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=22.57  E-value=56  Score=15.18  Aligned_cols=14  Identities=14%  Similarity=0.503  Sum_probs=9.7

Q ss_pred             CCceecCCcccccc
Q psy16601        121 NGSFICPKCSNRYV  134 (177)
Q Consensus       121 ~~~~~C~~C~~~f~  134 (177)
                      +..+.|..|+..|.
T Consensus        19 ~~~~~C~~Cg~~~~   32 (33)
T PF08792_consen   19 DDYEVCIFCGSSFP   32 (33)
T ss_pred             CCeEEcccCCcEee
Confidence            34567888887764


No 290
>PRK12860 transcriptional activator FlhC; Provisional
Probab=22.54  E-value=53  Score=22.48  Aligned_cols=12  Identities=17%  Similarity=0.717  Sum_probs=7.6

Q ss_pred             cccCccchhccC
Q psy16601         50 FACPKCSKTYLR   61 (177)
Q Consensus        50 ~~C~~C~~~f~~   61 (177)
                      ..|..|+..|..
T Consensus       135 ~~C~~Cgg~fv~  146 (189)
T PRK12860        135 ARCCRCGGKFVT  146 (189)
T ss_pred             ccCCCCCCCeec
Confidence            457777766663


No 291
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=22.29  E-value=75  Score=21.83  Aligned_cols=35  Identities=23%  Similarity=0.669  Sum_probs=19.9

Q ss_pred             cccCccchhccChHHHHHHHHHH-hCCCCceeCCCCcccccc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYE-CGKRPKFKCPHCNKKCHQ   90 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h-~~~~~~~~C~~C~~~f~~   90 (177)
                      +.|+.|+..  .  .  .|-... .+....+.|..||..+..
T Consensus         7 ~~Cp~Cg~e--e--v--~hEVik~~g~~~lvrC~eCG~V~~~   42 (201)
T COG1326           7 IECPSCGSE--E--V--SHEVIKERGREPLVRCEECGTVHPA   42 (201)
T ss_pred             EECCCCCcc--h--h--hHHHHHhcCCceEEEccCCCcEeec
Confidence            579999921  1  1  122122 233355899999987633


No 292
>PLN02748 tRNA dimethylallyltransferase
Probab=22.10  E-value=59  Score=25.78  Aligned_cols=22  Identities=14%  Similarity=0.422  Sum_probs=18.7

Q ss_pred             ceeCCCCcc-ccccchHHHhHHH
Q psy16601         78 KFKCPHCNK-KCHQKCNLKSHIA   99 (177)
Q Consensus        78 ~~~C~~C~~-~f~~~~~l~~H~~   99 (177)
                      .|.|..|++ .+.....|..|+.
T Consensus       418 ~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        418 QYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             cccccCCCCcccCCHHHHHHHhc
Confidence            488999997 7889999999974


No 293
>KOG1940|consensus
Probab=22.06  E-value=97  Score=22.67  Aligned_cols=58  Identities=16%  Similarity=0.312  Sum_probs=31.1

Q ss_pred             eeCCCCccccccchHHHhHHHHhcCCCCCCCCccccccccCCCCceecCCccccccChhHHHHHH
Q psy16601         79 FKCPHCNKKCHQKCNLKSHIALKHDQLLAPLAPRSYRRNSQLNGSFICPKCSNRYVYKHNLKQHL  143 (177)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  143 (177)
                      |.|++|.+ ....+.+-++....-...+.+.-..      ..+....|..|+.....+.....|+
T Consensus       197 y~CP~C~~-~~d~~~~~~~~d~~l~~~~~p~~y~------~~~~~i~cndC~~~~~~k~~~l~~k  254 (276)
T KOG1940|consen  197 YTCPICSK-PGDMSHYFRKLDKELAGSPMPEEYK------NKTQDILCNDCGSGTNVKYHILYHK  254 (276)
T ss_pred             CCCCcccc-hHHHHHHHHHHHHHHhcCCCCchhh------chhheeeccCCCCCCccceehhhhh
Confidence            88899888 5555555555544443322221111      1122357888887766555554443


No 294
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=21.99  E-value=48  Score=19.83  Aligned_cols=40  Identities=20%  Similarity=0.203  Sum_probs=16.5

Q ss_pred             CCCceecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccccch
Q psy16601        120 LNGSFICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRCKLK  165 (177)
Q Consensus       120 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  165 (177)
                      +.+.-.|..|+..+.....      .-.+++--|-|+.|.+.|.+-
T Consensus        11 g~ke~~CalCG~tWg~~y~------Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   11 GTKEMGCALCGATWGDYYE------EVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             -SGGGS-SS---S---SS-------B-TT--BSSS--SSSS-TTS-
T ss_pred             ccccccccccCCcHHHHHH------hhcCCEEEEEcHHHHHHHHHH
Confidence            4566789999988764321      123445557889999888754


No 295
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=21.78  E-value=40  Score=21.96  Aligned_cols=13  Identities=23%  Similarity=0.437  Sum_probs=8.0

Q ss_pred             ccCCCCcccccch
Q psy16601        153 FKCPYCDKRCKLK  165 (177)
Q Consensus       153 ~~C~~C~~~f~~~  165 (177)
                      -.|..|++.|++.
T Consensus        29 ReC~~C~~RFTTy   41 (147)
T TIGR00244        29 RECLECHERFTTF   41 (147)
T ss_pred             ccCCccCCcccee
Confidence            5566666666654


No 296
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=21.23  E-value=93  Score=15.17  Aligned_cols=13  Identities=31%  Similarity=0.999  Sum_probs=7.2

Q ss_pred             CCceecCCccccc
Q psy16601        121 NGSFICPKCSNRY  133 (177)
Q Consensus       121 ~~~~~C~~C~~~f  133 (177)
                      .+.+.|..||...
T Consensus        17 ~g~~vC~~CG~Vl   29 (43)
T PF08271_consen   17 RGELVCPNCGLVL   29 (43)
T ss_dssp             TTEEEETTT-BBE
T ss_pred             CCeEECCCCCCEe
Confidence            3456777776544


No 297
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=21.06  E-value=39  Score=17.11  Aligned_cols=13  Identities=23%  Similarity=0.626  Sum_probs=8.9

Q ss_pred             CccCCCCcccccc
Q psy16601        152 QFKCPYCDKRCKL  164 (177)
Q Consensus       152 ~~~C~~C~~~f~~  164 (177)
                      .|.|+.|++.+.-
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            3778888876543


No 298
>KOG2747|consensus
Probab=20.95  E-value=51  Score=25.37  Aligned_cols=21  Identities=33%  Similarity=0.713  Sum_probs=0.0

Q ss_pred             eecCCccccccChhHHHHHHH
Q psy16601        124 FICPKCSNRYVYKHNLKQHLK  144 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~  144 (177)
                      |.|.+|.+-+.++..|.+|+.
T Consensus       159 YiCEfCLkY~~s~~~l~rH~~  179 (396)
T KOG2747|consen  159 YICEFCLKYMKSRTSLQRHLK  179 (396)
T ss_pred             EEehHHHhHhchHHHHHHHHH


No 299
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=20.70  E-value=58  Score=23.97  Aligned_cols=26  Identities=31%  Similarity=0.714  Sum_probs=18.0

Q ss_pred             cccCccchhccChHHHHHHHHHHhCCCCceeCCCCccccccc
Q psy16601         50 FACPKCSKTYLRQYTLNAHLRYECGKRPKFKCPHCNKKCHQK   91 (177)
Q Consensus        50 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~   91 (177)
                      -.|+.||.                ...+.|.|+.||..+...
T Consensus       310 ~~C~~cg~----------------~~~r~~~C~~cg~~~~rD  335 (364)
T COG0675         310 KTCPCCGH----------------LSGRLFKCPRCGFVHDRD  335 (364)
T ss_pred             ccccccCC----------------ccceeEECCCCCCeehhh
Confidence            36999998                112339999999875544


No 300
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=20.68  E-value=30  Score=18.25  Aligned_cols=12  Identities=25%  Similarity=0.769  Sum_probs=8.7

Q ss_pred             CCCccCCCCccc
Q psy16601        150 EPQFKCPYCDKR  161 (177)
Q Consensus       150 ~~~~~C~~C~~~  161 (177)
                      .-|+.|+.|.+.
T Consensus        26 NfPlyCpKCK~E   37 (55)
T PF14205_consen   26 NFPLYCPKCKQE   37 (55)
T ss_pred             cccccCCCCCce
Confidence            556888888754


No 301
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=20.35  E-value=56  Score=14.58  Aligned_cols=9  Identities=33%  Similarity=1.103  Sum_probs=4.7

Q ss_pred             ccCCCCccc
Q psy16601        153 FKCPYCDKR  161 (177)
Q Consensus       153 ~~C~~C~~~  161 (177)
                      |.|.+|++.
T Consensus         1 ~~C~~C~~~    9 (30)
T PF03107_consen    1 FWCDVCRRK    9 (30)
T ss_pred             CCCCCCCCC
Confidence            355666544


No 302
>PF12773 DZR:  Double zinc ribbon
Probab=20.27  E-value=43  Score=16.84  Aligned_cols=27  Identities=22%  Similarity=0.559  Sum_probs=16.4

Q ss_pred             eecCCccccccChhHHHHHHHHhhCCCCCccCCCCcccc
Q psy16601        124 FICPKCSNRYVYKHNLKQHLKFECGVEPQFKCPYCDKRC  162 (177)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  162 (177)
                      --|+.|+....            ........|+.|+...
T Consensus        13 ~fC~~CG~~l~------------~~~~~~~~C~~Cg~~~   39 (50)
T PF12773_consen   13 KFCPHCGTPLP------------PPDQSKKICPNCGAEN   39 (50)
T ss_pred             cCChhhcCChh------------hccCCCCCCcCCcCCC
Confidence            46777776655            1123347788888753


No 303
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=20.23  E-value=44  Score=20.22  Aligned_cols=14  Identities=14%  Similarity=0.598  Sum_probs=11.2

Q ss_pred             ccccCccchhccCh
Q psy16601         49 VFACPKCSKTYLRQ   62 (177)
Q Consensus        49 ~~~C~~C~~~f~~~   62 (177)
                      +++|.-||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            46788899888874


No 304
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=20.03  E-value=52  Score=18.05  Aligned_cols=17  Identities=35%  Similarity=1.015  Sum_probs=13.7

Q ss_pred             CCCCceecCCccccccC
Q psy16601        119 QLNGSFICPKCSNRYVY  135 (177)
Q Consensus       119 ~~~~~~~C~~C~~~f~~  135 (177)
                      ..++...|+.|++.|.-
T Consensus        49 i~eg~L~Cp~c~r~YPI   65 (68)
T PF03966_consen   49 IVEGELICPECGREYPI   65 (68)
T ss_dssp             TTTTEEEETTTTEEEEE
T ss_pred             ccCCEEEcCCCCCEEeC
Confidence            35678999999999864


No 305
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=20.03  E-value=43  Score=14.05  Aligned_cols=6  Identities=50%  Similarity=1.630  Sum_probs=3.6

Q ss_pred             CCCCcc
Q psy16601        155 CPYCDK  160 (177)
Q Consensus       155 C~~C~~  160 (177)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            666664


Done!