Query         psy16618
Match_columns 51
No_of_seqs    58 out of 60
Neff          4.0 
Searched_HMMs 46136
Date          Fri Aug 16 17:30:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16618.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16618hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04042 C2A_MCTP_PRT C2 domain  98.2 1.9E-06 4.1E-11   50.9   4.2   43    1-44     79-121 (121)
  2 cd08400 C2_Ras_p21A1 C2 domain  95.6    0.03 6.6E-07   33.6   4.4   44    1-44     80-124 (126)
  3 cd08373 C2A_Ferlin C2 domain f  95.2   0.067 1.5E-06   31.6   4.9   46    1-47     75-120 (127)
  4 cd08376 C2B_MCTP_PRT C2 domain  95.0   0.044 9.6E-07   31.6   3.5   37    1-43     79-115 (116)
  5 cd04036 C2_cPLA2 C2 domain pre  94.2    0.11 2.4E-06   30.3   4.0   37    1-42     81-117 (119)
  6 cd04022 C2A_MCTP_PRT_plant C2   93.7    0.14   3E-06   30.3   3.8   43    1-43     83-126 (127)
  7 cd08682 C2_Rab11-FIP_classI C2  93.0    0.13 2.9E-06   30.4   3.0   40    1-40     83-125 (126)
  8 cd08401 C2A_RasA2_RasA3 C2 dom  92.4    0.22 4.8E-06   29.7   3.4   42    1-42     80-121 (121)
  9 cd08690 C2_Freud-1 C2 domain f  92.4    0.36 7.9E-06   31.1   4.5   41    1-43     97-137 (155)
 10 cd08379 C2D_MCTP_PRT_plant C2   91.7    0.29 6.2E-06   30.2   3.4   38    1-38     87-125 (126)
 11 cd08678 C2_C21orf25-like C2 do  91.4    0.57 1.2E-05   27.7   4.3   46    1-46     77-123 (126)
 12 cd08681 C2_fungal_Inn1p-like C  91.4    0.18   4E-06   29.1   2.1   38    1-41     80-117 (118)
 13 cd04040 C2D_Tricalbin-like C2   91.2     0.3 6.6E-06   28.0   3.0   36    1-38     79-114 (115)
 14 cd04015 C2_plant_PLD C2 domain  90.8    0.53 1.2E-05   29.6   4.0   41    1-41    115-156 (158)
 15 cd04044 C2A_Tricalbin-like C2   90.7    0.22 4.8E-06   28.6   2.1   41    1-44     83-124 (124)
 16 cd00275 C2_PLC_like C2 domain   90.2    0.78 1.7E-05   26.5   4.1   39    1-42     89-127 (128)
 17 cd04033 C2_NEDD4_NEDD4L C2 dom  90.0    0.39 8.5E-06   28.2   2.7   42    1-42     85-132 (133)
 18 PF06775 Seipin:  Putative adip  89.3     1.8 3.8E-05   28.4   5.7   46    3-48     41-91  (199)
 19 cd04016 C2_Tollip C2 domain pr  88.3    0.86 1.9E-05   27.9   3.5   40    1-41     80-120 (121)
 20 cd08377 C2C_MCTP_PRT C2 domain  87.4     1.2 2.7E-05   25.5   3.6   40    1-42     79-118 (119)
 21 cd04046 C2_Calpain C2 domain p  87.3     2.3   5E-05   25.2   4.9   42    1-44     80-123 (126)
 22 cd04019 C2C_MCTP_PRT_plant C2   87.1       1 2.2E-05   28.2   3.4   45    1-45     80-134 (150)
 23 cd08383 C2A_RasGAP C2 domain (  85.8     3.1 6.7E-05   23.6   4.7   38    4-41     79-116 (117)
 24 cd08378 C2B_MCTP_PRT_plant C2   83.2     1.9 4.1E-05   25.7   3.1   39    1-40     74-117 (121)
 25 cd08375 C2_Intersectin C2 doma  82.5     1.4 2.9E-05   27.0   2.3   37    1-42     94-135 (136)
 26 cd08390 C2A_Synaptotagmin-15-1  82.4     1.4 2.9E-05   25.5   2.2   25    1-25     99-123 (123)
 27 cd04043 C2_Munc13_fungal C2 do  82.1     2.7   6E-05   24.4   3.5   36    1-43     83-121 (126)
 28 cd04054 C2A_Rasal1_RasA4 C2 do  81.2     1.5 3.3E-05   25.8   2.2   41    1-41     79-120 (121)
 29 cd04028 C2B_RIM1alpha C2 domai  80.6     2.1 4.5E-05   27.2   2.8   30    1-30    114-143 (146)
 30 cd04051 C2_SRC2_like C2 domain  79.3     1.9 4.1E-05   25.1   2.2   35    1-37     85-124 (125)
 31 cd08382 C2_Smurf-like C2 domai  79.0     2.6 5.7E-05   24.9   2.7   39    1-39     80-121 (123)
 32 PLN03008 Phospholipase D delta  78.4     4.5 9.9E-05   33.1   4.6   47    1-47    134-181 (868)
 33 cd08391 C2A_C2C_Synaptotagmin_  77.9     3.1 6.7E-05   23.7   2.7   26    1-26     85-110 (121)
 34 cd04024 C2A_Synaptotagmin-like  77.1     4.8  0.0001   23.1   3.4   41    1-41     82-127 (128)
 35 cd04014 C2_PKC_epsilon C2 doma  76.1     4.5 9.8E-05   23.9   3.2   36    1-43     92-129 (132)
 36 cd04035 C2A_Rabphilin_Doc2 C2   74.7     2.3   5E-05   24.7   1.6   23    1-23    101-123 (123)
 37 cd04052 C2B_Tricalbin-like C2   74.3     3.8 8.3E-05   23.7   2.5   39    1-44     71-110 (111)
 38 cd04010 C2B_RasA3 C2 domain se  73.8     5.1 0.00011   25.2   3.1   30    1-30     97-127 (148)
 39 cd08388 C2A_Synaptotagmin-4-11  68.2     6.4 0.00014   23.6   2.6   23    1-23    102-126 (128)
 40 cd08395 C2C_Munc13 C2 domain t  66.6     6.4 0.00014   24.0   2.4   28    1-28     88-115 (120)
 41 cd04011 C2B_Ferlin C2 domain s  65.3     7.9 0.00017   22.2   2.5   26    1-26     83-111 (111)
 42 PHA00098 hypothetical protein   62.4      10 0.00022   24.3   2.7   33   13-51     72-104 (112)
 43 cd08389 C2A_Synaptotagmin-14_1  62.0     6.9 0.00015   23.3   1.9   24    1-24    100-123 (124)
 44 cd04017 C2D_Ferlin C2 domain f  59.0      24 0.00052   21.0   3.9   14   31-44    120-133 (135)
 45 cd04025 C2B_RasA1_RasA4 C2 dom  58.8      19 0.00041   20.8   3.3   40    1-40     79-122 (123)
 46 cd05880 Ig_EVA1 Immunoglobulin  54.3      31 0.00068   20.2   3.8   38    3-40     78-115 (115)
 47 cd05715 Ig_P0-like Immunoglobu  54.2      35 0.00077   19.7   4.0   36    4-39     80-115 (116)
 48 cd04030 C2C_KIAA1228 C2 domain  49.6      12 0.00026   21.6   1.5   22    1-22    104-125 (127)
 49 PF10358 NT-C2:  N-terminal C2   48.8      54  0.0012   19.4   4.3   41    1-44     94-136 (143)
 50 cd04029 C2A_SLP-4_5 C2 domain   48.2      13 0.00029   22.1   1.5   23    1-23    102-124 (125)
 51 cd08385 C2A_Synaptotagmin-1-5-  46.9      17 0.00037   21.0   1.8   23    1-23    100-122 (124)
 52 cd08387 C2A_Synaptotagmin-8 C2  45.5      19 0.00041   20.9   1.8   23    1-23    100-122 (124)
 53 PF11456 DUF3019:  Protein of u  44.5      47   0.001   20.1   3.5   37   10-47     56-93  (102)
 54 PF14924 DUF4497:  Protein of u  43.2      39 0.00085   20.2   3.1   26   16-43     79-104 (112)
 55 cd04013 C2_SynGAP_like C2 doma  42.5      63  0.0014   20.5   4.1   43    1-43     89-139 (146)
 56 cd08386 C2A_Synaptotagmin-7 C2  41.6      23 0.00051   20.3   1.9   23    1-23    101-123 (125)
 57 cd04021 C2_E3_ubiquitin_ligase  41.2      37  0.0008   20.0   2.7   13    1-13     79-91  (125)
 58 cd08393 C2A_SLP-1_2 C2 domain   39.4      22 0.00047   21.1   1.5   18    1-18    102-119 (125)
 59 PF01138 RNase_PH:  3' exoribon  38.4      82  0.0018   18.3   5.1   42    2-45     17-60  (132)
 60 cd08392 C2A_SLP-3 C2 domain fi  38.2      15 0.00032   22.2   0.7   18    1-18    102-119 (128)
 61 cd08675 C2B_RasGAP C2 domain s  37.1      31 0.00067   20.9   2.0   31    1-31     96-126 (137)
 62 PF09922 DUF2154:  Cell wall-ac  36.7      41  0.0009   20.0   2.4   13    1-13     24-36  (115)
 63 cd08367 P53 P53 DNA-binding do  35.5      74  0.0016   21.2   3.7   26   15-42    139-164 (179)
 64 cd04047 C2B_Copine C2 domain s  34.0      19 0.00041   20.3   0.6   21    1-21     88-108 (110)
 65 cd04048 C2A_Copine C2 domain f  33.8      24 0.00052   20.4   1.0   23    1-23     90-112 (120)
 66 cd05877 Ig_LP_like Immunoglobu  32.3      95  0.0021   17.2   3.9    7   20-26     69-75  (106)
 67 cd08521 C2A_SLP C2 domain firs  32.0      34 0.00074   19.5   1.5   16    1-16    101-116 (123)
 68 cd08381 C2B_PI3K_class_II C2 d  31.5      33 0.00071   20.3   1.4   21    1-21     99-119 (122)
 69 PF07865 DUF1652:  Protein of u  30.7      71  0.0015   18.4   2.7   24   13-41     21-44  (69)
 70 COG2123 RNase PH-related exori  30.6 1.5E+02  0.0033   21.4   4.8   42    2-45     48-89  (272)
 71 cd04027 C2B_Munc13 C2 domain s  29.5      66  0.0014   18.9   2.5   37    1-39     90-126 (127)
 72 PF10743 Phage_Cox:  Regulatory  28.6      61  0.0013   19.8   2.2   20   21-41     41-60  (87)
 73 cd04050 C2B_Synaptotagmin-like  25.9      66  0.0014   18.1   2.0   26    1-26     76-103 (105)
 74 PF00870 P53:  P53 DNA-binding   24.7 1.1E+02  0.0023   20.6   3.1   27   15-43    156-182 (196)
 75 PF15627 CEP76-C2:  CEP76 C2 do  23.5 1.4E+02   0.003   19.6   3.4   29   18-46    124-153 (156)
 76 PLN03008 Phospholipase D delta  22.6      42 0.00091   27.7   0.9   29    1-29    731-759 (868)
 77 PF12599 DUF3768:  Protein of u  21.0      69  0.0015   19.3   1.4   14   25-39     32-45  (84)
 78 cd04026 C2_PKC_alpha_gamma C2   20.6      55  0.0012   19.0   1.0   27    1-28     98-124 (131)

No 1  
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protein
Probab=98.25  E-value=1.9e-06  Score=50.90  Aligned_cols=43  Identities=49%  Similarity=0.714  Sum_probs=40.6

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEEEc
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYN   44 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~p   44 (51)
                      ||.|.++|+++..++..+..+.|.|+++ +..+|+|.+.++++|
T Consensus        79 iG~~~~~l~~l~~~~~~~~~~~L~~~~~-~~~~G~l~l~~~~~~  121 (121)
T cd04042          79 MGSAFVDLSTLELNKPTEVKLKLEDPNS-DEDLGYISLVVTLTP  121 (121)
T ss_pred             eEEEEEEHHHcCCCCCeEEEEECCCCCC-ccCceEEEEEEEECC
Confidence            7999999999999999999999999887 678999999999987


No 2  
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1). RasA1 is a GAP1 (GTPase activating protein 1), a Ras-specific GAP member, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  RasA1 contains a C2 domain,  a Ras-GAP domain, a pleckstrin homology (PH)-like domain, a SH3 domain, and 2 SH2 domains. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficki
Probab=95.65  E-value=0.03  Score=33.58  Aligned_cols=44  Identities=14%  Similarity=0.181  Sum_probs=38.1

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCC-CCCCcceEEEEEEEEc
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNK-PEENLEYVGYNVEKYN   44 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~-~e~dlG~I~l~vtL~p   44 (51)
                      +|.+.+.|+++..+...+.-..|+.++. +..+.|+|.|.++..+
T Consensus        80 iG~v~i~l~~l~~~~~~~~W~~L~~~~~~~~~~~G~i~l~l~~~~  124 (126)
T cd08400          80 IAEVTVQLSKLQNGQETDEWYPLSSASPLKGGEWGSLRIRARYSH  124 (126)
T ss_pred             EEEEEEEHhHccCCCcccEeEEcccCCCCCCCcCcEEEEEEEEEc
Confidence            5899999999999999999999987653 5789999999998764


No 3  
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=95.24  E-value=0.067  Score=31.59  Aligned_cols=46  Identities=20%  Similarity=0.194  Sum_probs=38.6

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEEEccch
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYNAEQ   47 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~pk~~   47 (51)
                      +|.+.++|+++.-+...+..+.|.|++.. ..-|+|.+.++..|-++
T Consensus        75 iG~~~~~l~~l~~~~~~~~~~~L~~~~~~-~~~~~l~l~~~~~~~~~  120 (127)
T cd08373          75 IGSATVSLQDLVSEGLLEVTEPLLDSNGR-PTGATISLEVSYQPPDG  120 (127)
T ss_pred             EEEEEEEhhHcccCCceEEEEeCcCCCCC-cccEEEEEEEEEeCCCC
Confidence            59999999999988899999999988763 33589999999887654


No 4  
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protei
Probab=94.97  E-value=0.044  Score=31.64  Aligned_cols=37  Identities=27%  Similarity=0.259  Sum_probs=32.0

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKY   43 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~   43 (51)
                      ||.+.++|+++..+...++.+.|+++      -|.|.+-++++
T Consensus        79 iG~~~~~l~~l~~~~~~~~w~~L~~~------~G~~~~~~~~~  115 (116)
T cd08376          79 IGRCEIDLSALPREQTHSLELELEDG------EGSLLLLLTLT  115 (116)
T ss_pred             EEEEEEeHHHCCCCCceEEEEEccCC------CcEEEEEEEec
Confidence            79999999999999999999999865      39998887764


No 5  
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2). A single copy of the C2 domain is present in cPLA2 which releases arachidonic acid from membranes initiating the biosynthesis of potent inflammatory mediators such as prostaglandins, leukotrienes, and platelet-activating factor.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants o
Probab=94.22  E-value=0.11  Score=30.32  Aligned_cols=37  Identities=19%  Similarity=0.317  Sum_probs=31.6

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEK   42 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL   42 (51)
                      ||.+.++|+++..+...+..+.|++.     .-|++.+.+.|
T Consensus        81 iG~~~~~l~~l~~g~~~~~~~~L~~~-----~~g~l~~~~~~  117 (119)
T cd04036          81 LGTVLFDVSKLKLGEKVRVTFSLNPQ-----GKEELEVEFLL  117 (119)
T ss_pred             cEEEEEEHHHCCCCCcEEEEEECCCC-----CCceEEEEEEe
Confidence            69999999999999999999999754     46888888776


No 6  
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates
Probab=93.66  E-value=0.14  Score=30.30  Aligned_cols=43  Identities=16%  Similarity=0.057  Sum_probs=34.3

Q ss_pred             CcceEEEcCcee-ccceEEEEEEecCCCCCCCCcceEEEEEEEE
Q psy16618          1 MGSASIDLTTLE-LGRCTDLILTLEDPNKPEENLEYVGYNVEKY   43 (51)
Q Consensus         1 MGSA~l~Lt~LE-l~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~   43 (51)
                      ||.+.+.|+++. -+.....-+.|+.+...+..-|+|.|.+.++
T Consensus        83 lG~v~i~l~~l~~~~~~~~~w~~L~~~~~~~~~~G~l~l~~~~~  126 (127)
T cd04022          83 LGRVRISGTSFVPPSEAVVQRYPLEKRGLFSRVRGEIGLKVYIT  126 (127)
T ss_pred             eeEEEEcHHHcCCCCCccceEeEeeeCCCCCCccEEEEEEEEEc
Confidence            689999999987 4667777888887765556789999988775


No 7  
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I. Rab GTPases recruit various effector proteins to organelles and vesicles.  Rab11-family interacting proteins (FIPs) are involved in mediating the role of Rab11. FIPs can be divided into three classes: class I FIPs (Rip11a, Rip11b, RCP, and FIP2) which contain a C2 domain after N-terminus of the protein, class II FIPs (FIP3 and FIP4) which contain two EF-hands and a proline rich region, and class III FIPs (FIP1) which exhibits no homology to known protein domains. All FIP proteins contain a highly conserved, 20-amino acid motif at the C-terminus of the protein, known as Rab11/25 binding domain (RBD).  Class I FIPs are thought to bind to endocytic membranes via their C2 domain, which interacts directly with phospholipids. Class II FIPs do not have any membrane binding domains leaving much to speculate about the mechanism involving FIP3 and FIP4 interactions with endocytic membranes. The member
Probab=93.05  E-value=0.13  Score=30.37  Aligned_cols=40  Identities=23%  Similarity=0.349  Sum_probs=31.2

Q ss_pred             CcceEEEcCcee--ccceEEEEEEecCCCC-CCCCcceEEEEE
Q psy16618          1 MGSASIDLTTLE--LGRCTDLILTLEDPNK-PEENLEYVGYNV   40 (51)
Q Consensus         1 MGSA~l~Lt~LE--l~r~~e~~L~L~Dp~~-~e~dlG~I~l~v   40 (51)
                      ||.|.|.|+++.  -+...+.-+.|++.+. +...-|+|.|.+
T Consensus        83 iG~~~i~l~~l~~~~~~~~~~W~~L~~~~~~~~~~~Gei~l~~  125 (126)
T cd08682          83 LGQVSIPLNDLDEDKGRRRTRWFKLESKPGKDDKERGEIEVDI  125 (126)
T ss_pred             eEEEEEEHHHhhccCCCcccEEEECcCCCCCCccccceEEEEe
Confidence            799999999987  5667778888886554 345789998876


No 8  
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3. RasA2 and RasA3 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation.  RasA2 and RasA3 are both inositol 1,3,4,5-tetrakisphosphate-binding proteins and contain an N-terminal C2 domain, a Ras-GAP domain, a pleckstrin-homology (PH) domain which localizes it to the plasma membrane, and Bruton's Tyrosine Kinase (BTK) a zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular p
Probab=92.39  E-value=0.22  Score=29.75  Aligned_cols=42  Identities=17%  Similarity=0.124  Sum_probs=33.1

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEK   42 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL   42 (51)
                      ||.+.+.|+++..+...+.-+.|+-+......-|+|.+.+.+
T Consensus        80 iG~~~i~l~~l~~~~~~~~w~~L~~~~~~~~~~G~i~l~~~~  121 (121)
T cd08401          80 IGKVAIKKEDLHKYYGKDTWFPLQPVDADSEVQGKVHLELRL  121 (121)
T ss_pred             EEEEEEEHHHccCCCCcEeeEEEEccCCCCcccEEEEEEEEC
Confidence            688999999999888888888887544444678999888764


No 9  
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1). Freud-1 is a novel calcium-regulated repressor that negatively regulates basal 5-HT1A receptor expression in neurons.  It may also play a role in the altered regulation of 5-HT1A receptors associated with anxiety or major depression. Freud-1 contains two DM-14 basic repeats, a helix-loop-helix DNA binding domain, and a C2 domain. The Freud-1 C2 domain is thought to be calcium insensitive and it lacks several acidic residues that mediate calcium binding of the PKC C2 domain. In addition, it contains a poly-basic insert that is not present in calcium-dependent C2 domains and may function as a nuclear localization signal. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules tha
Probab=92.38  E-value=0.36  Score=31.10  Aligned_cols=41  Identities=22%  Similarity=0.169  Sum_probs=34.6

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKY   43 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~   43 (51)
                      ||.|.++|+.|+.+......+.|.|...  .==|.+.+.|.+-
T Consensus        97 iG~~~i~L~~l~~~~~~~~~~~L~~~~k--~~Gg~l~v~ir~r  137 (155)
T cd08690          97 LGTAQVKLEPLETKCEIHESVDLMDGRK--ATGGKLEVKVRLR  137 (155)
T ss_pred             eEEEEEEcccccccCcceEEEEhhhCCC--CcCCEEEEEEEec
Confidence            8999999999999988888999998776  5558888887764


No 10 
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphate
Probab=91.71  E-value=0.29  Score=30.24  Aligned_cols=38  Identities=24%  Similarity=0.221  Sum_probs=31.9

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCC-CCCCCcceEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPN-KPEENLEYVGY   38 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~-~~e~dlG~I~l   38 (51)
                      ||.+.++|+++.-+...+..+.|.+++ ++...+|.|..
T Consensus        87 lG~~~i~l~~l~~~~~~~~~~~L~~~~~~~~~~~g~l~~  125 (126)
T cd08379          87 IGKVRIRLSTLEDDRVYAHSYPLLSLNPSGVKKMGELEC  125 (126)
T ss_pred             EEEEEEEHHHccCCCEEeeEEEeEeCCCCCccCCcEEEe
Confidence            689999999999999999999999876 34568888754


No 11 
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein. The members in this cd are named after the Human C21orf25 which contains a single C2 domain.  Several other members contain a C1 domain downstream of the C2 domain.  No other information on this protein is currently known. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a 
Probab=91.36  E-value=0.57  Score=27.70  Aligned_cols=46  Identities=11%  Similarity=0.084  Sum_probs=37.0

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCC-CCCcceEEEEEEEEccc
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKP-EENLEYVGYNVEKYNAE   46 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~-e~dlG~I~l~vtL~pk~   46 (51)
                      ||.+.+.|.++.-+...+..+.|...... ....|+|.+.+...+..
T Consensus        77 lG~~~i~l~~l~~~~~~~~~~~L~~~~~~~~~~~G~l~l~~~~~~~~  123 (126)
T cd08678          77 LGLAIVPFDELRKNPSGRQIFPLQGRPYEGDSVSGSITVEFLFMEPA  123 (126)
T ss_pred             EEEEEEeHHHhccCCceeEEEEecCCCCCCCCcceEEEEEEEEeccc
Confidence            69999999999988888888999865432 46799999999887643


No 12 
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins. Saccharomyces cerevisiae Inn1 associates with the contractile actomyosin ring at the end of mitosis and is needed for cytokinesis. The C2 domain of Inn1, located at the N-terminus, is required for ingression of the plasma membrane. The C-terminus is relatively unstructured and contains eight PXXP motifs that are thought to mediate interaction of Inn1 with other proteins with SH3 domains in the cytokinesis proteins Hof1 (an F-BAR protein) and Cyk3 (whose overexpression can restore primary septum formation in Inn1Delta cells) as well as recruiting Inn1 to the bud-neck by binding to Cyk3. Inn1 and Cyk3 appear to cooperate in activating chitin synthase Chs2 for primary septum formation, which allows coordination of actomyosin ring contraction with ingression of the cleavage furrow. It is thought that the C2 domain of Inn1 helps to preserve the link between the actomyosin ring and the plasma membrane, contr
Probab=91.35  E-value=0.18  Score=29.11  Aligned_cols=38  Identities=16%  Similarity=0.051  Sum_probs=27.2

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVE   41 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vt   41 (51)
                      ||.+.++|+++-.+...+..+.|..+.   ..-|+|.+.++
T Consensus        80 iG~~~~~l~~~~~~~~~~~w~~L~~~~---~~~G~i~l~l~  117 (118)
T cd08681          80 IGDTEVDLSPALKEGEFDDWYELTLKG---RYAGEVYLELT  117 (118)
T ss_pred             eEEEEEecHHHhhcCCCCCcEEeccCC---cEeeEEEEEEE
Confidence            688888888876666666667776532   46788888776


No 13 
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. 
Probab=91.24  E-value=0.3  Score=27.96  Aligned_cols=36  Identities=39%  Similarity=0.450  Sum_probs=27.8

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGY   38 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l   38 (51)
                      +|.|.+.++++.-++..++.+.|.....  ...|.+.+
T Consensus        79 iG~~~~~l~~l~~~~~~~~~~~L~~~g~--~~~~~~~~  114 (115)
T cd04040          79 LGSAYIDLSDLEPEETTELTLPLDGQGG--GKLGAVFL  114 (115)
T ss_pred             eEEEEEEHHHcCCCCcEEEEEECcCCCC--ccCceEEc
Confidence            5888888888888888888888876554  66676643


No 14 
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD). PLD hydrolyzes terminal phosphodiester bonds in diester glycerophospholipids resulting in the degradation of phospholipids.  In vitro PLD transfers phosphatidic acid to primary alcohols.  In plants PLD plays a role in germination, seedling growth, phosphatidylinositol metabolism, and changes in phospholipid composition.  There is a single Ca(2+)/phospholipid-binding C2 domain in PLD. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins whic
Probab=90.81  E-value=0.53  Score=29.58  Aligned_cols=41  Identities=22%  Similarity=0.263  Sum_probs=34.0

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCC-CCCCcceEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNK-PEENLEYVGYNVE   41 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~-~e~dlG~I~l~vt   41 (51)
                      +|.|++.|+++.-+...+..+.|.+++. +....|.|.+.+.
T Consensus       115 IG~~~i~l~~l~~g~~~~~w~~L~~~~~~~~~~~~~l~v~~~  156 (158)
T cd04015         115 IGRAYIPVEDLLSGEPVEGWLPILDSNGKPPKPGAKIRVSLQ  156 (158)
T ss_pred             EEEEEEEhHHccCCCCcceEEECcCCCCCCCCCCCEEEEEEE
Confidence            6899999999999999999999988744 5566788888765


No 15 
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  
Probab=90.73  E-value=0.22  Score=28.63  Aligned_cols=41  Identities=20%  Similarity=0.319  Sum_probs=29.4

Q ss_pred             CcceEEEcCceeccceEE-EEEEecCCCCCCCCcceEEEEEEEEc
Q psy16618          1 MGSASIDLTTLELGRCTD-LILTLEDPNKPEENLEYVGYNVEKYN   44 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e-~~L~L~Dp~~~e~dlG~I~l~vtL~p   44 (51)
                      +|.|.+.|.++.-+...+ ....|. +  .+...|+|.+.++..|
T Consensus        83 iG~~~~~l~~l~~~~~~~~~~~~~~-~--~~k~~G~i~~~l~~~p  124 (124)
T cd04044          83 IGTAEFDLSSLLQNPEQENLTKNLL-R--NGKPVGELNYDLRFFP  124 (124)
T ss_pred             eEEEEEEHHHhccCccccCcchhhh-c--CCccceEEEEEEEeCC
Confidence            689999999988776654 334443 2  3356799999998766


No 16 
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC). PLCs are involved in the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PIP2) to d-myo-inositol-1,4,5-trisphosphate (1,4,5-IP3) and sn-1,2-diacylglycerol (DAG).   1,4,5-IP3 and DAG are second messengers in eukaryotic signal transduction cascades. PLC is composed of a N-terminal PH domain followed by a series of EF hands, a catalytic TIM barrel and a C-terminal C2 domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking 
Probab=90.24  E-value=0.78  Score=26.45  Aligned_cols=39  Identities=21%  Similarity=0.263  Sum_probs=31.1

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEK   42 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL   42 (51)
                      +|.|.+.|++|+-+.   -.++|.++++-...-|.|.+.+++
T Consensus        89 iG~~~~~l~~l~~g~---~~~~l~~~~~~~~~~~~l~v~~~~  127 (128)
T cd00275          89 LGQACLPLDSLRQGY---RHVPLLDSKGEPLELSTLFVHIDI  127 (128)
T ss_pred             eEEEEEEhHHhcCce---EEEEecCCCCCCCcceeEEEEEEE
Confidence            589999999985432   457999998866777999998876


No 17 
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42). Nedd4 and Nedd4-2 are two of the nine members of the Human Nedd4 family.  All vertebrates appear to have both Nedd4 and Nedd4-2 genes. They are thought to participate in the regulation of epithelial Na+ channel (ENaC) activity. They also have identical specificity for ubiquitin conjugating enzymes (E2).  Nedd4 and Nedd4-2 are composed of a C2 domain, 2-4 WW domains, and a ubiquitin ligase Hect domain. Their WW domains can bind PPxY (PY) or LPSY motifs, and in vitro studies suggest that WW3 and WW4 of both proteins bind PY motifs in the key substrates, with WW3 generally exhibiting higher affinity. Most Nedd4 family members, especially Nedd4-2, also have multiple splice variants, which might play different roles in regulating their substrates. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=89.95  E-value=0.39  Score=28.23  Aligned_cols=42  Identities=10%  Similarity=-0.013  Sum_probs=32.5

Q ss_pred             CcceEEEcCceeccceE------EEEEEecCCCCCCCCcceEEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCT------DLILTLEDPNKPEENLEYVGYNVEK   42 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~------e~~L~L~Dp~~~e~dlG~I~l~vtL   42 (51)
                      +|.+.+.++++...++.      +--..|+.++.....-|+|.+.+..
T Consensus        85 iG~~~i~l~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~G~l~~~~~~  132 (133)
T cd04033          85 LGQVEVPLNNLPTETPGNERRYTFKDYLLRPRSSKSRVKGHLRLYMAY  132 (133)
T ss_pred             eEEEEEEHHHCCCcCccccccccchheeeeecCCCCcceeEEEEEEee
Confidence            58899999999987654      3556777776666789999998864


No 18 
>PF06775 Seipin:  Putative adipose-regulatory protein (Seipin);  InterPro: IPR009617 Seipin is a protein of approximately 400 residues in humans, which is the product of a gene homologous to the murine guanine nucleotide-binding protein (G protein) gamma-3 linked gene. This gene is implicated in the regulation of body fat distribution and insulin resistance and particularly in the auto-immune disease Berardinelli-Seip congenital lipodystrophy type 2. Seipin has no similarity with other known proteins or consensus motifs that might predict its function, but it is predicted to contain two transmembrane domains at residues 28-49 and 237-258, in humans, and a third transmembrane domain might be present at residues 155-173. Seipin may also be implicated in Silver spastic paraplegia syndrome and distal hereditary motor neuropathy type V [].
Probab=89.28  E-value=1.8  Score=28.36  Aligned_cols=46  Identities=26%  Similarity=0.377  Sum_probs=39.7

Q ss_pred             ceEEEcC----ceeccceEEEEEEecCCCCC-CCCcceEEEEEEEEccchh
Q psy16618          3 SASIDLT----TLELGRCTDLILTLEDPNKP-EENLEYVGYNVEKYNAEQR   48 (51)
Q Consensus         3 SA~l~Lt----~LEl~r~~e~~L~L~Dp~~~-e~dlG~I~l~vtL~pk~~~   48 (51)
                      .|.++|+    .|.-+..+++.+.|+=|.++ ..++|..-+++++.-.++.
T Consensus        41 ~A~v~l~~~~~~l~~~q~Ydv~v~L~lP~S~~N~~lG~Fmv~l~l~s~~~~   91 (199)
T PF06775_consen   41 YANVSLSNKARLLPPGQPYDVSVELELPESPYNRDLGMFMVSLELLSANGK   91 (199)
T ss_pred             EEEEEeccCccccCCCceEEEEEEEEeCCCCCcCCCCeEEEEEEEEcCCCc
Confidence            5778888    78889999999999989886 4899999999999877664


No 19 
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip). Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice varian
Probab=88.29  E-value=0.86  Score=27.87  Aligned_cols=40  Identities=13%  Similarity=0.145  Sum_probs=24.1

Q ss_pred             CcceEEEcC-ceeccceEEEEEEecCCCCCCCCcceEEEEEE
Q psy16618          1 MGSASIDLT-TLELGRCTDLILTLEDPNKPEENLEYVGYNVE   41 (51)
Q Consensus         1 MGSA~l~Lt-~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vt   41 (51)
                      ||++.+.|. .+.-+...+.-+.|.+.+. ....|.|.|.++
T Consensus        80 iG~~~i~l~~~~~~g~~~~~W~~L~~~~~-~~~~g~i~l~l~  120 (121)
T cd04016          80 IAWTHITIPESVFNGETLDDWYSLSGKQG-EDKEGMINLVFS  120 (121)
T ss_pred             EEEEEEECchhccCCCCccccEeCcCccC-CCCceEEEEEEe
Confidence            466777774 4555666666666665332 445677766654


No 20 
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  The cds in this family contain multiple C2 domains as well as a C-terminal PRT domain.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal tran
Probab=87.39  E-value=1.2  Score=25.46  Aligned_cols=40  Identities=15%  Similarity=0.228  Sum_probs=28.7

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEK   42 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL   42 (51)
                      +|.+.+.|.++.-+.  +....|.++......-|.|.+.+.+
T Consensus        79 iG~~~~~l~~~~~~~--~~~~~l~~~~~~~~~~G~i~l~~~~  118 (119)
T cd08377          79 LGKVAIPLLSIKNGE--RKWYALKDKKLRTRAKGSILLEMDV  118 (119)
T ss_pred             eeEEEEEHHHCCCCC--ceEEECcccCCCCceeeEEEEEEEe
Confidence            578888888876554  4466677776655678888888765


No 21 
>cd04046 C2_Calpain C2 domain present in Calpain proteins. A single C2 domain is found in calpains (EC 3.4.22.52, EC 3.4.22.53), calcium-dependent, non-lysosomal cysteine proteases.  Caplains are classified as belonging to Clan CA by MEROPS and include six families: C1, C2, C10, C12, C28, and C47.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of pic
Probab=87.31  E-value=2.3  Score=25.19  Aligned_cols=42  Identities=17%  Similarity=0.155  Sum_probs=27.9

Q ss_pred             CcceEEEcCceeccceEEEEEEecCC--CCCCCCcceEEEEEEEEc
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDP--NKPEENLEYVGYNVEKYN   44 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp--~~~e~dlG~I~l~vtL~p   44 (51)
                      +|.+.+.+..+.-  .....+.|+..  .....--|+|.+.|++.+
T Consensus        80 lG~~~~~l~~~~~--~~~~~~~l~~~~~~~~~~~~G~i~~~~~~~~  123 (126)
T cd04046          80 LGQATLSADPNDS--QTLRTLPLRKRGRDAAGEVPGTISVKVTSSD  123 (126)
T ss_pred             eEEEEEecccCCC--cCceEEEcccCCCCCCCCCCCEEEEEEEEcc
Confidence            5889999987543  33445555422  233478899999988765


No 22 
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates
Probab=87.13  E-value=1  Score=28.22  Aligned_cols=45  Identities=18%  Similarity=0.201  Sum_probs=35.6

Q ss_pred             CcceEEEcCceecc----ceEEEEEEecCCCC------CCCCcceEEEEEEEEcc
Q psy16618          1 MGSASIDLTTLELG----RCTDLILTLEDPNK------PEENLEYVGYNVEKYNA   45 (51)
Q Consensus         1 MGSA~l~Lt~LEl~----r~~e~~L~L~Dp~~------~e~dlG~I~l~vtL~pk   45 (51)
                      ||.+.|.|+++.-+    ...+.-+.|++++.      ++.--|.|.|.+++.+.
T Consensus        80 lG~v~i~L~~l~~~~~~~~~~~~W~~L~~~~~~~~~~k~~k~~g~l~l~i~~~~~  134 (150)
T cd04019          80 LGRAVIPLNDIERRVDDRPVPSRWFSLERPGGAMEQKKKRKFASRIHLRLCLDGG  134 (150)
T ss_pred             EEEEEEEHHHCcccCCCCccCCceEECcCCCCcccccccCcccccEEEEEEecCc
Confidence            69999999999753    45678889999874      34556999999999864


No 23 
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs). RasGAPs suppress Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  The proteins here all contain either a single C2 domain or two tandem C2 domains,  a Ras-GAP domain, and a pleckstrin homology (PH)-like domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 
Probab=85.81  E-value=3.1  Score=23.61  Aligned_cols=38  Identities=21%  Similarity=0.273  Sum_probs=25.9

Q ss_pred             eEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEE
Q psy16618          4 ASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVE   41 (51)
Q Consensus         4 A~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vt   41 (51)
                      +.+.|..++.+...+.-+.|...+......|+|.+.+.
T Consensus        79 g~v~l~~~~~~~~~~~w~~L~~~~~~~~~~G~l~l~~~  116 (117)
T cd08383          79 GKVALSKLDLGQGKDEWFPLTPVDPDSEVQGSVRLRAR  116 (117)
T ss_pred             EEEEecCcCCCCcceeEEECccCCCCCCcCceEEEEEE
Confidence            34556666777777777888766555567888877663


No 24 
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphate
Probab=83.21  E-value=1.9  Score=25.71  Aligned_cols=39  Identities=18%  Similarity=0.118  Sum_probs=28.3

Q ss_pred             CcceEEEcCceeccce-----EEEEEEecCCCCCCCCcceEEEEE
Q psy16618          1 MGSASIDLTTLELGRC-----TDLILTLEDPNKPEENLEYVGYNV   40 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~-----~e~~L~L~Dp~~~e~dlG~I~l~v   40 (51)
                      ||.+.++|+++.....     .+.-..|.+..+ ...-|+|.|.+
T Consensus        74 lG~~~i~l~~l~~~~~~~~~~~~~W~~L~~~~~-~~~~G~i~l~~  117 (121)
T cd08378          74 LGGVCFDLSEVPTRVPPDSPLAPQWYRLEDKKG-GRVGGELMLAV  117 (121)
T ss_pred             eeeEEEEhHhCcCCCCCCCCCCcceEEccCCCC-CccceEEEEEE
Confidence            6899999999877543     345667777765 56779888654


No 25 
>cd08375 C2_Intersectin C2 domain present in Intersectin. A single instance of the C2 domain is located C terminally in the intersectin protein.  Intersectin functions as a scaffolding protein, providing a link between the actin cytoskeleton and the components of endocytosis and plays a role in signal transduction.   In addition to C2, intersectin contains several additional domains including: Eps15 homology domains, SH3 domains, a RhoGEF domain, and a PH domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking pro
Probab=82.49  E-value=1.4  Score=27.03  Aligned_cols=37  Identities=16%  Similarity=0.083  Sum_probs=23.4

Q ss_pred             CcceEEEcCceec-----cceEEEEEEecCCCCCCCCcceEEEEEEE
Q psy16618          1 MGSASIDLTTLEL-----GRCTDLILTLEDPNKPEENLEYVGYNVEK   42 (51)
Q Consensus         1 MGSA~l~Lt~LEl-----~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL   42 (51)
                      ||.+.+.|+++.-     ..+....+.|.     +-+.|+|.|.+++
T Consensus        94 lG~~~i~l~~l~~~~~~~~~~~~~~~~~~-----~~~~g~i~l~~~~  135 (136)
T cd08375          94 LGRTEIRVADILKETKESKGPITKRLLLH-----EVPTGEVVVKLDL  135 (136)
T ss_pred             eEEEEEEHHHhccccccCCCcEEEEeccc-----cccceeEEEEEEe
Confidence            5778888877765     33333344442     4667888888776


No 26 
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. It is thought to be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues and is Ca2+ independent. Human synaptotagmin 15 has 2 alternatively spliced forms that encode proteins with different C-termini.  The larger, SYT15a, contains a N-terminal TM region, a putative fatty-acylation site, and 2 tandem C terminal C2 domains.  The smaller, SYT15b, lacks the C-terminal portion of the second C2 domain.  Unlike most other synaptotagmins it is nearly absent in the brain and rather is found in the heart, lungs, skeletal muscle, and testis. Synaptotagmin 17 is located in the brain, kidney, and prostate and is thought to be a peripheral membrane protein. Previously all synaptotagmins were thought to be calcium sensors in the regulat
Probab=82.40  E-value=1.4  Score=25.50  Aligned_cols=25  Identities=24%  Similarity=0.270  Sum_probs=21.9

Q ss_pred             CcceEEEcCceeccceEEEEEEecC
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLED   25 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~D   25 (51)
                      ||.|.+.|+++...+..+.-+.|++
T Consensus        99 iG~~~i~L~~l~~~~~~~~w~~L~~  123 (123)
T cd08390          99 IGHVLFPLKDLDLVKGGVVWRDLEP  123 (123)
T ss_pred             EEEEEEeccceecCCCceEEEeCCC
Confidence            6999999999999998888888763


No 27 
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synap
Probab=82.08  E-value=2.7  Score=24.36  Aligned_cols=36  Identities=22%  Similarity=0.245  Sum_probs=25.2

Q ss_pred             CcceEEEcCceecc---ceEEEEEEecCCCCCCCCcceEEEEEEEE
Q psy16618          1 MGSASIDLTTLELG---RCTDLILTLEDPNKPEENLEYVGYNVEKY   43 (51)
Q Consensus         1 MGSA~l~Lt~LEl~---r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~   43 (51)
                      +|.|.+.|+.+...   ...++.+.|..       -|.|.+.+++.
T Consensus        83 iG~~~i~l~~~~~~~~~~~~~~w~~l~~-------~g~i~l~~~~~  121 (126)
T cd04043          83 CGRASLKLDPKRFGDDGLPREIWLDLDT-------QGRLLLRVSME  121 (126)
T ss_pred             EEEEEEecCHHHcCCCCCCceEEEEcCC-------CCeEEEEEEEe
Confidence            58888888876554   35677777752       27888877764


No 28 
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4. Rasal1 and RasA4 are both members of GAP1 (GTPase activating protein 1).  Rasal1 responds to repetitive Ca2+ signals by associating with the plasma membrane and deactivating Ras. RasA4 suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation.  Both of these proteins contains two C2 domains, a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  
Probab=81.19  E-value=1.5  Score=25.80  Aligned_cols=41  Identities=17%  Similarity=0.217  Sum_probs=27.0

Q ss_pred             CcceEEEcCceecc-ceEEEEEEecCCCCCCCCcceEEEEEE
Q psy16618          1 MGSASIDLTTLELG-RCTDLILTLEDPNKPEENLEYVGYNVE   41 (51)
Q Consensus         1 MGSA~l~Lt~LEl~-r~~e~~L~L~Dp~~~e~dlG~I~l~vt   41 (51)
                      ||.+.+.+..+.-. +..+.-+.|+.-...+..-|+|.+.++
T Consensus        79 iG~~~~~~~~~~~~~~~~~~W~~L~~~~~~~~~~G~i~l~~~  120 (121)
T cd04054          79 IGKVSLTREVISAHPRGIDGWMNLTEVDPDEEVQGEIHLELS  120 (121)
T ss_pred             EEEEEEcHHHhccCCCCCCcEEECeeeCCCCccccEEEEEEE
Confidence            57788887776532 346777777654443467788877765


No 29 
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as
Probab=80.61  E-value=2.1  Score=27.18  Aligned_cols=30  Identities=27%  Similarity=0.144  Sum_probs=18.4

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCC
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPE   30 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e   30 (51)
                      ||.+.|+|++++++.....-..|.++.++.
T Consensus       114 iG~~~i~L~~l~~~~~~~~Wy~L~~~~~~~  143 (146)
T cd04028         114 MGVAQILLDDLDLSNLVIGWYKLFPTSSLV  143 (146)
T ss_pred             EEEEEEEcccccCCCCceeEEecCCccccc
Confidence            566666666666666655556666555543


No 30 
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins. SRC2 production is a response to pathogen infiltration.  The initial response of increased Ca2+ concentrations are coupled to downstream signal transduction pathways via calcium binding proteins.  SRC2 contains a single C2 domain which localizes to the plasma membrane and is involved in Ca2+ dependent protein binding. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such 
Probab=79.34  E-value=1.9  Score=25.09  Aligned_cols=35  Identities=20%  Similarity=0.262  Sum_probs=18.8

Q ss_pred             CcceEEEcCceeccceE-----EEEEEecCCCCCCCCcceEE
Q psy16618          1 MGSASIDLTTLELGRCT-----DLILTLEDPNKPEENLEYVG   37 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~-----e~~L~L~Dp~~~e~dlG~I~   37 (51)
                      ||.|.+.|+++.-+...     .....|.+++.  ..-|+|.
T Consensus        85 lG~~~i~l~~l~~~~~~~~~~~~~~~~l~~~~g--~~~G~~~  124 (125)
T cd04051          85 IGEVRVPLKDLLDGASPAGELRFLSYQLRRPSG--KPQGVLN  124 (125)
T ss_pred             EEEEEEEHHHhhcccCCCCcceeEEEEeECCCC--CcCeEEe
Confidence            46666666666555432     34555555553  4555543


No 31 
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins. A single C2 domain is found in Smurf proteins, C2-WW-HECT-domain E3s, which play an important role in the downregulation of the TGF-beta signaling pathway.  Smurf proteins also regulate cell shape, motility, and polarity by degrading small guanosine triphosphatases (GTPases). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are 
Probab=78.98  E-value=2.6  Score=24.86  Aligned_cols=39  Identities=15%  Similarity=0.059  Sum_probs=20.4

Q ss_pred             CcceEEEcCceeccceE-EEEEEecCCCCCCCC--cceEEEE
Q psy16618          1 MGSASIDLTTLELGRCT-DLILTLEDPNKPEEN--LEYVGYN   39 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~-e~~L~L~Dp~~~e~d--lG~I~l~   39 (51)
                      ||.+.+.++++.-.+.. .-.+.|+++...+.+  -|+|.+.
T Consensus        80 lG~~~i~l~~l~~~~~~~~~~~~l~~~~~~~~~~~~G~v~~~  121 (123)
T cd08382          80 LGCVRIRANAVLPLKDTGYQRLDLRKLKKSDNLSVRGKIVVS  121 (123)
T ss_pred             EeEEEEEHHHccccCCCccceeEeecCCCCCCceEeeEEEEE
Confidence            46677777776433322 446666666653222  4554443


No 32 
>PLN03008 Phospholipase D delta
Probab=78.38  E-value=4.5  Score=33.05  Aligned_cols=47  Identities=13%  Similarity=0.148  Sum_probs=40.6

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCC-CCCCcceEEEEEEEEccch
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNK-PEENLEYVGYNVEKYNAEQ   47 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~-~e~dlG~I~l~vtL~pk~~   47 (51)
                      ||.|+|.|.+|.-+...+..+.|-+.+. |.+.-|.|.+.+...|-..
T Consensus       134 IG~a~IPL~~L~~Ge~vd~Wl~Ll~~~~kp~k~~~kl~v~lqf~pv~~  181 (868)
T PLN03008        134 IGTAKIPVRDIASGERISGWFPVLGASGKPPKAETAIFIDMKFTPFDQ  181 (868)
T ss_pred             eEEEEEEHHHcCCCCceEEEEEccccCCCCCCCCcEEEEEEEEEEccc
Confidence            7999999999999999999999998885 4456689999998888553


No 33 
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular
Probab=77.95  E-value=3.1  Score=23.66  Aligned_cols=26  Identities=42%  Similarity=0.486  Sum_probs=14.2

Q ss_pred             CcceEEEcCceeccceEEEEEEecCC
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDP   26 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp   26 (51)
                      ||.+.+.|+++.-+...+.-+.|++.
T Consensus        85 iG~~~i~l~~l~~~~~~~~w~~L~~~  110 (121)
T cd08391          85 LGRLSIDLGSVEKKGFIDEWLPLEDV  110 (121)
T ss_pred             EEEEEEEHHHhcccCccceEEECcCC
Confidence            35555665555555555555555543


No 34 
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permu
Probab=77.15  E-value=4.8  Score=23.15  Aligned_cols=41  Identities=15%  Similarity=0.101  Sum_probs=26.2

Q ss_pred             CcceEEEcCceec---cceEEEEEEecCCCCC--CCCcceEEEEEE
Q psy16618          1 MGSASIDLTTLEL---GRCTDLILTLEDPNKP--EENLEYVGYNVE   41 (51)
Q Consensus         1 MGSA~l~Lt~LEl---~r~~e~~L~L~Dp~~~--e~dlG~I~l~vt   41 (51)
                      ||.+.+.|.++..   ....+.-+.|++....  ...-|+|.|.++
T Consensus        82 lG~~~i~l~~~~~~~~~~~~~~w~~L~~~~~~~~~~~~G~i~l~~~  127 (128)
T cd04024          82 LGEFDIALEEVFADGKTGQSDKWITLKSTRPGKTSVVSGEIHLQFS  127 (128)
T ss_pred             ceEEEEEHHHhhcccccCccceeEEccCcccCccccccceEEEEEE
Confidence            5888888888763   2334566667665432  235788887764


No 35 
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon. A single C2 domain is found in PKC epsilon. The PKC family of serine/threonine kinases regulates apoptosis, proliferation, migration, motility, chemo-resistance, and differentiation.  There are 3 groups: group 1 (alpha, betaI, beta II, gamma) which require phospholipids and calcium, group 2 (delta, epsilon, theta, eta) which do not require calcium for activation, and group 3 (xi, iota/lambda) which are atypical and can be activated in the absence of diacylglycerol and calcium. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that
Probab=76.07  E-value=4.5  Score=23.90  Aligned_cols=36  Identities=19%  Similarity=0.205  Sum_probs=24.9

Q ss_pred             CcceEEEcCceec--cceEEEEEEecCCCCCCCCcceEEEEEEEE
Q psy16618          1 MGSASIDLTTLEL--GRCTDLILTLEDPNKPEENLEYVGYNVEKY   43 (51)
Q Consensus         1 MGSA~l~Lt~LEl--~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~   43 (51)
                      +|.+.+.|+++.-  +...+.-+.|+       .-|.|.+.+++.
T Consensus        92 iG~~~i~l~~l~~~~~~~~~~w~~L~-------~~G~l~l~~~~~  129 (132)
T cd04014          92 VANCTISFEDLIQRGSGSFDLWVDLE-------PQGKLHVKIELK  129 (132)
T ss_pred             EEEEEEEhHHhcccCCCcccEEEEcc-------CCcEEEEEEEEe
Confidence            5778888887776  45567777775       237777777654


No 36 
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain. Rabphilin is found neurons and in neuroendrocrine cells, while Doc2 is found not only in the brain but in tissues, including mast cells, chromaffin cells, and osteoblasts.  Rabphilin and Doc2s share highly homologous tandem C2 domains, although their N-terminal structures are completely different: rabphilin contains an N-terminal Rab-binding domain (RBD),7 whereas Doc2 contains an N-terminal Munc13-1-interacting domain (MID). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain
Probab=74.69  E-value=2.3  Score=24.74  Aligned_cols=23  Identities=22%  Similarity=0.411  Sum_probs=20.3

Q ss_pred             CcceEEEcCceeccceEEEEEEe
Q psy16618          1 MGSASIDLTTLELGRCTDLILTL   23 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L   23 (51)
                      ||.+.+.|++|.-+...++++.|
T Consensus       101 iG~~~i~l~~l~~~~~~~~~~~~  123 (123)
T cd04035         101 LGETRIPLKKLKPNQTKQFNICL  123 (123)
T ss_pred             EEEEEEEcccCCCCcceEeeccC
Confidence            69999999999999999888764


No 37 
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. 
Probab=74.33  E-value=3.8  Score=23.73  Aligned_cols=39  Identities=18%  Similarity=0.173  Sum_probs=25.5

Q ss_pred             CcceEEEcCce-eccceEEEEEEecCCCCCCCCcceEEEEEEEEc
Q psy16618          1 MGSASIDLTTL-ELGRCTDLILTLEDPNKPEENLEYVGYNVEKYN   44 (51)
Q Consensus         1 MGSA~l~Lt~L-El~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~p   44 (51)
                      ||.+.+.|+++ .-....+..+.|++  .   .-|+|.+.+...|
T Consensus        71 iG~~~v~L~~l~~~~~~~~~w~~L~~--~---~~G~i~~~~~~~p  110 (111)
T cd04052          71 LGSVSISLNDLIDATSVGQQWFPLSG--N---GQGRIRISALWKP  110 (111)
T ss_pred             EEEEEecHHHHHhhhhccceeEECCC--C---CCCEEEEEEEEec
Confidence            57888888877 22333466777765  1   2388888877766


No 38 
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3). RasA3 are members of GTPase activating protein 1 (GAP1), a Ras-specific GAP, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  RasA3 contains an N-terminal C2 domain,  a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain
Probab=73.77  E-value=5.1  Score=25.23  Aligned_cols=30  Identities=20%  Similarity=0.285  Sum_probs=25.4

Q ss_pred             CcceEEEcCceecc-ceEEEEEEecCCCCCC
Q psy16618          1 MGSASIDLTTLELG-RCTDLILTLEDPNKPE   30 (51)
Q Consensus         1 MGSA~l~Lt~LEl~-r~~e~~L~L~Dp~~~e   30 (51)
                      ||.+.|.|+.+..+ ...+..+.|++..+..
T Consensus        97 LG~v~i~l~~l~~~~~~~~~W~~L~~~~~~~  127 (148)
T cd04010          97 LGEVRIPLRGLDLQAGSHQAWYFLQPREEKS  127 (148)
T ss_pred             eEEEEEecccccccCCcCcceeecCCccccc
Confidence            79999999999998 6778889998776644


No 39 
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmins 4 and 11, class 4 synaptotagmins, are located in the brain.  Their functions are unknown. They are distinguished from the other synaptotagmins by having and Asp to Ser substitution in their C2A domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence 
Probab=68.18  E-value=6.4  Score=23.59  Aligned_cols=23  Identities=13%  Similarity=0.037  Sum_probs=17.7

Q ss_pred             CcceEEEcCceecc--ceEEEEEEe
Q psy16618          1 MGSASIDLTTLELG--RCTDLILTL   23 (51)
Q Consensus         1 MGSA~l~Lt~LEl~--r~~e~~L~L   23 (51)
                      ||.+.+.|+++++.  ....+.|.|
T Consensus       102 lG~~~i~L~~l~~~~~~~~~~~~~~  126 (128)
T cd08388         102 IGEVVCPLAGADLLNEGELLVSREI  126 (128)
T ss_pred             eEEEEEeccccCCCCCceEEEEEec
Confidence            68999999999998  555555544


No 40 
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synaptobrevi
Probab=66.55  E-value=6.4  Score=24.02  Aligned_cols=28  Identities=14%  Similarity=0.179  Sum_probs=24.6

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCC
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNK   28 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~   28 (51)
                      +|.|.|.|+++..+...++.+.|+.+-.
T Consensus        88 IG~~~l~l~~~~~~~~~~~w~~L~~~~~  115 (120)
T cd08395          88 VGVTVLQLRDIAQAGSCACWLPLGRRIH  115 (120)
T ss_pred             EEEEEEEHHHCcCCCcEEEEEECcCccc
Confidence            6999999999999999999999976644


No 41 
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangeme
Probab=65.28  E-value=7.9  Score=22.18  Aligned_cols=26  Identities=31%  Similarity=0.330  Sum_probs=17.2

Q ss_pred             CcceEEEcCceeccc---eEEEEEEecCC
Q psy16618          1 MGSASIDLTTLELGR---CTDLILTLEDP   26 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r---~~e~~L~L~Dp   26 (51)
                      +|.+.++|+++.-..   ..+--+.|.||
T Consensus        83 iG~~~i~l~~v~~~~~~~~~~~w~~L~~~  111 (111)
T cd04011          83 IGSFKLDVGTVYDQPDHAFLRKWLLLTDP  111 (111)
T ss_pred             cEEEEECCccccCCCCCcceEEEEEeeCc
Confidence            688889998886552   23445666665


No 42 
>PHA00098 hypothetical protein
Probab=62.44  E-value=10  Score=24.29  Aligned_cols=33  Identities=18%  Similarity=0.229  Sum_probs=23.3

Q ss_pred             ccceEEEEEEecCCCCCCCCcceEEEEEEEEccchhccC
Q psy16618         13 LGRCTDLILTLEDPNKPEENLEYVGYNVEKYNAEQRQYR   51 (51)
Q Consensus        13 l~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~pk~~~~k~   51 (51)
                      =+|.+++++.+    +|++.+|.|.  +.|.|.+.+.|+
T Consensus        72 p~Rey~l~~~~----np~dp~~aiv--~elipvD~eiKK  104 (112)
T PHA00098         72 PNREYQLRFEI----NPEDPLAAIV--TELIPVDDDIKK  104 (112)
T ss_pred             CCcceeEEEec----CCCCcccceE--EEeecCCHHHHH
Confidence            35677777765    4556688775  567899988764


No 43 
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16. Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain.   Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicle
Probab=62.00  E-value=6.9  Score=23.25  Aligned_cols=24  Identities=38%  Similarity=0.508  Sum_probs=20.4

Q ss_pred             CcceEEEcCceeccceEEEEEEec
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLE   24 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~   24 (51)
                      +|.+.|.|+++.++.....-+.|+
T Consensus       100 lG~~~i~L~~l~~~~~~~~w~~L~  123 (124)
T cd08389         100 IGEKVVPLSQLNLEGETTVWLTLE  123 (124)
T ss_pred             EEEEEEeccccCCCCCceEEEeCC
Confidence            689999999999988888777775


No 44 
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangeme
Probab=58.98  E-value=24  Score=21.02  Aligned_cols=14  Identities=7%  Similarity=-0.126  Sum_probs=9.1

Q ss_pred             CCcceEEEEEEEEc
Q psy16618         31 ENLEYVGYNVEKYN   44 (51)
Q Consensus        31 ~dlG~I~l~vtL~p   44 (51)
                      ...|+|.+.+.|-+
T Consensus       120 ~~~Geil~~~~~~~  133 (135)
T cd04017         120 QSAGELLAAFELIE  133 (135)
T ss_pred             CchhheeEEeEEEE
Confidence            46677777776654


No 45 
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4. RasA1 and RasA4 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  Both proteins contain two C2 domains,  a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such a
Probab=58.84  E-value=19  Score=20.80  Aligned_cols=40  Identities=18%  Similarity=0.243  Sum_probs=23.7

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCC----CCCCcceEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNK----PEENLEYVGYNV   40 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~----~e~dlG~I~l~v   40 (51)
                      ||.+.++|.++..+...+.-..|.....    .....|.|.+.+
T Consensus        79 iG~~~~~l~~l~~~~~~~~w~~L~~~~~~~~~~~~~~G~l~~~~  122 (123)
T cd04025          79 LGKVVFSIQTLQQAKQEEGWFRLLPDPRAEEESGGNLGSLRLKV  122 (123)
T ss_pred             eEEEEEEHHHcccCCCCCCEEECCCCCCCCccccCceEEEEEEe
Confidence            5777777777766655565566654222    234666666654


No 46 
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=54.35  E-value=31  Score=20.24  Aligned_cols=38  Identities=16%  Similarity=0.141  Sum_probs=20.8

Q ss_pred             ceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEE
Q psy16618          3 SASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNV   40 (51)
Q Consensus         3 SA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~v   40 (51)
                      .|.|-++++++.-.-..+=.+..|..-..-.|+|.|+|
T Consensus        78 ~~sL~I~~v~~~D~G~Y~C~v~~~~~~~~~~~~~~~~~  115 (115)
T cd05880          78 DASILIWQLQPTDNGTYTCQVKNPPDVHGPIGEIRLRV  115 (115)
T ss_pred             ceEEEEeeCChhhCEEEEEEEEeCCCCCCCccEEEEeC
Confidence            45555666665555555555554444333467777654


No 47 
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=54.15  E-value=35  Score=19.69  Aligned_cols=36  Identities=14%  Similarity=0.136  Sum_probs=16.8

Q ss_pred             eEEEcCceeccceEEEEEEecCCCCCCCCcceEEEE
Q psy16618          4 ASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYN   39 (51)
Q Consensus         4 A~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~   39 (51)
                      |.|-+++++..-.-...-.+..+..-+-+-|+|.|.
T Consensus        80 ~sL~I~~v~~~D~G~Y~C~v~~~~~~~~~~~~~~~~  115 (116)
T cd05715          80 ASIVIHNLQFTDNGTYTCDVKNPPDIVGKPGEIRLR  115 (116)
T ss_pred             eEEEEeeCCcccCEEEEEEEEeCCCCCCCccEEEEe
Confidence            445555555544444444444443322344555554


No 48 
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins. KIAA proteins are uncharacterized human proteins. They were compiled by the Kazusa mammalian cDNA project which identified more than 2000 human genes. They are identified by 4 digit codes that precede the KIAA designation.  Many KIAA genes are still functionally uncharacterized including KIAA1228. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1
Probab=49.60  E-value=12  Score=21.56  Aligned_cols=22  Identities=27%  Similarity=0.425  Sum_probs=15.3

Q ss_pred             CcceEEEcCceeccceEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILT   22 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~   22 (51)
                      ||.+.+.|.++..+...+.-..
T Consensus       104 iG~~~i~l~~l~~~~~~~~W~~  125 (127)
T cd04030         104 LGQVLIDLSDLDLSKGFTQWYD  125 (127)
T ss_pred             EEEEEEecccccccCCccceEE
Confidence            6888888888877665544443


No 49 
>PF10358 NT-C2:  N-terminal C2 in EEIG1 and EHBP1 proteins;  InterPro: IPR019448  This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen []. Proteins in this entry are usually annotated as Fam102A, Fam102B, or Eeig1 (early oestrogen-responsive gene product 1). 
Probab=48.78  E-value=54  Score=19.35  Aligned_cols=41  Identities=15%  Similarity=0.170  Sum_probs=24.2

Q ss_pred             CcceEEEcCceec--cceEEEEEEecCCCCCCCCcceEEEEEEEEc
Q psy16618          1 MGSASIDLTTLEL--GRCTDLILTLEDPNKPEENLEYVGYNVEKYN   44 (51)
Q Consensus         1 MGSA~l~Lt~LEl--~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~p   44 (51)
                      .|++.|||+++==  .++....+.|....   .---.+.|++++.+
T Consensus        94 lG~~~inLaey~~~~~~~~~~~~~l~~~~---~~~a~L~isi~~~~  136 (143)
T PF10358_consen   94 LGKVSINLAEYANEDEEPITVRLLLKKCK---KSNATLSISISLSE  136 (143)
T ss_pred             EEEEEEEHHHhhCcCCCcEEEEEeCccCC---CCCcEEEEEEEEEE
Confidence            4778888887655  35666777776651   12234555555544


No 50 
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp4/granuphilin promotes dense-core vesicle exocytosis. The C2A domain of Slp4 is Ca2+ dependent. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2
Probab=48.21  E-value=13  Score=22.12  Aligned_cols=23  Identities=22%  Similarity=0.364  Sum_probs=18.5

Q ss_pred             CcceEEEcCceeccceEEEEEEe
Q psy16618          1 MGSASIDLTTLELGRCTDLILTL   23 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L   23 (51)
                      ||.+.+.|.++++..+.+.-+.|
T Consensus       102 lG~~~i~l~~~~~~~~~~~w~~l  124 (125)
T cd04029         102 LGEVEIPLDSWNFDSQHEECLPL  124 (125)
T ss_pred             EEEEEEeCCcccccCCcccEEEC
Confidence            68999999999998877665554


No 51 
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a member of class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules.  It functions as a Ca2+ sensor for fast exocytosis as do synaptotagmins 5, 6, and 10. It is distinguished from the other synaptotagmins by having an N-glycosylated N-terminus. Synaptotagmins 5, 6, and 10, members of class 3 synaptotagmins, are located primarily in the brain and localized to the active zone and plasma membrane.  They is distinguished from the other synaptotagmins by having disulfide bonds at its N-terminus.  Synaptotagmin 6 also regulates the acrosome reaction, a unique Ca2+-regulated exocytosis, in sperm. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and
Probab=46.92  E-value=17  Score=20.96  Aligned_cols=23  Identities=30%  Similarity=0.507  Sum_probs=16.4

Q ss_pred             CcceEEEcCceeccceEEEEEEe
Q psy16618          1 MGSASIDLTTLELGRCTDLILTL   23 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L   23 (51)
                      ||.+.++|+++..+...+.-+.|
T Consensus       100 lG~~~i~l~~~~~~~~~~~W~~l  122 (124)
T cd08385         100 IGEVRVPLLTVDLGHVTEEWRDL  122 (124)
T ss_pred             eEEEEEecCcccCCCCcceEEEc
Confidence            68888888888776665555444


No 52 
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involv
Probab=45.46  E-value=19  Score=20.86  Aligned_cols=23  Identities=22%  Similarity=0.404  Sum_probs=17.3

Q ss_pred             CcceEEEcCceeccceEEEEEEe
Q psy16618          1 MGSASIDLTTLELGRCTDLILTL   23 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L   23 (51)
                      ||.+.+.|+++.++...+.-+.|
T Consensus       100 iG~~~i~l~~~~~~~~~~~W~~l  122 (124)
T cd08387         100 IGVVELPLAEVDLSEKLDLWRKI  122 (124)
T ss_pred             eEEEEEecccccCCCCcceEEEC
Confidence            68899999998887766555544


No 53 
>PF11456 DUF3019:  Protein of unknown function (DUF3019);  InterPro: IPR021559  This is a bacterial family of uncharacterised proteins. 
Probab=44.48  E-value=47  Score=20.08  Aligned_cols=37  Identities=24%  Similarity=0.255  Sum_probs=26.5

Q ss_pred             ceeccceEEEEEEecCCCCCCCCcceEEEEEEEE-ccch
Q psy16618         10 TLELGRCTDLILTLEDPNKPEENLEYVGYNVEKY-NAEQ   47 (51)
Q Consensus        10 ~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~-pk~~   47 (51)
                      ++++.-..++.+.|.|+++ .+.+....|.|+-. |+..
T Consensus        56 ~~~~~~~~~~~f~L~~~~~-~~~la~~~v~V~~~~~k~R   93 (102)
T PF11456_consen   56 TLEFSSQKDTQFSLRDSDT-GQPLAQVKVKVTWVSPKVR   93 (102)
T ss_pred             EEEEEecCCeEEEEEeCCC-CcEEEEEEEEEEEeccCcC
Confidence            3566667788888999888 44577777877776 6543


No 54 
>PF14924 DUF4497:  Protein of unknown function (DUF4497)
Probab=43.19  E-value=39  Score=20.16  Aligned_cols=26  Identities=12%  Similarity=0.046  Sum_probs=20.8

Q ss_pred             eEEEEEEecCCCCCCCCcceEEEEEEEE
Q psy16618         16 CTDLILTLEDPNKPEENLEYVGYNVEKY   43 (51)
Q Consensus        16 ~~e~~L~L~Dp~~~e~dlG~I~l~vtL~   43 (51)
                      +..=+..|.|++.  +..|+|.+.+.|+
T Consensus        79 ~~k~~f~L~~~~~--~~~G~I~l~iRLs  104 (112)
T PF14924_consen   79 TIKGTFPLFDENG--NPVGEISLYIRLS  104 (112)
T ss_pred             hhcceeEeecCCC--ceeeeEEEEEEEe
Confidence            3444677889888  6999999999987


No 55 
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family. SynGAP, GAP1, RasGAP, and neurofibromin are all members of the Ras-specific GAP (GTPase-activating protein) family.  SynGAP regulates the MAP kinase signaling pathway and is critical for cognition and synapse function.  Mutations in this gene causes mental retardation in humans.   SynGAP contains a PH-like domain, a C2 domain, and a  Ras-GAP domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at leas
Probab=42.51  E-value=63  Score=20.51  Aligned_cols=43  Identities=9%  Similarity=0.156  Sum_probs=26.9

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCC--------CCcceEEEEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPE--------ENLEYVGYNVEKY   43 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e--------~dlG~I~l~vtL~   43 (51)
                      +|.+.|.++++--+...|--+.|.++....        .+-+.|.+.+...
T Consensus        89 IG~V~Ip~~~l~~~~~ve~Wfpl~~~~~~~~~~~~~~~~~~~~lrik~rf~  139 (146)
T cd04013          89 IGTVNIPVTDVSSRQFVEKWYPVSTPKGNGKSGGKEGKGESPSIRIKARYQ  139 (146)
T ss_pred             EEEEEEEHHHhcCCCcccEEEEeecCCCCCccccccccCCCCEEEEEEEEE
Confidence            366777777777666666667776666542        4556666655544


No 56 
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 7, a member of class 2 synaptotagmins, is located in presynaptic plasma membranes in neurons, dense-core vesicles in endocrine cells, and lysosomes in fibroblasts.  It has been shown to play a role in regulation of Ca2+-dependent lysosomal exocytosis in fibroblasts and may also function as a vesicular Ca2+-sensor.  It is distinguished from the other synaptotagmins by having over 12 splice forms. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic ves
Probab=41.62  E-value=23  Score=20.33  Aligned_cols=23  Identities=22%  Similarity=0.367  Sum_probs=16.3

Q ss_pred             CcceEEEcCceeccceEEEEEEe
Q psy16618          1 MGSASIDLTTLELGRCTDLILTL   23 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L   23 (51)
                      ||.+.+.|++++++...+.-..|
T Consensus       101 iG~~~i~l~~l~~~~~~~~W~~l  123 (125)
T cd08386         101 IGEVSLPLNKVDLTEEQTFWKDL  123 (125)
T ss_pred             eeEEEEecccccCCCCcceEEec
Confidence            68888888888877665544443


No 57 
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase. E3 ubiquitin ligase is part of the ubiquitylation mechanism responsible for controlling surface expression of membrane proteins.  The sequential action of several enzymes are involved: ubiquitin-activating enzyme E1, ubiquitin-conjugating enzyme E2, and ubiquitin-protein ligase E3 which is responsible for substrate recognition and promoting the transfer of ubiquitin to the target protein.  E3 ubiquitin ligase is composed of an N-terminal C2 domain, 4 WW domains, and a HECTc domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction e
Probab=41.21  E-value=37  Score=20.03  Aligned_cols=13  Identities=38%  Similarity=0.644  Sum_probs=8.2

Q ss_pred             CcceEEEcCceec
Q psy16618          1 MGSASIDLTTLEL   13 (51)
Q Consensus         1 MGSA~l~Lt~LEl   13 (51)
                      +|.|.++|.++.-
T Consensus        79 iG~~~i~l~~l~~   91 (125)
T cd04021          79 LGEASLDLSDILK   91 (125)
T ss_pred             EEEEEEEHHHhHh
Confidence            4667777766654


No 58 
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike Slp3 and Slp4/granuphilin which are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain.  In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety 
Probab=39.39  E-value=22  Score=21.07  Aligned_cols=18  Identities=17%  Similarity=0.425  Sum_probs=13.8

Q ss_pred             CcceEEEcCceeccceEE
Q psy16618          1 MGSASIDLTTLELGRCTD   18 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e   18 (51)
                      ||.+.+.|.++++.....
T Consensus       102 iG~~~i~L~~~~~~~~~~  119 (125)
T cd08393         102 LGEVEVDLGSWDWSNTQP  119 (125)
T ss_pred             eEEEEEecCccccCCCCc
Confidence            688889998888775443


No 59 
>PF01138 RNase_PH:  3' exoribonuclease family, domain 1 This Prosite family only includes Ribonuclease PH;  InterPro: IPR001247 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function. An active PH domain uses inorganic phosphate as a nucleophile, adding it across the phosphodiester bond between the end two nucleotides in order to release ribonucleoside 5'-diphosphate (rNDP) from the 3' end of the RNA substrate. PH domains can be found in bacterial/organelle RNases and PNPases (polynucleotide phosphorylases) [], as well as in archaeal and eukaryotic RNA exosomes [, ], the later acting as nano-compartments for the degradation or processing of RNA (including mRNA, rRNA, snRNA and snoRNA). Bacterial/organelle PNPases share a common barrel structure with RNA exosomes, consisting of a hexameric ring of PH domains that act as a degradation chamber, and an S1-domain/KH-domain containing cap that binds the RNA substrate (and sometimes accessory proteins) in order to regulate and restrict entry into the degradation chamber []. Unstructured RNA substrates feed in through the pore made by the S1 domains, are degraded by the PH domain ring, and exit as nucleotides via the PH pore at the opposite end of the barrel [, ]. This entry represents the phosphorolytic (PH) domain 1, which has a core 2-layer alpha/beta structure with a left-handed crossover, similar to that found in ribosomal protein S5. This domain is found in bacterial/organelle PNPases and in archaeal/eukaryotic exosomes []. More information about these proteins can be found at Protein of the Month: RNA Exosomes [].; PDB: 2C38_G 2BR2_O 2C37_M 3L7Z_A 2JEB_A 2C39_A 2JEA_A 2JE6_A 3U1K_A 4AM3_B ....
Probab=38.39  E-value=82  Score=18.30  Aligned_cols=42  Identities=21%  Similarity=0.235  Sum_probs=23.9

Q ss_pred             cceEEEcCceeccceEEEEEEecCCCCCC-CCc-ceEEEEEEEEcc
Q psy16618          2 GSASIDLTTLELGRCTDLILTLEDPNKPE-ENL-EYVGYNVEKYNA   45 (51)
Q Consensus         2 GSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e-~dl-G~I~l~vtL~pk   45 (51)
                      |||.+.+-+-..  ..-+......+.+.+ .+. |.|.++|...|-
T Consensus        17 GSa~v~~G~T~V--~~~V~~~~~~~~~~~~~~~~g~~~v~v~~~~~   60 (132)
T PF01138_consen   17 GSARVSLGNTKV--ICSVKGPIEPPPSNERDDAEGRLTVEVEFSPF   60 (132)
T ss_dssp             EEEEEEETTEEE--EEEEEEEEEGCSCSTTSSSSEEEEEEEEECCC
T ss_pred             eEEEEEECCeEE--EEEEEecccccchhcccCCCceEEEEEEeccc
Confidence            677766554221  123445555532323 333 999999999874


No 60 
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. Little is known about the expression or localization of Slp3.  The C2A domain of Slp3 is Ca2+ dependent.  It has been demonstrated that Slp3 promotes dense-core vesicle exocytosis.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids
Probab=38.22  E-value=15  Score=22.22  Aligned_cols=18  Identities=17%  Similarity=0.342  Sum_probs=14.4

Q ss_pred             CcceEEEcCceeccceEE
Q psy16618          1 MGSASIDLTTLELGRCTD   18 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e   18 (51)
                      ||.+.|.|+++++...++
T Consensus       102 lG~~~i~L~~~~~~~~~~  119 (128)
T cd08392         102 LGEVLIPLADWDFEDTDS  119 (128)
T ss_pred             EEEEEEEcCCcccCCCCc
Confidence            689999999998876443


No 61 
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs). RasGAPs suppress Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  The proteins here all contain two tandem C2 domains,  a Ras-GAP domain, and a pleckstrin homology (PH)-like domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin
Probab=37.12  E-value=31  Score=20.92  Aligned_cols=31  Identities=19%  Similarity=0.282  Sum_probs=25.3

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCC
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEE   31 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~   31 (51)
                      ||.+.+.|.++......+.-..|+...+|+.
T Consensus        96 IG~~~i~l~~l~~~~~~~~W~~L~~~~~~~~  126 (137)
T cd08675          96 LGEVRIPLQGLQQAGSHQAWYFLQPREAPGT  126 (137)
T ss_pred             EEEEEEehhhccCCCcccceEecCCcCCCCC
Confidence            6889999999887777888888888877653


No 62 
>PF09922 DUF2154:  Cell wall-active antibiotics response protein (DUF2154);  InterPro: IPR024425 This domain is found in various prokaryotic proteins, including cell wall-active antibiotic response proteins.
Probab=36.66  E-value=41  Score=19.99  Aligned_cols=13  Identities=31%  Similarity=0.713  Sum_probs=10.7

Q ss_pred             CcceEEEcCceec
Q psy16618          1 MGSASIDLTTLEL   13 (51)
Q Consensus         1 MGSA~l~Lt~LEl   13 (51)
                      ||+..|||++..+
T Consensus        24 ~G~~~lDl~~a~l   36 (115)
T PF09922_consen   24 FGDVTLDLSQAQL   36 (115)
T ss_pred             ECCEEEECCCCCc
Confidence            6888888888887


No 63 
>cd08367 P53 P53 DNA-binding domain. P53 is a tumor suppressor gene product; mutations in p53 or lack of expression are found associated with a large fraction of all human cancers. P53 is activated by DNA damage and acts as a regulator of gene expression that ultimatively blocks progression through the cell cycle. P53 binds to DNA as a tetrameric transcription factor. In its inactive form, p53 is bound to the ring finger protein Mdm2, which promotes its ubiquitinylation and subsequent proteosomal degradation. Phosphorylation of p53 disrupts the Mdm2-p53 complex, while the stable and active p53 binds to regulatory regions of its target genes, such as the cyclin-kinase inhibitor p21, which complexes and inactivates cdk2 and other cyclin complexes.
Probab=35.51  E-value=74  Score=21.22  Aligned_cols=26  Identities=35%  Similarity=0.323  Sum_probs=20.8

Q ss_pred             ceEEEEEEecCCCCCCCCcceEEEEEEE
Q psy16618         15 RCTDLILTLEDPNKPEENLEYVGYNVEK   42 (51)
Q Consensus        15 r~~e~~L~L~Dp~~~e~dlG~I~l~vtL   42 (51)
                      |++.+.+.|||++.  +-+|.=.+.|.+
T Consensus       139 R~i~liftLE~~~G--~vLGR~~i~VrV  164 (179)
T cd08367         139 RPIQLVFTLEDENG--NVLGRRVIEVRV  164 (179)
T ss_pred             ceEEEEEEEECCCC--CEeeEEEEEEEE
Confidence            78999999999965  778876666554


No 64 
>cd04047 C2B_Copine C2 domain second repeat in Copine. There are 2 copies of the C2 domain present in copine, a protein involved in membrane trafficking, protein-protein interactions, and perhaps even cell division and growth.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 dom
Probab=34.05  E-value=19  Score=20.35  Aligned_cols=21  Identities=19%  Similarity=0.183  Sum_probs=15.7

Q ss_pred             CcceEEEcCceeccceEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLIL   21 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L   21 (51)
                      ||.+.+.|++|--+++.++.+
T Consensus        88 iG~~~~~l~~l~~~~~~~~~~  108 (110)
T cd04047          88 IGEFETTLDELLKSSPLEFEL  108 (110)
T ss_pred             EEEEEEEHHHHhcCCCceEEe
Confidence            588888888887666666554


No 65 
>cd04048 C2A_Copine C2 domain first repeat in Copine. There are 2 copies of the C2 domain present in copine, a protein involved in membrane trafficking, protein-protein interactions, and perhaps even cell division and growth.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 doma
Probab=33.77  E-value=24  Score=20.41  Aligned_cols=23  Identities=26%  Similarity=0.323  Sum_probs=18.3

Q ss_pred             CcceEEEcCceeccceEEEEEEe
Q psy16618          1 MGSASIDLTTLELGRCTDLILTL   23 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L   23 (51)
                      ||.+.+.+++|--++....++.|
T Consensus        90 iG~~~i~l~~l~~~~~~~~~~~l  112 (120)
T cd04048          90 LGEAECTLGEIVSSPGQKLTLPL  112 (120)
T ss_pred             EEEEEEEHHHHhcCCCcEEEEEc
Confidence            58888999988777777777777


No 66 
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=32.25  E-value=95  Score=17.24  Aligned_cols=7  Identities=29%  Similarity=0.349  Sum_probs=2.7

Q ss_pred             EEEecCC
Q psy16618         20 ILTLEDP   26 (51)
Q Consensus        20 ~L~L~Dp   26 (51)
                      .|.+.+-
T Consensus        69 sL~I~~v   75 (106)
T cd05877          69 SLVITDL   75 (106)
T ss_pred             EEEEccC
Confidence            3444333


No 67 
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike the case in Slp3 and Slp4/granuphilin in which their C2A domains are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain. In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp3 and Slp4/granuphilin promote dense-core vesicle exocytosis. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into 
Probab=32.01  E-value=34  Score=19.45  Aligned_cols=16  Identities=25%  Similarity=0.464  Sum_probs=10.3

Q ss_pred             CcceEEEcCceeccce
Q psy16618          1 MGSASIDLTTLELGRC   16 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~   16 (51)
                      +|.+.+.|.++.++..
T Consensus       101 iG~~~i~l~~l~~~~~  116 (123)
T cd08521         101 LGEVEIPLDSWDLDSQ  116 (123)
T ss_pred             eeEEEEecccccccCC
Confidence            4677777777765543


No 68 
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks). There are 3 classes of PI3Ks based on structure, regulation, and specificity.  All classes contain a N-terminal C2 domain, a PIK domain, and a kinase catalytic domain. Unlike class I and class III, class II PI3Ks have additionally a PX domain and a C-terminal C2 domain containing a nuclear localization signal both of which bind phospholipids though in a slightly different fashion.  PI3Ks (AKA phosphatidylinositol (PtdIns) 3-kinases) regulate cell processes such as cell growth, differentiation, proliferation, and motility. PI3Ks work on phosphorylation of phosphatidylinositol, phosphatidylinositide (4)P (PtdIns (4)P),2 or PtdIns(4,5)P2. Specifically they phosphorylate the D3 hydroxyl group of phosphoinositol lipids on the inositol ring. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permut
Probab=31.47  E-value=33  Score=20.29  Aligned_cols=21  Identities=29%  Similarity=0.452  Sum_probs=14.7

Q ss_pred             CcceEEEcCceeccceEEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLIL   21 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L   21 (51)
                      ||-+.|+|+++.++...+.-.
T Consensus        99 lG~~~i~l~~l~~~~~~~~W~  119 (122)
T cd08381          99 LGGVCIPLKKLDLSQETEKWY  119 (122)
T ss_pred             EEEEEEeccccccCCCccceE
Confidence            578888888888766544433


No 69 
>PF07865 DUF1652:  Protein of unknown function (DUF1652);  InterPro: IPR012448  The proteins in this entry have not been characterised.
Probab=30.71  E-value=71  Score=18.41  Aligned_cols=24  Identities=21%  Similarity=0.257  Sum_probs=16.9

Q ss_pred             ccceEEEEEEecCCCCCCCCcceEEEEEE
Q psy16618         13 LGRCTDLILTLEDPNKPEENLEYVGYNVE   41 (51)
Q Consensus        13 l~r~~e~~L~L~Dp~~~e~dlG~I~l~vt   41 (51)
                      +....-|+++|-||.+     |.+.+.||
T Consensus        21 ~~~~~smtvrl~d~~s-----g~~~l~vt   44 (69)
T PF07865_consen   21 IAPDGSMTVRLFDPAS-----GRVELTVT   44 (69)
T ss_pred             ECCCCcEEEEEecCCC-----CcEEEEEc
Confidence            3445679999999998     55555554


No 70 
>COG2123 RNase PH-related exoribonuclease [Translation, ribosomal structure and biogenesis]
Probab=30.62  E-value=1.5e+02  Score=21.36  Aligned_cols=42  Identities=21%  Similarity=0.203  Sum_probs=23.8

Q ss_pred             cceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEEEEEEcc
Q psy16618          2 GSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYNVEKYNA   45 (51)
Q Consensus         2 GSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~pk   45 (51)
                      |||.+-|.+-++  ..-+..+.--|=---.+.|.+.+++.|.|=
T Consensus        48 GSa~VklG~Tqv--v~gvK~eig~Pf~DtP~eG~~~~n~El~Pl   89 (272)
T COG2123          48 GSALVKLGNTQV--VVGVKAEIGEPFPDTPNEGVLVVNVELSPL   89 (272)
T ss_pred             CcEEEEecCeEE--EEEEEcccCCCCCCCCCCceEEeeeeeecc
Confidence            677665544111  112233333332223689999999999883


No 71 
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synaptobrev
Probab=29.49  E-value=66  Score=18.87  Aligned_cols=37  Identities=19%  Similarity=0.252  Sum_probs=20.2

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCCCCCcceEEEE
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYVGYN   39 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~e~dlG~I~l~   39 (51)
                      +|.+.++|+++.  ...++-..|+.-.....--|+|.+.
T Consensus        90 iG~~~i~l~~~~--~~~~~w~~L~~~~~~~~~~G~i~~~  126 (127)
T cd04027          90 LGQTIIEVRTLS--GEMDVWYNLEKRTDKSAVSGAIRLH  126 (127)
T ss_pred             ceEEEEEhHHcc--CCCCeEEECccCCCCCcEeEEEEEE
Confidence            467777777653  4455666665433323345665543


No 72 
>PF10743 Phage_Cox:  Regulatory phage protein cox;  InterPro: IPR019679 Phage Cox proteins are expressed by Enterobacteria phages. The Cox protein is a 79-residue basic protein with a predicted strong helix-turn-helix DNA-binding motif. It inhibits integrative recombination and it activates site-specific excision of the HP1 genome from the Haemophilus influenzae chromosome, Hp1. Cox appears to function as a tetramer. Cox binding sites consist of two direct repeats of the consensus motif 5'-GGTMAWWWWA, one Cox tetramer binding to each motif. Cox binding interferes with the interaction of HP1 integrase with one of its binding sites, IBS5. This competition is central to directional control. Both Cox binding sites are needed for full inhibition of integration and for activating excision, because it plays a positive role in assembling the nucleoprotein complexes that produce excisive recombination, by inducing the formation of a critical conformation in those complexes []. 
Probab=28.64  E-value=61  Score=19.82  Aligned_cols=20  Identities=20%  Similarity=0.346  Sum_probs=16.6

Q ss_pred             EEecCCCCCCCCcceEEEEEE
Q psy16618         21 LTLEDPNKPEENLEYVGYNVE   41 (51)
Q Consensus        21 L~L~Dp~~~e~dlG~I~l~vt   41 (51)
                      +.++||.+|+.. |+..|.+.
T Consensus        41 i~~~dP~~p~~r-gE~wI~~~   60 (87)
T PF10743_consen   41 IEMRDPEKPNGR-GEWWIYIP   60 (87)
T ss_pred             EeccCCCCCCCc-eeEEEeHH
Confidence            567899999988 99988764


No 73 
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular perm
Probab=25.90  E-value=66  Score=18.13  Aligned_cols=26  Identities=23%  Similarity=0.346  Sum_probs=16.1

Q ss_pred             CcceEEEcCceeccc--eEEEEEEecCC
Q psy16618          1 MGSASIDLTTLELGR--CTDLILTLEDP   26 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r--~~e~~L~L~Dp   26 (51)
                      ||.+.++|+++.-..  ..+--..|++.
T Consensus        76 iG~~~i~l~~l~~~~~~~~~~w~~L~~~  103 (105)
T cd04050          76 LGSLTLPLSELLKEPDLTLDQPFPLDNS  103 (105)
T ss_pred             cEEEEEEHHHhhccccceeeeeEecCCC
Confidence            577888887776442  44555555543


No 74 
>PF00870 P53:  P53 DNA-binding domain;  InterPro: IPR011615 This domain is found in p53 transcription factors, where it is responsible for DNA-binding. These transcription factors play diverse roles in the regulation of cellular functions: the p53 tumour suppressor upregulates the expression of genes involved in cell cycle arrest and apoptosis []. The DNA-binding domain acts to clamp, or in the case of TonEBP, encircle the DNA target in order to stabilise the protein-DNA complex []. Protein interactions may also serve to stabilise the protein-DNA complex, for example in the STAT-1 dimer the SH2 (Src homology 2) domain in each monomer is coupled to the DNA-binding domain to increase stability []. The DNA-binding domain consists of a beta-sandwich formed of 9 strands in 2 sheets with a Greek-key topology. This structure is found in many transcription factors, often within the DNA-binding domain.; GO: 0044212 transcription regulatory region DNA binding; PDB: 3US2_A 3QYM_E 3QYN_A 3US0_C 3US1_D 2RMN_A 3Q06_B 2VUK_A 2H1L_M 1KZY_B ....
Probab=24.70  E-value=1.1e+02  Score=20.59  Aligned_cols=27  Identities=33%  Similarity=0.374  Sum_probs=20.1

Q ss_pred             ceEEEEEEecCCCCCCCCcceEEEEEEEE
Q psy16618         15 RCTDLILTLEDPNKPEENLEYVGYNVEKY   43 (51)
Q Consensus        15 r~~e~~L~L~Dp~~~e~dlG~I~l~vtL~   43 (51)
                      |++.+++.|||++.  +=+|.=.+.|.+-
T Consensus       156 Rpi~~ifTLE~~~g--~vlGR~~~~vrvC  182 (196)
T PF00870_consen  156 RPILLIFTLEDSDG--QVLGRRSFEVRVC  182 (196)
T ss_dssp             S-EEEEEEEEETTS--CEEEEEEEEEEEE
T ss_pred             ceEEEEEEEECCCC--CEeeeeccCceEc
Confidence            68899999999865  8888766666553


No 75 
>PF15627 CEP76-C2:  CEP76 C2 domain
Probab=23.47  E-value=1.4e+02  Score=19.65  Aligned_cols=29  Identities=7%  Similarity=0.030  Sum_probs=24.3

Q ss_pred             EEEEEecCCCCC-CCCcceEEEEEEEEccc
Q psy16618         18 DLILTLEDPNKP-EENLEYVGYNVEKYNAE   46 (51)
Q Consensus        18 e~~L~L~Dp~~~-e~dlG~I~l~vtL~pk~   46 (51)
                      -+.++|...+.. .=..|.+.+.+.|.|+-
T Consensus       124 ~~~vEL~G~~~e~kv~~GiL~l~lELlP~~  153 (156)
T PF15627_consen  124 SFTVELCGVGPESKVPVGILDLRLELLPNL  153 (156)
T ss_pred             ceeEEEeccCCCCccceeEEEEEEEeecCC
Confidence            788999998883 23899999999999975


No 76 
>PLN03008 Phospholipase D delta
Probab=22.61  E-value=42  Score=27.73  Aligned_cols=29  Identities=28%  Similarity=0.428  Sum_probs=26.5

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCCC
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNKP   29 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~~   29 (51)
                      +|||.++-.++.+.|-+|+.+...||.+.
T Consensus       731 iGSaN~n~RS~~~~Rd~E~~~~~~~~~~~  759 (868)
T PLN03008        731 MGSANINQRSMAGTKDTEIAMGAYQPNHT  759 (868)
T ss_pred             EeccccCHhhccCCCCceEeEEecccccc
Confidence            59999999999999999999999888864


No 77 
>PF12599 DUF3768:  Protein of unknown function (DUF3768);  InterPro: IPR022243  This family of proteins is found in bacteria. Proteins in this family are typically between 108 and 129 amino acids in length. There are two conserved sequence motifs: NDP and RVLT. 
Probab=21.04  E-value=69  Score=19.34  Aligned_cols=14  Identities=29%  Similarity=0.593  Sum_probs=10.1

Q ss_pred             CCCCCCCCcceEEEE
Q psy16618         25 DPNKPEENLEYVGYN   39 (51)
Q Consensus        25 Dp~~~e~dlG~I~l~   39 (51)
                      ||.. |+|.|.|.+.
T Consensus        32 DP~g-EHDFG~v~~~   45 (84)
T PF12599_consen   32 DPYG-EHDFGAVEFD   45 (84)
T ss_pred             CCcc-cccceEEEEC
Confidence            4443 8999999763


No 78 
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma. A single C2 domain is found in PKC alpha and gamma. The PKC family of serine/threonine kinases regulates apoptosis, proliferation, migration, motility, chemo-resistance, and differentiation.  There are 3 groups: group 1(alpha, betaI, beta II, gamma) which require phospholipids and calcium, group 2 (delta, epsilon, theta, eta) which do not require calcium for activation, and group 3 (xi, iota/lambda) which are atypical and can be activated in the absence of diacylglycerol and calcium. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transd
Probab=20.64  E-value=55  Score=19.01  Aligned_cols=27  Identities=26%  Similarity=0.220  Sum_probs=18.9

Q ss_pred             CcceEEEcCceeccceEEEEEEecCCCC
Q psy16618          1 MGSASIDLTTLELGRCTDLILTLEDPNK   28 (51)
Q Consensus         1 MGSA~l~Lt~LEl~r~~e~~L~L~Dp~~   28 (51)
                      +|.+.+.|+++. .+..+.-..|.++.+
T Consensus        98 iG~~~~~l~~l~-~~~~~~w~~L~~~~~  124 (131)
T cd04026          98 MGSLSFGVSELI-KMPVDGWYKLLNQEE  124 (131)
T ss_pred             eEEEEEeHHHhC-cCccCceEECcCccc
Confidence            477888888875 346666777777665


Done!