Query         psy16623
Match_columns 93
No_of_seqs    118 out of 1016
Neff          6.8 
Searched_HMMs 46136
Date          Fri Aug 16 17:39:06 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16623.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16623hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00368 universal minicircle   99.0 3.8E-10 8.2E-15   76.1   2.8   43   43-89    105-147 (148)
  2 COG5082 AIR1 Arginine methyltr  98.9 7.7E-10 1.7E-14   78.1   2.4   49   40-88     59-114 (190)
  3 PTZ00368 universal minicircle   98.8 6.3E-09 1.4E-13   70.2   3.5   44   42-90     53-96  (148)
  4 PF00098 zf-CCHC:  Zinc knuckle  98.6 1.2E-08 2.5E-13   46.8   1.1   17   73-89      2-18  (18)
  5 COG5082 AIR1 Arginine methyltr  98.5 6.3E-08 1.4E-12   68.4   2.4   49    5-60     68-117 (190)
  6 KOG4400|consensus               98.5 6.5E-08 1.4E-12   70.6   2.5   42   42-92    144-185 (261)
  7 PF00098 zf-CCHC:  Zinc knuckle  98.4 7.8E-08 1.7E-12   44.0   1.1   17   43-59      2-18  (18)
  8 KOG4400|consensus               98.2 6.7E-07 1.5E-11   65.3   2.7   50   41-90     92-162 (261)
  9 PF13696 zf-CCHC_2:  Zinc knuck  97.8 8.4E-06 1.8E-10   42.4   1.4   21   72-92      9-29  (32)
 10 KOG0119|consensus               97.3 0.00018 3.9E-09   57.3   2.6   49   36-90    256-304 (554)
 11 PF13696 zf-CCHC_2:  Zinc knuck  97.1 0.00035 7.6E-09   36.3   1.7   21   41-61      8-28  (32)
 12 PF13917 zf-CCHC_3:  Zinc knuck  96.8 0.00069 1.5E-08   37.2   1.2   17   72-88      5-21  (42)
 13 smart00343 ZnF_C2HC zinc finge  96.6  0.0008 1.7E-08   32.8   0.8   17   73-89      1-17  (26)
 14 PF13917 zf-CCHC_3:  Zinc knuck  96.5  0.0014   3E-08   36.0   1.3   19   41-59      4-22  (42)
 15 smart00343 ZnF_C2HC zinc finge  96.1  0.0027 5.9E-08   30.9   0.9   18   43-60      1-18  (26)
 16 PF14392 zf-CCHC_4:  Zinc knuck  95.5    0.01 2.3E-07   33.1   2.0   31   25-58     18-48  (49)
 17 KOG0109|consensus               95.5  0.0052 1.1E-07   46.5   0.9   19   72-90    161-179 (346)
 18 PF14392 zf-CCHC_4:  Zinc knuck  94.8  0.0096 2.1E-07   33.2   0.4   18   72-89     32-49  (49)
 19 PF14787 zf-CCHC_5:  GAG-polypr  94.8   0.011 2.3E-07   31.4   0.5   18   72-89      3-20  (36)
 20 COG5222 Uncharacterized conser  94.7   0.017 3.7E-07   44.1   1.5   21   71-91    176-196 (427)
 21 PF15288 zf-CCHC_6:  Zinc knuck  94.4   0.027 5.8E-07   30.6   1.5   12   73-84      3-14  (40)
 22 PF15288 zf-CCHC_6:  Zinc knuck  93.3   0.045 9.7E-07   29.7   1.1   20   42-61      2-23  (40)
 23 KOG0109|consensus               93.1     0.1 2.2E-06   39.8   3.0   22   41-62    160-181 (346)
 24 PF14787 zf-CCHC_5:  GAG-polypr  91.2    0.13 2.8E-06   27.3   1.2   20   42-61      3-22  (36)
 25 COG5222 Uncharacterized conser  90.0    0.17 3.7E-06   38.8   1.4   21   41-61    176-196 (427)
 26 KOG3116|consensus               89.3   0.084 1.8E-06   36.5  -0.6   41   17-61      7-47  (177)
 27 KOG0107|consensus               89.2    0.59 1.3E-05   33.3   3.6   45   15-59     60-118 (195)
 28 KOG0314|consensus               86.0       1 2.2E-05   35.9   3.6   49   43-91    114-178 (448)
 29 KOG2044|consensus               85.4    0.65 1.4E-05   39.5   2.3   34   28-61    247-280 (931)
 30 KOG2044|consensus               68.8     2.2 4.8E-05   36.5   0.8   19   72-90    261-279 (931)
 31 KOG3794|consensus               68.7     2.6 5.7E-05   33.3   1.2   29   29-60    115-145 (453)
 32 PF12353 eIF3g:  Eukaryotic tra  68.0     2.5 5.5E-05   28.1   0.9   18   72-90    107-124 (128)
 33 KOG0119|consensus               64.1     3.5 7.6E-05   33.5   1.1   18   43-60    287-304 (554)
 34 PF09779 Ima1_N:  Ima1 N-termin  57.4     9.3  0.0002   25.3   2.1   35   43-87      2-36  (131)
 35 KOG2673|consensus               56.2     5.9 0.00013   31.9   1.1   21   42-62    129-149 (485)
 36 KOG0107|consensus               55.5     6.1 0.00013   28.2   1.0   19   72-90    101-119 (195)
 37 KOG3116|consensus               54.6     3.1 6.6E-05   28.9  -0.6   19   72-90     28-46  (177)
 38 PF12353 eIF3g:  Eukaryotic tra  50.7     7.3 0.00016   25.8   0.7   21   40-61    105-125 (128)
 39 KOG3794|consensus               49.5     8.1 0.00017   30.7   0.9   20   72-91    125-146 (453)
 40 KOG2673|consensus               49.1     8.8 0.00019   30.9   1.1   18   73-90    130-147 (485)
 41 KOG2560|consensus               41.2     6.7 0.00015   31.7  -0.7   18   72-89    113-130 (529)
 42 COG5179 TAF1 Transcription ini  38.9      19  0.0004   30.6   1.5   20   72-91    938-959 (968)
 43 COG1644 RPB10 DNA-directed RNA  38.0      15 0.00033   21.7   0.6   10   41-50      4-13  (63)
 44 COG2336 MazE Growth regulator   33.7      27 0.00058   21.7   1.3   20    3-22      6-25  (82)
 45 PHA00689 hypothetical protein   32.3      18 0.00039   20.7   0.3   17   37-53     13-29  (62)
 46 PF10890 DUF2741:  Protein of u  32.3      20 0.00044   21.7   0.6   26    1-26     18-43  (72)
 47 PLN00032 DNA-directed RNA poly  31.2      21 0.00045   21.6   0.5   10   41-50      4-13  (71)
 48 KOG0341|consensus               31.1      25 0.00055   28.4   1.1   19   72-90    571-589 (610)
 49 PF01194 RNA_pol_N:  RNA polyme  30.1      21 0.00045   20.9   0.3   10   41-50      4-13  (60)
 50 KOG3497|consensus               27.9      25 0.00055   20.8   0.5   10   41-50      4-13  (69)
 51 PRK04016 DNA-directed RNA poly  27.0      27 0.00058   20.6   0.5   10   41-50      4-13  (62)
 52 smart00647 IBR In Between Ring  24.3      42 0.00091   18.3   0.9   16   72-87     49-64  (64)
 53 KOG2560|consensus               21.2      25 0.00054   28.6  -0.6   19   42-60    113-131 (529)

No 1  
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=98.96  E-value=3.8e-10  Score=76.12  Aligned_cols=43  Identities=35%  Similarity=0.914  Sum_probs=20.7

Q ss_pred             ceeecCCCCccccccCCCCCCCCCCCcccccceeccccccccccCCC
Q psy16623         43 QCYNCFDFGHYQYSCPQKSSADARGDKVGIVCYKCNNYGHFARECAT   89 (93)
Q Consensus        43 ~C~~Cg~~GH~~~~C~~~~~~~~~~~~~~~~C~~Cg~~GH~ar~C~~   89 (93)
                      .||+|++.||++++||........    ...||+|++.|||++|||+
T Consensus       105 ~C~~Cg~~gH~~~~C~~~~~~~~~----~~~C~~Cg~~gH~~~dCp~  147 (148)
T PTZ00368        105 ACYNCGGEGHISRDCPNAGKRPGG----DKTCYNCGQTGHLSRDCPD  147 (148)
T ss_pred             hhcccCcCCcchhcCCCccccCCC----CCccccCCCcCcccccCCC
Confidence            355555555555555543100000    1456666666666666664


No 2  
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=98.90  E-value=7.7e-10  Score=78.09  Aligned_cols=49  Identities=31%  Similarity=0.707  Sum_probs=34.7

Q ss_pred             CCcceeecCCCCccccccC-----CCCCC-CCCC-CcccccceeccccccccccCC
Q psy16623         40 STIQCYNCFDFGHYQYSCP-----QKSSA-DARG-DKVGIVCYKCNNYGHFARECA   88 (93)
Q Consensus        40 ~~~~C~~Cg~~GH~~~~C~-----~~~~~-~~~~-~~~~~~C~~Cg~~GH~ar~C~   88 (93)
                      ....||+|++.||.++|||     .-... -++. -...+.||+||+.||++++|+
T Consensus        59 ~~~~C~nCg~~GH~~~DCP~~iC~~C~~~~H~s~~C~~~~~C~~Cg~~GH~~~dC~  114 (190)
T COG5082          59 ENPVCFNCGQNGHLRRDCPHSICYNCSWDGHRSNHCPKPKKCYNCGETGHLSRDCN  114 (190)
T ss_pred             cccccchhcccCcccccCChhHhhhcCCCCcccccCCcccccccccccCccccccC
Confidence            3567999999999999999     11000 0110 011278999999999999994


No 3  
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=98.77  E-value=6.3e-09  Score=70.17  Aligned_cols=44  Identities=36%  Similarity=0.915  Sum_probs=29.2

Q ss_pred             cceeecCCCCccccccCCCCCCCCCCCcccccceeccccccccccCCCC
Q psy16623         42 IQCYNCFDFGHYQYSCPQKSSADARGDKVGIVCYKCNNYGHFARECATE   90 (93)
Q Consensus        42 ~~C~~Cg~~GH~~~~C~~~~~~~~~~~~~~~~C~~Cg~~GH~ar~C~~~   90 (93)
                      ..||+|++.||++++||+......     ...||+|++.||++++||+.
T Consensus        53 ~~C~~Cg~~GH~~~~Cp~~~~~~~-----~~~C~~Cg~~GH~~~~C~~~   96 (148)
T PTZ00368         53 RSCYNCGKTGHLSRECPEAPPGSG-----PRSCYNCGQTGHISRECPNR   96 (148)
T ss_pred             cccCCCCCcCcCcccCCCcccCCC-----CcccCcCCCCCcccccCCCc
Confidence            357777777777777766432111     15688888888888888774


No 4  
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=98.63  E-value=1.2e-08  Score=46.79  Aligned_cols=17  Identities=41%  Similarity=1.189  Sum_probs=11.3

Q ss_pred             cceeccccccccccCCC
Q psy16623         73 VCYKCNNYGHFARECAT   89 (93)
Q Consensus        73 ~C~~Cg~~GH~ar~C~~   89 (93)
                      .||+|++.||++++||+
T Consensus         2 ~C~~C~~~GH~~~~Cp~   18 (18)
T PF00098_consen    2 KCFNCGEPGHIARDCPK   18 (18)
T ss_dssp             BCTTTSCSSSCGCTSSS
T ss_pred             cCcCCCCcCcccccCcc
Confidence            46667777777776664


No 5  
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=98.50  E-value=6.3e-08  Score=68.45  Aligned_cols=49  Identities=22%  Similarity=0.398  Sum_probs=28.7

Q ss_pred             CcceeeeechHHHHHHHHhcCceeeEEEeeeecCCCCcceeecCCCCcccccc-CCC
Q psy16623          5 LENSLWNNYVLGILLIIKQRNEGLLFVLRVEMSSTSTIQCYNCFDFGHYQYSC-PQK   60 (93)
Q Consensus         5 ~~~~~~~~~p~~~a~~i~~~g~~~~~~~~~~~~~~~~~~C~~Cg~~GH~~~~C-~~~   60 (93)
                      ..||+.-++|-.+...-...++..      . -=...+.||+||+.||++++| |..
T Consensus        68 ~~GH~~~DCP~~iC~~C~~~~H~s------~-~C~~~~~C~~Cg~~GH~~~dC~P~~  117 (190)
T COG5082          68 QNGHLRRDCPHSICYNCSWDGHRS------N-HCPKPKKCYNCGETGHLSRDCNPSK  117 (190)
T ss_pred             ccCcccccCChhHhhhcCCCCccc------c-cCCcccccccccccCccccccCccc
Confidence            346677777743333332233321      1 001126899999999999999 554


No 6  
>KOG4400|consensus
Probab=98.50  E-value=6.5e-08  Score=70.59  Aligned_cols=42  Identities=31%  Similarity=0.906  Sum_probs=36.4

Q ss_pred             cceeecCCCCccccccCCCCCCCCCCCcccccceeccccccccccCCCCCC
Q psy16623         42 IQCYNCFDFGHYQYSCPQKSSADARGDKVGIVCYKCNNYGHFARECATESP   92 (93)
Q Consensus        42 ~~C~~Cg~~GH~~~~C~~~~~~~~~~~~~~~~C~~Cg~~GH~ar~C~~~~~   92 (93)
                      +.||+|++.||++.+||.+.    .     ..||.|++.+|++++||...+
T Consensus       144 ~~Cy~Cg~~GH~s~~C~~~~----~-----~~c~~c~~~~h~~~~C~~~~~  185 (261)
T KOG4400|consen  144 AKCYSCGEQGHISDDCPENK----G-----GTCFRCGKVGHGSRDCPSKQK  185 (261)
T ss_pred             CccCCCCcCCcchhhCCCCC----C-----CccccCCCcceecccCCcccc
Confidence            56999999999999999761    1     689999999999999998754


No 7  
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=98.44  E-value=7.8e-08  Score=44.01  Aligned_cols=17  Identities=41%  Similarity=1.138  Sum_probs=16.0

Q ss_pred             ceeecCCCCccccccCC
Q psy16623         43 QCYNCFDFGHYQYSCPQ   59 (93)
Q Consensus        43 ~C~~Cg~~GH~~~~C~~   59 (93)
                      .||+|++.||++++||+
T Consensus         2 ~C~~C~~~GH~~~~Cp~   18 (18)
T PF00098_consen    2 KCFNCGEPGHIARDCPK   18 (18)
T ss_dssp             BCTTTSCSSSCGCTSSS
T ss_pred             cCcCCCCcCcccccCcc
Confidence            69999999999999985


No 8  
>KOG4400|consensus
Probab=98.24  E-value=6.7e-07  Score=65.28  Aligned_cols=50  Identities=28%  Similarity=0.773  Sum_probs=37.5

Q ss_pred             CcceeecCCCCccccccCCCCCCCC-------CC-----C--------cc-cccceeccccccccccCCCC
Q psy16623         41 TIQCYNCFDFGHYQYSCPQKSSADA-------RG-----D--------KV-GIVCYKCNNYGHFARECATE   90 (93)
Q Consensus        41 ~~~C~~Cg~~GH~~~~C~~~~~~~~-------~~-----~--------~~-~~~C~~Cg~~GH~ar~C~~~   90 (93)
                      ...||+|++.||+.++||.......       .+     .        .+ ...||+||+.||+.++||..
T Consensus        92 ~~~c~~C~~~gH~~~~c~~~~~~~~~~~~~~~c~~~gh~~~~~~~~~~~~~~~~Cy~Cg~~GH~s~~C~~~  162 (261)
T KOG4400|consen   92 AAACFNCGEGGHIERDCPEAGKEGSSETSCYSCGKTGHRGCPDADPVDGPKPAKCYSCGEQGHISDDCPEN  162 (261)
T ss_pred             chhhhhCCCCccchhhCCcccCcccccceeeccCCCccccCcccccccCCCCCccCCCCcCCcchhhCCCC
Confidence            5679999999999999997765430       00     0        00 14599999999999999964


No 9  
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=97.84  E-value=8.4e-06  Score=42.36  Aligned_cols=21  Identities=38%  Similarity=1.073  Sum_probs=16.0

Q ss_pred             ccceeccccccccccCCCCCC
Q psy16623         72 IVCYKCNNYGHFARECATESP   92 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~~~~   92 (93)
                      ..|+.|++.||+.+|||...|
T Consensus         9 Y~C~~C~~~GH~i~dCP~~~P   29 (32)
T PF13696_consen    9 YVCHRCGQKGHWIQDCPTNKP   29 (32)
T ss_pred             CEeecCCCCCccHhHCCCCCC
Confidence            668888888888888887654


No 10 
>KOG0119|consensus
Probab=97.28  E-value=0.00018  Score=57.32  Aligned_cols=49  Identities=31%  Similarity=0.741  Sum_probs=39.3

Q ss_pred             ecCCCCcceeecCCCCccccccCCCCCCCCCCCcccccceeccccccccccCCCC
Q psy16623         36 MSSTSTIQCYNCFDFGHYQYSCPQKSSADARGDKVGIVCYKCNNYGHFARECATE   90 (93)
Q Consensus        36 ~~~~~~~~C~~Cg~~GH~~~~C~~~~~~~~~~~~~~~~C~~Cg~~GH~ar~C~~~   90 (93)
                      +.......|..|+..||...+||.... ...     ..|+.|+..||+++||+..
T Consensus       256 ~r~~d~~~c~~cg~~~H~q~~cp~r~~-~~~-----n~c~~cg~~gH~~~dc~~~  304 (554)
T KOG0119|consen  256 LRDDDNRACRNCGSTGHKQYDCPGRIP-NTT-----NVCKICGPLGHISIDCKVN  304 (554)
T ss_pred             CCccccccccccCCCccccccCCcccc-ccc-----ccccccCCcccccccCCCc
Confidence            444445689999999999999998731 122     4799999999999999875


No 11 
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=97.09  E-value=0.00035  Score=36.27  Aligned_cols=21  Identities=29%  Similarity=0.695  Sum_probs=18.7

Q ss_pred             CcceeecCCCCccccccCCCC
Q psy16623         41 TIQCYNCFDFGHYQYSCPQKS   61 (93)
Q Consensus        41 ~~~C~~Cg~~GH~~~~C~~~~   61 (93)
                      ...|+.|++.||+..|||...
T Consensus         8 ~Y~C~~C~~~GH~i~dCP~~~   28 (32)
T PF13696_consen    8 GYVCHRCGQKGHWIQDCPTNK   28 (32)
T ss_pred             CCEeecCCCCCccHhHCCCCC
Confidence            467999999999999999854


No 12 
>PF13917 zf-CCHC_3:  Zinc knuckle
Probab=96.76  E-value=0.00069  Score=37.20  Aligned_cols=17  Identities=41%  Similarity=1.077  Sum_probs=9.0

Q ss_pred             ccceeccccccccccCC
Q psy16623         72 IVCYKCNNYGHFARECA   88 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~   88 (93)
                      ..|.+|++.||++.+|+
T Consensus         5 ~~CqkC~~~GH~tyeC~   21 (42)
T PF13917_consen    5 VRCQKCGQKGHWTYECP   21 (42)
T ss_pred             CcCcccCCCCcchhhCC
Confidence            34555555555555555


No 13 
>smart00343 ZnF_C2HC zinc finger.
Probab=96.62  E-value=0.0008  Score=32.78  Aligned_cols=17  Identities=47%  Similarity=1.247  Sum_probs=14.4

Q ss_pred             cceeccccccccccCCC
Q psy16623         73 VCYKCNNYGHFARECAT   89 (93)
Q Consensus        73 ~C~~Cg~~GH~ar~C~~   89 (93)
                      .|++|++.||++++||+
T Consensus         1 ~C~~CG~~GH~~~~C~~   17 (26)
T smart00343        1 KCYNCGKEGHIARDCPK   17 (26)
T ss_pred             CCccCCCCCcchhhCCc
Confidence            38899999999999984


No 14 
>PF13917 zf-CCHC_3:  Zinc knuckle
Probab=96.51  E-value=0.0014  Score=36.00  Aligned_cols=19  Identities=37%  Similarity=1.111  Sum_probs=17.2

Q ss_pred             CcceeecCCCCccccccCC
Q psy16623         41 TIQCYNCFDFGHYQYSCPQ   59 (93)
Q Consensus        41 ~~~C~~Cg~~GH~~~~C~~   59 (93)
                      ...|.+|++.||+..+|++
T Consensus         4 ~~~CqkC~~~GH~tyeC~~   22 (42)
T PF13917_consen    4 RVRCQKCGQKGHWTYECPN   22 (42)
T ss_pred             CCcCcccCCCCcchhhCCC
Confidence            4579999999999999995


No 15 
>smart00343 ZnF_C2HC zinc finger.
Probab=96.08  E-value=0.0027  Score=30.85  Aligned_cols=18  Identities=44%  Similarity=1.069  Sum_probs=16.0

Q ss_pred             ceeecCCCCccccccCCC
Q psy16623         43 QCYNCFDFGHYQYSCPQK   60 (93)
Q Consensus        43 ~C~~Cg~~GH~~~~C~~~   60 (93)
                      .||+|++.||++++||..
T Consensus         1 ~C~~CG~~GH~~~~C~~~   18 (26)
T smart00343        1 KCYNCGKEGHIARDCPKX   18 (26)
T ss_pred             CCccCCCCCcchhhCCcc
Confidence            499999999999999844


No 16 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=95.55  E-value=0.01  Score=33.07  Aligned_cols=31  Identities=26%  Similarity=0.603  Sum_probs=20.7

Q ss_pred             CceeeEEEeeeecCCCCcceeecCCCCccccccC
Q psy16623         25 NEGLLFVLRVEMSSTSTIQCYNCFDFGHYQYSCP   58 (93)
Q Consensus        25 g~~~~~~~~~~~~~~~~~~C~~Cg~~GH~~~~C~   58 (93)
                      |+..+.....+-.   +..|++|+..||...+||
T Consensus        18 g~~~~~~v~YE~l---p~~C~~C~~~gH~~~~C~   48 (49)
T PF14392_consen   18 GESFWVKVKYERL---PRFCFHCGRIGHSDKECP   48 (49)
T ss_pred             CcEEEEEEEECCc---ChhhcCCCCcCcCHhHcC
Confidence            4443444444433   347999999999999987


No 17 
>KOG0109|consensus
Probab=95.54  E-value=0.0052  Score=46.53  Aligned_cols=19  Identities=37%  Similarity=1.139  Sum_probs=17.5

Q ss_pred             ccceeccccccccccCCCC
Q psy16623         72 IVCYKCNNYGHFARECATE   90 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~~   90 (93)
                      ..||+||++|||+++||..
T Consensus       161 ~~cyrcGkeghwskEcP~~  179 (346)
T KOG0109|consen  161 SGCYRCGKEGHWSKECPVD  179 (346)
T ss_pred             HHheeccccccccccCCcc
Confidence            6799999999999999975


No 18 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=94.82  E-value=0.0096  Score=33.22  Aligned_cols=18  Identities=33%  Similarity=1.001  Sum_probs=16.5

Q ss_pred             ccceeccccccccccCCC
Q psy16623         72 IVCYKCNNYGHFARECAT   89 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~   89 (93)
                      ..|+.||..||..++||.
T Consensus        32 ~~C~~C~~~gH~~~~C~k   49 (49)
T PF14392_consen   32 RFCFHCGRIGHSDKECPK   49 (49)
T ss_pred             hhhcCCCCcCcCHhHcCC
Confidence            679999999999999984


No 19 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=94.81  E-value=0.011  Score=31.43  Aligned_cols=18  Identities=33%  Similarity=0.735  Sum_probs=11.4

Q ss_pred             ccceeccccccccccCCC
Q psy16623         72 IVCYKCNNYGHFARECAT   89 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~   89 (93)
                      ..|++|++..|+|++|..
T Consensus         3 ~~CprC~kg~Hwa~~C~s   20 (36)
T PF14787_consen    3 GLCPRCGKGFHWASECRS   20 (36)
T ss_dssp             -C-TTTSSSCS-TTT---
T ss_pred             ccCcccCCCcchhhhhhh
Confidence            479999999999999954


No 20 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.66  E-value=0.017  Score=44.13  Aligned_cols=21  Identities=43%  Similarity=1.189  Sum_probs=18.5

Q ss_pred             cccceeccccccccccCCCCC
Q psy16623         71 GIVCYKCNNYGHFARECATES   91 (93)
Q Consensus        71 ~~~C~~Cg~~GH~ar~C~~~~   91 (93)
                      +..||+||+.|||..+||.+.
T Consensus       176 gY~CyRCGqkgHwIqnCpTN~  196 (427)
T COG5222         176 GYVCYRCGQKGHWIQNCPTNQ  196 (427)
T ss_pred             ceeEEecCCCCchhhcCCCCC
Confidence            478999999999999998764


No 21 
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=94.42  E-value=0.027  Score=30.60  Aligned_cols=12  Identities=33%  Similarity=1.077  Sum_probs=6.0

Q ss_pred             cceecccccccc
Q psy16623         73 VCYKCNNYGHFA   84 (93)
Q Consensus        73 ~C~~Cg~~GH~a   84 (93)
                      .|.+||..||.+
T Consensus         3 kC~~CG~~GH~~   14 (40)
T PF15288_consen    3 KCKNCGAFGHMR   14 (40)
T ss_pred             cccccccccccc
Confidence            355555555554


No 22 
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=93.31  E-value=0.045  Score=29.72  Aligned_cols=20  Identities=40%  Similarity=0.974  Sum_probs=16.8

Q ss_pred             cceeecCCCCccc--cccCCCC
Q psy16623         42 IQCYNCFDFGHYQ--YSCPQKS   61 (93)
Q Consensus        42 ~~C~~Cg~~GH~~--~~C~~~~   61 (93)
                      +.|.+||.+||++  +.||-..
T Consensus         2 ~kC~~CG~~GH~~t~k~CP~~~   23 (40)
T PF15288_consen    2 VKCKNCGAFGHMRTNKRCPMYC   23 (40)
T ss_pred             ccccccccccccccCccCCCCC
Confidence            4799999999998  5788664


No 23 
>KOG0109|consensus
Probab=93.08  E-value=0.1  Score=39.76  Aligned_cols=22  Identities=32%  Similarity=0.819  Sum_probs=19.2

Q ss_pred             CcceeecCCCCccccccCCCCC
Q psy16623         41 TIQCYNCFDFGHYQYSCPQKSS   62 (93)
Q Consensus        41 ~~~C~~Cg~~GH~~~~C~~~~~   62 (93)
                      ...||+||+.||++.+||....
T Consensus       160 q~~cyrcGkeghwskEcP~~~~  181 (346)
T KOG0109|consen  160 QSGCYRCGKEGHWSKECPVDRT  181 (346)
T ss_pred             HHHheeccccccccccCCccCC
Confidence            4569999999999999998753


No 24 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=91.23  E-value=0.13  Score=27.29  Aligned_cols=20  Identities=25%  Similarity=0.379  Sum_probs=13.0

Q ss_pred             cceeecCCCCccccccCCCC
Q psy16623         42 IQCYNCFDFGHYQYSCPQKS   61 (93)
Q Consensus        42 ~~C~~Cg~~GH~~~~C~~~~   61 (93)
                      ..|++|++-.|++++|....
T Consensus         3 ~~CprC~kg~Hwa~~C~sk~   22 (36)
T PF14787_consen    3 GLCPRCGKGFHWASECRSKT   22 (36)
T ss_dssp             -C-TTTSSSCS-TTT---TC
T ss_pred             ccCcccCCCcchhhhhhhhh
Confidence            46999999999999999876


No 25 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=89.96  E-value=0.17  Score=38.84  Aligned_cols=21  Identities=33%  Similarity=0.861  Sum_probs=18.6

Q ss_pred             CcceeecCCCCccccccCCCC
Q psy16623         41 TIQCYNCFDFGHYQYSCPQKS   61 (93)
Q Consensus        41 ~~~C~~Cg~~GH~~~~C~~~~   61 (93)
                      +..||+||+.||+..+||.+.
T Consensus       176 gY~CyRCGqkgHwIqnCpTN~  196 (427)
T COG5222         176 GYVCYRCGQKGHWIQNCPTNQ  196 (427)
T ss_pred             ceeEEecCCCCchhhcCCCCC
Confidence            456999999999999999875


No 26 
>KOG3116|consensus
Probab=89.34  E-value=0.084  Score=36.54  Aligned_cols=41  Identities=24%  Similarity=0.578  Sum_probs=27.3

Q ss_pred             HHHHHHhcCceeeEEEeeeecCCCCcceeecCCCCccccccCCCC
Q psy16623         17 ILLIIKQRNEGLLFVLRVEMSSTSTIQCYNCFDFGHYQYSCPQKS   61 (93)
Q Consensus        17 ~a~~i~~~g~~~~~~~~~~~~~~~~~~C~~Cg~~GH~~~~C~~~~   61 (93)
                      +|.+|.++..-......+    ...++|.+|.++||+.++|.+..
T Consensus         7 ~a~rL~~rk~~~~qA~a~----~~~~rCQKClq~GHWtYECk~kR   47 (177)
T KOG3116|consen    7 EAVRLGERKDKTMQASAV----GSSARCQKCLQAGHWTYECKNKR   47 (177)
T ss_pred             HHHHHHHhhhhhhhhhhc----ccchhHHHHHhhccceeeecCce
Confidence            367777766532111111    12358999999999999998764


No 27 
>KOG0107|consensus
Probab=89.24  E-value=0.59  Score=33.26  Aligned_cols=45  Identities=22%  Similarity=0.296  Sum_probs=32.0

Q ss_pred             HHHHHHHHhcCceeeEEEeeeecCCCCc--------------ceeecCCCCccccccCC
Q psy16623         15 LGILLIIKQRNEGLLFVLRVEMSSTSTI--------------QCYNCFDFGHYQYSCPQ   59 (93)
Q Consensus        15 ~~~a~~i~~~g~~~~~~~~~~~~~~~~~--------------~C~~Cg~~GH~~~~C~~   59 (93)
                      .++|...++-..|.-+.++||++...+.              -|+.|++.||+.++|.+
T Consensus        60 A~DAvr~LDG~~~cG~r~rVE~S~G~~r~~r~gg~~~~~g~~~~~r~G~rg~~~r~~~~  118 (195)
T KOG0107|consen   60 AEDAVRYLDGKDICGSRIRVELSTGRPRGSRRGGSRPPRGRGFCYRCGERGHIGRNCKD  118 (195)
T ss_pred             HHHHHhhcCCccccCceEEEEeecCCccccccCCCCCcccccccccCCCcccccccccc
Confidence            3567777877777777788888764322              27778888888877766


No 28 
>KOG0314|consensus
Probab=85.98  E-value=1  Score=35.95  Aligned_cols=49  Identities=18%  Similarity=0.170  Sum_probs=32.5

Q ss_pred             ceeecCCCCccccccCCCCCCCC-----C----------C-CcccccceeccccccccccCCCCC
Q psy16623         43 QCYNCFDFGHYQYSCPQKSSADA-----R----------G-DKVGIVCYKCNNYGHFARECATES   91 (93)
Q Consensus        43 ~C~~Cg~~GH~~~~C~~~~~~~~-----~----------~-~~~~~~C~~Cg~~GH~ar~C~~~~   91 (93)
                      .++.++..||..+.+........     .          + -..+..|++|+..||+.+.||...
T Consensus       114 ~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~iq~~~~~g~Pppsy~c~rc~~~g~wikacptv~  178 (448)
T KOG0314|consen  114 MNGRMGGRGFGMRRQTPPPGYVCHRCNSPGHFIQHCSTNGSPPPSYKCVKCPTPGPWIKACPTVS  178 (448)
T ss_pred             hccccccCCcccccCCCcccceeeecccCccccccccccCCCCCCcceecCCCCCccceeccccC
Confidence            47777777777777643321100     0          0 012478999999999999999765


No 29 
>KOG2044|consensus
Probab=85.39  E-value=0.65  Score=39.54  Aligned_cols=34  Identities=26%  Similarity=0.492  Sum_probs=28.2

Q ss_pred             eeEEEeeeecCCCCcceeecCCCCccccccCCCC
Q psy16623         28 LLFVLRVEMSSTSTIQCYNCFDFGHYQYSCPQKS   61 (93)
Q Consensus        28 ~~~~~~~~~~~~~~~~C~~Cg~~GH~~~~C~~~~   61 (93)
                      .++..|-++.+..+..||.|+++||.+.+|....
T Consensus       247 hF~IlRE~~~P~~~~~C~~cgq~gh~~~dc~g~~  280 (931)
T KOG2044|consen  247 HFSILREEFFPNKPRRCFLCGQTGHEAKDCEGKP  280 (931)
T ss_pred             ceEEeeeeecCCCcccchhhcccCCcHhhcCCcC
Confidence            3677777777777788999999999999998763


No 30 
>KOG2044|consensus
Probab=68.77  E-value=2.2  Score=36.51  Aligned_cols=19  Identities=32%  Similarity=0.857  Sum_probs=17.1

Q ss_pred             ccceeccccccccccCCCC
Q psy16623         72 IVCYKCNNYGHFARECATE   90 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~~   90 (93)
                      ..|+.||+.||.++||...
T Consensus       261 ~~C~~cgq~gh~~~dc~g~  279 (931)
T KOG2044|consen  261 RRCFLCGQTGHEAKDCEGK  279 (931)
T ss_pred             ccchhhcccCCcHhhcCCc
Confidence            6799999999999999764


No 31 
>KOG3794|consensus
Probab=68.69  E-value=2.6  Score=33.33  Aligned_cols=29  Identities=21%  Similarity=0.654  Sum_probs=19.6

Q ss_pred             eEEEeeeecCCCCcceeecCCCCccc--cccCCC
Q psy16623         29 LFVLRVEMSSTSTIQCYNCFDFGHYQ--YSCPQK   60 (93)
Q Consensus        29 ~~~~~~~~~~~~~~~C~~Cg~~GH~~--~~C~~~   60 (93)
                      |.-..+++   +++.|++|...||+.  ++||-.
T Consensus       115 dqPFGiqV---RNVrC~kChkwGH~n~DreCplf  145 (453)
T KOG3794|consen  115 DQPFGIQV---RNVRCLKCHKWGHINTDRECPLF  145 (453)
T ss_pred             ccccceEe---eeeeEEeecccccccCCccCcch
Confidence            44444444   456899999999988  578744


No 32 
>PF12353 eIF3g:  Eukaryotic translation initiation factor 3 subunit G ;  InterPro: IPR024675 At least eleven different protein factors are involved in initiation of protein synthesis in eukaryotes. Binding of initiator tRNA and mRNA to the 40S subunit requires the presence of the translation initiation factors eIF-2 and eIF-3, with eIF-3 being particularly important for 80S ribosome dissociation and mRNA binding []. eIF-3 is the most complex translation inititation factor, consisting of about 13 putative subunits and having a molecular weight of between 550 - 700 kDa in mammalian cells. Subunits are designated eIF-3a - eIF-3m; the large number of subunits means that the interactions between the individual subunits that make up the eIF-3 complex are complex and varied. Subunit G is required for eIF3 integrity.   This entry represents a domain of approximately 130 amino acids in length found at the N terminus of eukaryotic translation initiation factor 3 subunit G. This domain is commonly found in association with the RNA recognition domain PF00076 from PFAM. 
Probab=68.02  E-value=2.5  Score=28.05  Aligned_cols=18  Identities=22%  Similarity=0.735  Sum_probs=15.5

Q ss_pred             ccceeccccccccccCCCC
Q psy16623         72 IVCYKCNNYGHFARECATE   90 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~~   90 (93)
                      ..|+.|+ ..||...||-.
T Consensus       107 v~CR~Ck-GdH~T~~CPyK  124 (128)
T PF12353_consen  107 VKCRICK-GDHWTSKCPYK  124 (128)
T ss_pred             EEeCCCC-CCcccccCCcc
Confidence            6799997 78999999964


No 33 
>KOG0119|consensus
Probab=64.10  E-value=3.5  Score=33.52  Aligned_cols=18  Identities=28%  Similarity=0.645  Sum_probs=17.1

Q ss_pred             ceeecCCCCccccccCCC
Q psy16623         43 QCYNCFDFGHYQYSCPQK   60 (93)
Q Consensus        43 ~C~~Cg~~GH~~~~C~~~   60 (93)
                      .|+.|+..||+++||+..
T Consensus       287 ~c~~cg~~gH~~~dc~~~  304 (554)
T KOG0119|consen  287 VCKICGPLGHISIDCKVN  304 (554)
T ss_pred             cccccCCcccccccCCCc
Confidence            799999999999999877


No 34 
>PF09779 Ima1_N:  Ima1 N-terminal domain;  InterPro: IPR018617  Members of this family of uncharacterised novel proteins have no known function. 
Probab=57.43  E-value=9.3  Score=25.30  Aligned_cols=35  Identities=20%  Similarity=0.564  Sum_probs=25.6

Q ss_pred             ceeecCCCCccccccCCCCCCCCCCCcccccceeccccccccccC
Q psy16623         43 QCYNCFDFGHYQYSCPQKSSADARGDKVGIVCYKCNNYGHFAREC   87 (93)
Q Consensus        43 ~C~~Cg~~GH~~~~C~~~~~~~~~~~~~~~~C~~Cg~~GH~ar~C   87 (93)
                      .||-|++...+..+.....          -.|-.|....+|..+=
T Consensus         2 ~C~fC~~~s~~~~~~~~~~----------w~C~~C~q~N~f~e~G   36 (131)
T PF09779_consen    2 NCWFCGQNSKVPYDNRNSN----------WTCPHCEQYNGFDEDG   36 (131)
T ss_pred             eeccCCCCCCCCCCCCCCe----------eECCCCCCccCccccC
Confidence            6999999887776644432          5788888888877653


No 35 
>KOG2673|consensus
Probab=56.19  E-value=5.9  Score=31.88  Aligned_cols=21  Identities=29%  Similarity=0.602  Sum_probs=18.3

Q ss_pred             cceeecCCCCccccccCCCCC
Q psy16623         42 IQCYNCFDFGHYQYSCPQKSS   62 (93)
Q Consensus        42 ~~C~~Cg~~GH~~~~C~~~~~   62 (93)
                      ..||+|+..-|-.+|||.+..
T Consensus       129 ~~CFNC~g~~hsLrdC~rp~d  149 (485)
T KOG2673|consen  129 DPCFNCGGTPHSLRDCPRPFD  149 (485)
T ss_pred             ccccccCCCCCccccCCCccc
Confidence            348999999999999998863


No 36 
>KOG0107|consensus
Probab=55.51  E-value=6.1  Score=28.19  Aligned_cols=19  Identities=37%  Similarity=1.045  Sum_probs=16.5

Q ss_pred             ccceeccccccccccCCCC
Q psy16623         72 IVCYKCNNYGHFARECATE   90 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~~   90 (93)
                      ..|++||+.||+.+.|.+.
T Consensus       101 ~~~~r~G~rg~~~r~~~~s  119 (195)
T KOG0107|consen  101 GFCYRCGERGHIGRNCKDS  119 (195)
T ss_pred             cccccCCCccccccccccc
Confidence            3499999999999999873


No 37 
>KOG3116|consensus
Probab=54.58  E-value=3.1  Score=28.94  Aligned_cols=19  Identities=37%  Similarity=0.852  Sum_probs=17.4

Q ss_pred             ccceeccccccccccCCCC
Q psy16623         72 IVCYKCNNYGHFARECATE   90 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~~   90 (93)
                      ..|-+|-+.|||.-+|.+.
T Consensus        28 ~rCQKClq~GHWtYECk~k   46 (177)
T KOG3116|consen   28 ARCQKCLQAGHWTYECKNK   46 (177)
T ss_pred             hhHHHHHhhccceeeecCc
Confidence            7899999999999999764


No 38 
>PF12353 eIF3g:  Eukaryotic translation initiation factor 3 subunit G ;  InterPro: IPR024675 At least eleven different protein factors are involved in initiation of protein synthesis in eukaryotes. Binding of initiator tRNA and mRNA to the 40S subunit requires the presence of the translation initiation factors eIF-2 and eIF-3, with eIF-3 being particularly important for 80S ribosome dissociation and mRNA binding []. eIF-3 is the most complex translation inititation factor, consisting of about 13 putative subunits and having a molecular weight of between 550 - 700 kDa in mammalian cells. Subunits are designated eIF-3a - eIF-3m; the large number of subunits means that the interactions between the individual subunits that make up the eIF-3 complex are complex and varied. Subunit G is required for eIF3 integrity.   This entry represents a domain of approximately 130 amino acids in length found at the N terminus of eukaryotic translation initiation factor 3 subunit G. This domain is commonly found in association with the RNA recognition domain PF00076 from PFAM. 
Probab=50.67  E-value=7.3  Score=25.84  Aligned_cols=21  Identities=33%  Similarity=0.735  Sum_probs=17.7

Q ss_pred             CCcceeecCCCCccccccCCCC
Q psy16623         40 STIQCYNCFDFGHYQYSCPQKS   61 (93)
Q Consensus        40 ~~~~C~~Cg~~GH~~~~C~~~~   61 (93)
                      ..+.|..|+ -.|+...||-..
T Consensus       105 ~~v~CR~Ck-GdH~T~~CPyKd  125 (128)
T PF12353_consen  105 SKVKCRICK-GDHWTSKCPYKD  125 (128)
T ss_pred             ceEEeCCCC-CCcccccCCccc
Confidence            356799996 999999999764


No 39 
>KOG3794|consensus
Probab=49.50  E-value=8.1  Score=30.68  Aligned_cols=20  Identities=40%  Similarity=1.032  Sum_probs=16.6

Q ss_pred             ccceecccccccc--ccCCCCC
Q psy16623         72 IVCYKCNNYGHFA--RECATES   91 (93)
Q Consensus        72 ~~C~~Cg~~GH~a--r~C~~~~   91 (93)
                      ..|.+|+..||+.  ++||-.+
T Consensus       125 VrC~kChkwGH~n~DreCplf~  146 (453)
T KOG3794|consen  125 VRCLKCHKWGHINTDRECPLFG  146 (453)
T ss_pred             eeEEeecccccccCCccCcchh
Confidence            7899999999998  4688543


No 40 
>KOG2673|consensus
Probab=49.08  E-value=8.8  Score=30.92  Aligned_cols=18  Identities=28%  Similarity=0.831  Sum_probs=16.1

Q ss_pred             cceeccccccccccCCCC
Q psy16623         73 VCYKCNNYGHFARECATE   90 (93)
Q Consensus        73 ~C~~Cg~~GH~ar~C~~~   90 (93)
                      .||+|+..-|-.+|||..
T Consensus       130 ~CFNC~g~~hsLrdC~rp  147 (485)
T KOG2673|consen  130 PCFNCGGTPHSLRDCPRP  147 (485)
T ss_pred             cccccCCCCCccccCCCc
Confidence            399999999999999875


No 41 
>KOG2560|consensus
Probab=41.18  E-value=6.7  Score=31.72  Aligned_cols=18  Identities=22%  Similarity=0.637  Sum_probs=15.6

Q ss_pred             ccceeccccccccccCCC
Q psy16623         72 IVCYKCNNYGHFARECAT   89 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~   89 (93)
                      ..|-+||..+|-.++|-.
T Consensus       113 GACeNCGAmtHk~KDCmE  130 (529)
T KOG2560|consen  113 GACENCGAMTHKVKDCME  130 (529)
T ss_pred             hhhhhhhhhhcchHHHhh
Confidence            459999999999999943


No 42 
>COG5179 TAF1 Transcription initiation factor TFIID, subunit TAF1 [Transcription]
Probab=38.86  E-value=19  Score=30.64  Aligned_cols=20  Identities=30%  Similarity=0.735  Sum_probs=15.7

Q ss_pred             ccceecccccccc--ccCCCCC
Q psy16623         72 IVCYKCNNYGHFA--RECATES   91 (93)
Q Consensus        72 ~~C~~Cg~~GH~a--r~C~~~~   91 (93)
                      .+|-+||+.||+.  +.||..+
T Consensus       938 r~C~nCGQvGHmkTNK~CP~f~  959 (968)
T COG5179         938 RTCGNCGQVGHMKTNKACPKFS  959 (968)
T ss_pred             eecccccccccccccccCcccc
Confidence            6799999999986  4588755


No 43 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=37.98  E-value=15  Score=21.70  Aligned_cols=10  Identities=20%  Similarity=0.969  Sum_probs=7.0

Q ss_pred             CcceeecCCC
Q psy16623         41 TIQCYNCFDF   50 (93)
Q Consensus        41 ~~~C~~Cg~~   50 (93)
                      ++.||.||+.
T Consensus         4 PiRCFsCGkv   13 (63)
T COG1644           4 PVRCFSCGKV   13 (63)
T ss_pred             ceEeecCCCC
Confidence            4578888764


No 44 
>COG2336 MazE Growth regulator [Signal transduction mechanisms]
Probab=33.75  E-value=27  Score=21.71  Aligned_cols=20  Identities=15%  Similarity=0.089  Sum_probs=17.8

Q ss_pred             CcCcceeeeechHHHHHHHH
Q psy16623          3 QRLENSLWNNYVLGILLIIK   22 (93)
Q Consensus         3 ~~~~~~~~~~~p~~~a~~i~   22 (93)
                      ||.+||+-+.+|.+++..|-
T Consensus         6 ~KWGNS~avrIP~~l~kql~   25 (82)
T COG2336           6 KKWGNSAAVRIPAALLKQLN   25 (82)
T ss_pred             hhhCCcceeeccHHHHHHhC
Confidence            68899999999999988775


No 45 
>PHA00689 hypothetical protein
Probab=32.34  E-value=18  Score=20.66  Aligned_cols=17  Identities=18%  Similarity=0.417  Sum_probs=12.4

Q ss_pred             cCCCCcceeecCCCCcc
Q psy16623         37 SSTSTIQCYNCFDFGHY   53 (93)
Q Consensus        37 ~~~~~~~C~~Cg~~GH~   53 (93)
                      ++++...|.+|++.|-.
T Consensus        13 qepravtckrcgktglr   29 (62)
T PHA00689         13 QEPRAVTCKRCGKTGLR   29 (62)
T ss_pred             cCcceeehhhccccCce
Confidence            34566789999988754


No 46 
>PF10890 DUF2741:  Protein of unknown function (DUF2741);  InterPro: IPR020101 This entry represents subunit 8 of the Cytochrome b-c1 complex. The ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone. In plants, the b-c1 complex contains 10 subunits: 3 respiratory subunits, 2 core proteins and 5 low-molecular weight proteins.
Probab=32.31  E-value=20  Score=21.71  Aligned_cols=26  Identities=15%  Similarity=0.251  Sum_probs=22.5

Q ss_pred             CCCcCcceeeeechHHHHHHHHhcCc
Q psy16623          1 MHQRLENSLWNNYVLGILLIIKQRNE   26 (93)
Q Consensus         1 ~~~~~~~~~~~~~p~~~a~~i~~~g~   26 (93)
                      +||-.+.-+|-++|-.++.++.+...
T Consensus        18 ~qq~Vm~GLwKDlp~ki~hk~~enwv   43 (72)
T PF10890_consen   18 FQQKVMPGLWKDLPKKIHHKFSENWV   43 (72)
T ss_pred             hhhhhhhhhhhhcHHHHHHHHhhcce
Confidence            57888889999999999999987655


No 47 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=31.17  E-value=21  Score=21.64  Aligned_cols=10  Identities=20%  Similarity=0.956  Sum_probs=7.1

Q ss_pred             CcceeecCCC
Q psy16623         41 TIQCYNCFDF   50 (93)
Q Consensus        41 ~~~C~~Cg~~   50 (93)
                      ++.||.||+.
T Consensus         4 PVRCFTCGkv   13 (71)
T PLN00032          4 PVRCFTCGKV   13 (71)
T ss_pred             ceeecCCCCC
Confidence            4578888864


No 48 
>KOG0341|consensus
Probab=31.13  E-value=25  Score=28.43  Aligned_cols=19  Identities=26%  Similarity=0.602  Sum_probs=16.6

Q ss_pred             ccceeccccccccccCCCC
Q psy16623         72 IVCYKCNNYGHFARECATE   90 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C~~~   90 (93)
                      ..|-.||.-||-..|||+-
T Consensus       571 kGCayCgGLGHRItdCPKl  589 (610)
T KOG0341|consen  571 KGCAYCGGLGHRITDCPKL  589 (610)
T ss_pred             cccccccCCCcccccCchh
Confidence            6799999999999999874


No 49 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=30.07  E-value=21  Score=20.90  Aligned_cols=10  Identities=20%  Similarity=0.956  Sum_probs=5.8

Q ss_pred             CcceeecCCC
Q psy16623         41 TIQCYNCFDF   50 (93)
Q Consensus        41 ~~~C~~Cg~~   50 (93)
                      ++.||.||+.
T Consensus         4 PVRCFTCGkv   13 (60)
T PF01194_consen    4 PVRCFTCGKV   13 (60)
T ss_dssp             SSS-STTTSB
T ss_pred             ceecCCCCCC
Confidence            4567777764


No 50 
>KOG3497|consensus
Probab=27.88  E-value=25  Score=20.82  Aligned_cols=10  Identities=30%  Similarity=0.986  Sum_probs=6.7

Q ss_pred             CcceeecCCC
Q psy16623         41 TIQCYNCFDF   50 (93)
Q Consensus        41 ~~~C~~Cg~~   50 (93)
                      ++.||.||+.
T Consensus         4 PiRCFtCGKv   13 (69)
T KOG3497|consen    4 PIRCFTCGKV   13 (69)
T ss_pred             eeEeeecccc
Confidence            4568888764


No 51 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=26.99  E-value=27  Score=20.58  Aligned_cols=10  Identities=20%  Similarity=0.956  Sum_probs=6.8

Q ss_pred             CcceeecCCC
Q psy16623         41 TIQCYNCFDF   50 (93)
Q Consensus        41 ~~~C~~Cg~~   50 (93)
                      ++.||.||+.
T Consensus         4 PvRCFTCGkv   13 (62)
T PRK04016          4 PVRCFTCGKV   13 (62)
T ss_pred             CeEecCCCCC
Confidence            4568888764


No 52 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=24.27  E-value=42  Score=18.33  Aligned_cols=16  Identities=25%  Similarity=0.704  Sum_probs=12.4

Q ss_pred             ccceeccccccccccC
Q psy16623         72 IVCYKCNNYGHFAREC   87 (93)
Q Consensus        72 ~~C~~Cg~~GH~ar~C   87 (93)
                      ..|++|++..|.-..|
T Consensus        49 ~fC~~C~~~~H~~~~C   64 (64)
T smart00647       49 SFCFRCKVPWHSPVSC   64 (64)
T ss_pred             eECCCCCCcCCCCCCC
Confidence            5799999998876544


No 53 
>KOG2560|consensus
Probab=21.20  E-value=25  Score=28.59  Aligned_cols=19  Identities=26%  Similarity=0.504  Sum_probs=16.5

Q ss_pred             cceeecCCCCccccccCCC
Q psy16623         42 IQCYNCFDFGHYQYSCPQK   60 (93)
Q Consensus        42 ~~C~~Cg~~GH~~~~C~~~   60 (93)
                      .-|.+||..+|...+|-..
T Consensus       113 GACeNCGAmtHk~KDCmER  131 (529)
T KOG2560|consen  113 GACENCGAMTHKVKDCMER  131 (529)
T ss_pred             hhhhhhhhhhcchHHHhhc
Confidence            4699999999999999544


Done!