RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy16618
         (51 letters)



>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2
           domain and Transmembrane region Proteins (MCTP).  MCTPs
           are involved in Ca2+ signaling at the membrane.  MCTP is
           composed of a variable N-terminal sequence, three C2
           domains, two transmembrane regions (TMRs), and a short
           C-terminal sequence.  It is one of four protein classes
           that are anchored to membranes via a transmembrane
           region; the others being synaptotagmins, extended
           synaptotagmins, and ferlins. MCTPs are the only
           membrane-bound C2 domain proteins that contain two
           functional TMRs. MCTPs are unique in that they bind Ca2+
           but not phospholipids. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 121

 Score = 43.4 bits (103), Expect = 2e-07
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 1   MGSASIDLTTLELGRCTDLILTLEDPNKPEENLEYV 36
           MGSA +DL+TLEL + T++ L LEDPN  +E+L Y+
Sbjct: 79  MGSAFVDLSTLELNKPTEVKLKLEDPNS-DEDLGYI 113


>gnl|CDD|131470 TIGR02417, fruct_sucro_rep, D-fructose-responsive transcription
           factor.  Members of this family belong the lacI
           helix-turn-helix family (pfam00356) of DNA-binding
           transcriptional regulators. All members are from the
           proteobacteria. Characterized members act as positive
           and negative transcriptional regulators of fructose and
           sucrose transport and metabolism. Sucrose is a
           disaccharide composed of fructose and glucose;
           D-fructose-1-phosphate rather than an intact sucrose
           moiety has been shown to act as the inducer [Regulatory
           functions, DNA interactions].
          Length = 327

 Score = 25.1 bits (55), Expect = 1.5
 Identities = 7/28 (25%), Positives = 11/28 (39%)

Query: 15  RCTDLILTLEDPNKPEENLEYVGYNVEK 42
              +L L   D  KPE    Y+   ++ 
Sbjct: 298 HALELALAAIDGKKPEPGQRYIPRTLQI 325


>gnl|CDD|192012 pfam08355, EF_assoc_1, EF hand associated.  This region typically
          appears on the C-terminus of EF hands in GTP-binding
          proteins such as Arht/Rhot (may be involved in
          mitochondrial homeostasis and apoptosis). The EF hand
          associated region is found in yeast, vertebrates and
          plants.
          Length = 75

 Score = 23.4 bits (51), Expect = 4.7
 Identities = 8/19 (42%), Positives = 10/19 (52%)

Query: 22 TLEDPNKPEENLEYVGYNV 40
          TL D     E L Y+G+ V
Sbjct: 32 TLLDYKTTLEYLAYLGFPV 50


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.311    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0765    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 2,456,892
Number of extensions: 151008
Number of successful extensions: 102
Number of sequences better than 10.0: 1
Number of HSP's gapped: 102
Number of HSP's successfully gapped: 4
Length of query: 51
Length of database: 10,937,602
Length adjustment: 23
Effective length of query: 28
Effective length of database: 9,917,460
Effective search space: 277688880
Effective search space used: 277688880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 53 (24.1 bits)