Query         psy16646
Match_columns 159
No_of_seqs    149 out of 2111
Neff          10.5
Searched_HMMs 46136
Date          Fri Aug 16 18:23:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16646.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16646hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 2.9E-28 6.3E-33  166.0   4.4  119   29-150   127-247 (279)
  2 KOG2462|consensus               99.9 1.6E-26 3.4E-31  157.5   4.7  131    5-140   127-265 (279)
  3 KOG3576|consensus               99.8 1.1E-19 2.5E-24  119.0   2.6  122   23-146   108-240 (267)
  4 KOG3608|consensus               99.7 1.6E-18 3.4E-23  122.1   0.7  133   14-149   189-322 (467)
  5 KOG1074|consensus               99.7 5.8E-18 1.3E-22  130.2   1.9   64   90-154   606-669 (958)
  6 KOG3623|consensus               99.7   1E-17 2.2E-22  127.3   1.9  108   32-140   210-331 (1007)
  7 KOG1074|consensus               99.6 3.4E-17 7.4E-22  126.0   1.1   57   90-147   880-936 (958)
  8 KOG3608|consensus               99.6   3E-16 6.5E-21  110.8   1.5  139    5-149   204-355 (467)
  9 KOG3576|consensus               99.6 1.7E-16 3.7E-21  104.2  -1.1   81   61-142   116-198 (267)
 10 KOG3623|consensus               99.6 6.1E-16 1.3E-20  117.9   1.3   77   61-138   893-970 (1007)
 11 PLN03086 PRLI-interacting fact  99.4 1.8E-12   4E-17   98.6   6.6  119    8-142   433-565 (567)
 12 PHA00733 hypothetical protein   99.2 1.2E-11 2.6E-16   77.8   3.0   79   61-142    39-123 (128)
 13 PHA02768 hypothetical protein;  99.1 2.7E-11 5.9E-16   63.8   0.6   43   90-135     6-48  (55)
 14 PHA00733 hypothetical protein   99.0 1.2E-10 2.6E-15   73.4   2.6   83   30-114    38-124 (128)
 15 PLN03086 PRLI-interacting fact  99.0 2.6E-10 5.6E-15   87.1   4.1   83   61-149   452-544 (567)
 16 PHA02768 hypothetical protein;  98.9 7.2E-10 1.6E-14   58.4   2.4   44   62-106     5-48  (55)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.7 4.6E-09 9.9E-14   47.5   0.6   24  105-129     2-25  (26)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.6 3.7E-08 8.1E-13   44.4   1.9   23   78-100     2-25  (26)
 19 PHA00616 hypothetical protein   98.5 1.3E-08 2.8E-13   51.1  -0.0   28   90-117     2-29  (44)
 20 PHA00616 hypothetical protein   98.5 2.8E-08   6E-13   50.0   1.0   32  119-150     2-33  (44)
 21 PHA00732 hypothetical protein   98.5 7.7E-08 1.7E-12   55.3   1.5   44   63-111     2-46  (79)
 22 KOG3993|consensus               98.3 2.7E-07 5.7E-12   67.5   2.2  130   11-142   270-482 (500)
 23 KOG3993|consensus               98.2 1.7E-07 3.7E-12   68.5  -0.7   83   63-145   268-383 (500)
 24 PHA00732 hypothetical protein   98.1 2.1E-06 4.7E-11   49.4   2.4   47   32-85      1-47  (79)
 25 PF00096 zf-C2H2:  Zinc finger,  98.1 1.1E-06 2.3E-11   38.4   0.7   22  119-140     1-22  (23)
 26 PF13912 zf-C2H2_6:  C2H2-type   97.9 9.2E-06   2E-10   36.8   1.8   25  119-143     2-26  (27)
 27 PF05605 zf-Di19:  Drought indu  97.8 3.3E-05   7E-10   41.2   2.9    8  119-126    32-39  (54)
 28 PF00096 zf-C2H2:  Zinc finger,  97.7 6.8E-06 1.5E-10   35.7   0.2   22   90-111     1-22  (23)
 29 PF05605 zf-Di19:  Drought indu  97.7 8.8E-05 1.9E-09   39.5   4.4   48   63-113     3-53  (54)
 30 PF13894 zf-C2H2_4:  C2H2-type   97.7 1.4E-05   3E-10   34.9   0.8   23  119-141     1-23  (24)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.4 3.7E-05 8.1E-10   33.5   0.3   23   90-112     1-23  (24)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.4 7.9E-05 1.7E-09   44.7   1.7   74   64-143     1-75  (100)
 33 PF13912 zf-C2H2_6:  C2H2-type   97.4 3.9E-05 8.5E-10   34.7   0.2   25   89-113     1-25  (27)
 34 smart00355 ZnF_C2H2 zinc finge  97.4 0.00012 2.6E-09   32.3   1.5   24  119-142     1-24  (26)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.3 8.4E-05 1.8E-09   44.6   0.7   73   34-112     1-73  (100)
 36 PF09237 GAGA:  GAGA factor;  I  97.2 0.00014 3.1E-09   37.4   1.1   28  119-146    25-52  (54)
 37 PF12874 zf-met:  Zinc-finger o  97.0 0.00039 8.5E-09   30.6   1.0   23  119-141     1-23  (25)
 38 COG5189 SFP1 Putative transcri  96.9 0.00035 7.6E-09   49.9   1.0   52   86-138   346-418 (423)
 39 PRK04860 hypothetical protein;  96.8 0.00044 9.6E-09   45.3   0.7   39   89-132   119-157 (160)
 40 smart00355 ZnF_C2H2 zinc finge  96.7  0.0006 1.3E-08   29.9   0.6   23   90-112     1-23  (26)
 41 PF13909 zf-H2C2_5:  C2H2-type   96.6 0.00058 1.3E-08   29.8   0.2   22  119-141     1-22  (24)
 42 PF09237 GAGA:  GAGA factor;  I  96.6 0.00068 1.5E-08   35.0   0.3   32   86-117    21-52  (54)
 43 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5  0.0014   3E-08   29.5   1.2   22  119-140     2-23  (27)
 44 COG5189 SFP1 Putative transcri  96.2  0.0026 5.6E-08   45.7   1.6   71   28-109   345-418 (423)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.1  0.0016 3.5E-08   28.3   0.2   23   90-113     1-23  (24)
 46 PRK04860 hypothetical protein;  96.0   0.004 8.7E-08   40.8   1.7   37   62-102   119-156 (160)
 47 PF12874 zf-met:  Zinc-finger o  95.5  0.0075 1.6E-07   26.3   1.1   17   35-51      3-19  (25)
 48 KOG2231|consensus               95.2   0.039 8.5E-07   43.9   4.7   97   35-141   118-235 (669)
 49 PF13913 zf-C2HC_2:  zinc-finge  95.0   0.017 3.7E-07   25.4   1.4   20  119-139     3-22  (25)
 50 PF12171 zf-C2H2_jaz:  Zinc-fin  94.9  0.0091   2E-07   26.7   0.3   22   90-111     2-23  (27)
 51 KOG2893|consensus               94.9  0.0052 1.1E-07   42.4  -0.7   47   61-111    10-56  (341)
 52 COG5048 FOG: Zn-finger [Genera  94.4   0.019 4.2E-07   43.1   1.2   63   89-152   289-357 (467)
 53 smart00451 ZnF_U1 U1-like zinc  93.8   0.042 9.2E-07   26.0   1.4   23  119-141     4-26  (35)
 54 PF09986 DUF2225:  Uncharacteri  92.9   0.035 7.5E-07   38.3   0.4   44   88-131     4-61  (214)
 55 cd00350 rubredoxin_like Rubred  92.9   0.067 1.4E-06   25.2   1.3    8  119-126    18-25  (33)
 56 KOG2893|consensus               92.8   0.047   1E-06   37.8   0.9   46   34-85     12-58  (341)
 57 smart00451 ZnF_U1 U1-like zinc  92.6    0.12 2.5E-06   24.4   1.9   23   32-54      3-25  (35)
 58 PF12013 DUF3505:  Protein of u  92.2    0.11 2.4E-06   31.8   1.9   25  119-143    81-109 (109)
 59 TIGR00622 ssl1 transcription f  91.4    0.36 7.7E-06   29.7   3.4   49   91-142    57-105 (112)
 60 PF13719 zinc_ribbon_5:  zinc-r  91.3   0.077 1.7E-06   25.7   0.4   34    9-43      3-36  (37)
 61 COG4049 Uncharacterized protei  91.1   0.068 1.5E-06   28.2   0.1   20  119-138    18-37  (65)
 62 COG5048 FOG: Zn-finger [Genera  90.5    0.11 2.3E-06   39.1   0.8   59   62-121   289-354 (467)
 63 PF12907 zf-met2:  Zinc-binding  90.4   0.097 2.1E-06   25.9   0.3   35  119-153     2-40  (40)
 64 COG4049 Uncharacterized protei  90.4   0.084 1.8E-06   27.8   0.1   29   86-114    14-42  (65)
 65 PF13717 zinc_ribbon_4:  zinc-r  90.3    0.12 2.7E-06   24.9   0.6   33    9-42      3-35  (36)
 66 TIGR02098 MJ0042_CXXC MJ0042 f  89.6   0.099 2.1E-06   25.4  -0.1   33    9-42      3-35  (38)
 67 PF03811 Zn_Tnp_IS1:  InsA N-te  89.0    0.37   8E-06   23.2   1.7   35    4-38      1-35  (36)
 68 PRK00464 nrdR transcriptional   88.7    0.16 3.4E-06   33.2   0.4   12   90-101    29-40  (154)
 69 KOG1146|consensus               87.7    0.21 4.6E-06   42.7   0.6   90   33-140  1261-1350(1406)
 70 KOG2186|consensus               86.4    0.32   7E-06   34.1   0.9   52   63-116     4-55  (276)
 71 cd00729 rubredoxin_SM Rubredox  86.1    0.33   7E-06   23.0   0.6    8  119-126    19-26  (34)
 72 smart00659 RPOLCX RNA polymera  84.9     0.5 1.1E-05   23.9   0.9   11   90-100     3-13  (44)
 73 KOG4173|consensus               84.5     0.4 8.6E-06   32.6   0.6   77   63-142    80-171 (253)
 74 smart00834 CxxC_CXXC_SSSS Puta  84.2    0.36 7.8E-06   23.6   0.2   30    8-40      5-34  (41)
 75 PRK09678 DNA-binding transcrip  84.1    0.45 9.8E-06   26.8   0.6   42   90-134     2-45  (72)
 76 PF14353 CpXC:  CpXC protein     83.7    0.43 9.2E-06   30.1   0.5   21    9-29      2-22  (128)
 77 PF01096 TFIIS_C:  Transcriptio  83.7    0.22 4.8E-06   24.4  -0.7   33   10-42      2-38  (39)
 78 smart00531 TFIIE Transcription  83.6    0.33 7.3E-06   31.4  -0.1   14   31-44     98-111 (147)
 79 COG5236 Uncharacterized conser  83.5    0.97 2.1E-05   33.4   2.2   12  127-138   290-301 (493)
 80 smart00440 ZnF_C2C2 C2C2 Zinc   82.3    0.64 1.4E-05   22.9   0.7   33   10-42      2-38  (40)
 81 PRK00398 rpoP DNA-directed RNA  82.2    0.71 1.5E-05   23.4   0.9   29    8-42      3-31  (46)
 82 KOG1146|consensus               82.1    0.37   8E-06   41.4  -0.3   25   87-111   516-540 (1406)
 83 COG2888 Predicted Zn-ribbon RN  81.9    0.85 1.8E-05   24.5   1.1   10   87-96     48-57  (61)
 84 TIGR02605 CxxC_CxxC_SSSS putat  80.9    0.59 1.3E-05   24.3   0.3   29    9-40      6-34  (52)
 85 COG1996 RPC10 DNA-directed RNA  80.9    0.67 1.5E-05   24.0   0.5   11   89-99      6-16  (49)
 86 PF09538 FYDLN_acid:  Protein o  80.7     1.2 2.5E-05   27.3   1.6   29   64-102    11-39  (108)
 87 COG1592 Rubrerythrin [Energy p  79.9       1 2.3E-05   29.8   1.2    8   89-96    134-141 (166)
 88 KOG3408|consensus               79.8    0.48   1E-05   29.4  -0.3   36  119-154    58-93  (129)
 89 PHA02998 RNA polymerase subuni  79.2     1.1 2.3E-05   29.9   1.1   37    7-43    142-182 (195)
 90 TIGR00373 conserved hypothetic  78.8    0.65 1.4E-05   30.5   0.0   31   88-128   108-138 (158)
 91 PRK06266 transcription initiat  78.5    0.66 1.4E-05   31.1   0.0   32   89-130   117-148 (178)
 92 COG1997 RPL43A Ribosomal prote  78.3    0.98 2.1E-05   26.3   0.7   12   89-100    53-64  (89)
 93 PF09723 Zn-ribbon_8:  Zinc rib  78.1    0.65 1.4E-05   23.1  -0.1   12    9-20      6-17  (42)
 94 PRK14890 putative Zn-ribbon RN  74.7     1.6 3.4E-05   23.5   0.8    8  119-126    49-56  (59)
 95 KOG2186|consensus               74.3     2.3   5E-05   30.0   1.7   46   33-83      4-49  (276)
 96 COG1594 RPB9 DNA-directed RNA   73.7     1.6 3.6E-05   26.9   0.8   11   63-73    101-111 (113)
 97 smart00614 ZnF_BED BED zinc fi  73.7     2.5 5.3E-05   21.8   1.4   21  119-139    19-44  (50)
 98 COG3677 Transposase and inacti  73.6     2.5 5.4E-05   26.8   1.7   39    5-44     27-65  (129)
 99 smart00734 ZnF_Rad18 Rad18-lik  73.5     2.7 5.8E-05   18.5   1.3   19  120-139     3-21  (26)
100 PHA00626 hypothetical protein   71.9     1.7 3.6E-05   23.1   0.5   14  118-131    23-36  (59)
101 PF10571 UPF0547:  Uncharacteri  71.5     1.9 4.2E-05   19.0   0.6   10  120-129    16-25  (26)
102 COG1198 PriA Primosomal protei  71.5     3.4 7.4E-05   34.0   2.3   25    9-39    445-469 (730)
103 PF02176 zf-TRAF:  TRAF-type zi  71.0     2.4 5.1E-05   22.6   1.0   42   89-131     9-55  (60)
104 PF02892 zf-BED:  BED zinc fing  70.1       3 6.5E-05   20.7   1.2   20  119-138    17-40  (45)
105 PF05443 ROS_MUCR:  ROS/MUCR tr  69.9     1.9 4.1E-05   27.4   0.5   28   87-117    70-97  (132)
106 PF03604 DNA_RNApol_7kD:  DNA d  69.0       3 6.4E-05   19.5   0.9   10  119-128    18-27  (32)
107 PF12013 DUF3505:  Protein of u  68.8       2 4.2E-05   26.2   0.4   25   90-114    81-109 (109)
108 PF09845 DUF2072:  Zn-ribbon co  68.7     3.1 6.7E-05   26.3   1.2   15   62-76      1-15  (131)
109 PF08790 zf-LYAR:  LYAR-type C2  68.3     1.8 3.9E-05   19.5   0.1   17  120-137     2-18  (28)
110 PF04959 ARS2:  Arsenite-resist  68.2     1.8 3.9E-05   29.9   0.2   30   87-116    75-104 (214)
111 TIGR02300 FYDLN_acid conserved  67.5       4 8.6E-05   25.7   1.5   30   63-102    10-39  (129)
112 cd00730 rubredoxin Rubredoxin;  66.1     4.1 8.9E-05   21.2   1.2    8  119-126    35-42  (50)
113 PF07754 DUF1610:  Domain of un  65.5     3.5 7.5E-05   17.9   0.7   10    7-16     15-24  (24)
114 PF14205 Cys_rich_KTR:  Cystein  65.4     4.2 9.1E-05   21.5   1.2   32    9-40      5-36  (55)
115 PF07975 C1_4:  TFIIH C1-like d  65.0     2.9 6.4E-05   21.8   0.5   25  118-142    21-45  (51)
116 PF00301 Rubredoxin:  Rubredoxi  63.3       8 0.00017   19.8   1.9    8  119-126    35-42  (47)
117 PF06524 NOA36:  NOA36 protein;  62.1     7.3 0.00016   27.8   2.2   19   88-106   208-226 (314)
118 KOG2482|consensus               61.3     9.2  0.0002   28.4   2.6   22   33-54    196-217 (423)
119 PF13451 zf-trcl:  Probable zin  60.0     3.2   7E-05   21.5   0.2   13   89-101     4-16  (49)
120 PF08274 PhnA_Zn_Ribbon:  PhnA   59.9     2.9 6.3E-05   19.2  -0.0    8  119-126    20-27  (30)
121 KOG2482|consensus               58.8      18 0.00038   27.1   3.7   50   62-111   144-217 (423)
122 TIGR00595 priA primosomal prot  57.8     9.4  0.0002   30.1   2.4   26    9-40    223-248 (505)
123 COG5112 UFD2 U1-like Zn-finger  57.8     1.9   4E-05   26.1  -1.1   33  119-151    56-88  (126)
124 PRK03824 hypA hydrogenase nick  57.4     5.3 0.00012   25.5   0.8   14   89-102    70-83  (135)
125 PF11672 DUF3268:  Protein of u  56.9     5.6 0.00012   24.1   0.8    8   63-70      3-10  (102)
126 smart00778 Prim_Zn_Ribbon Zinc  56.8      16 0.00034   17.7   2.2   31    8-40      3-33  (37)
127 PF13453 zf-TFIIB:  Transcripti  56.4      11 0.00023   18.5   1.7   37   10-50      1-37  (41)
128 PF11494 Ta0938:  Ta0938;  Inte  56.4     7.5 0.00016   23.2   1.3   39   87-131    12-50  (105)
129 PF12760 Zn_Tnp_IS1595:  Transp  55.5       6 0.00013   19.9   0.7    8  119-126    38-45  (46)
130 PF01780 Ribosomal_L37ae:  Ribo  55.3     3.3 7.1E-05   24.4  -0.3   11   90-100    54-64  (90)
131 COG1655 Uncharacterized protei  54.8     3.3 7.1E-05   28.9  -0.4   41   87-127    17-71  (267)
132 PF13878 zf-C2H2_3:  zinc-finge  54.5     7.3 0.00016   19.2   0.9   12  119-130    14-25  (41)
133 COG3357 Predicted transcriptio  54.1     7.3 0.00016   23.0   1.0   13   89-101    58-70  (97)
134 COG3091 SprT Zn-dependent meta  53.3     5.1 0.00011   26.1   0.3   34   89-128   117-150 (156)
135 COG4306 Uncharacterized protei  53.2     6.1 0.00013   24.8   0.6   14   89-102    68-81  (160)
136 PF05129 Elf1:  Transcription e  52.8     2.7 5.8E-05   24.3  -1.0   10   30-39     20-29  (81)
137 PRK12380 hydrogenase nickel in  52.6     7.6 0.00016   24.0   1.0   25   89-126    70-94  (113)
138 PF04606 Ogr_Delta:  Ogr/Delta-  52.5     4.9 0.00011   20.5   0.1   38   92-132     2-41  (47)
139 KOG4173|consensus               51.9     8.2 0.00018   26.5   1.1   75   32-111    79-168 (253)
140 COG5151 SSL1 RNA polymerase II  51.8      12 0.00025   27.5   1.9   48   92-142   365-412 (421)
141 PF09332 Mcm10:  Mcm10 replicat  51.3     3.1 6.7E-05   31.0  -1.0   45   90-134   253-301 (344)
142 TIGR00100 hypA hydrogenase nic  51.2     8.4 0.00018   23.8   1.0   26   89-127    70-95  (115)
143 COG1326 Uncharacterized archae  49.6     5.8 0.00013   26.9   0.1   38    4-43      2-41  (201)
144 PF14803 Nudix_N_2:  Nudix N-te  49.0       6 0.00013   18.7   0.1   10  118-127    22-31  (34)
145 PF04810 zf-Sec23_Sec24:  Sec23  48.8     8.9 0.00019   18.7   0.7    9  119-127    25-33  (40)
146 PF11023 DUF2614:  Protein of u  48.0     7.9 0.00017   23.8   0.5   31    6-44     67-97  (114)
147 KOG3408|consensus               48.0      12 0.00027   23.3   1.3   26   29-54     54-79  (129)
148 COG1327 Predicted transcriptio  47.9     9.8 0.00021   24.8   0.9   13   90-102    29-41  (156)
149 PRK14892 putative transcriptio  47.4      13 0.00029   22.4   1.4    9   31-39     20-28  (99)
150 KOG3214|consensus               47.2      13 0.00027   22.4   1.2   42   28-75     19-60  (109)
151 TIGR00240 ATCase_reg aspartate  46.8      15 0.00032   24.0   1.6   35    9-43    104-143 (150)
152 KOG2593|consensus               46.3     7.5 0.00016   29.8   0.3   34    7-40    127-161 (436)
153 PRK00564 hypA hydrogenase nick  46.2      11 0.00024   23.4   1.0   14   89-102    71-84  (117)
154 smart00661 RPOL9 RNA polymeras  46.1      20 0.00044   18.2   1.9   11   32-42     20-30  (52)
155 PF15135 UPF0515:  Uncharacteri  45.5      15 0.00033   26.0   1.6   38    6-44    130-167 (278)
156 PF14446 Prok-RING_1:  Prokaryo  45.3      17 0.00037   19.3   1.4   29    6-42      3-31  (54)
157 PF04216 FdhE:  Protein involve  45.2     1.9 4.1E-05   31.3  -2.9    8   33-40    173-180 (290)
158 KOG4167|consensus               45.0     4.3 9.3E-05   33.2  -1.2   27   89-115   792-818 (907)
159 PF02748 PyrI_C:  Aspartate car  44.9      15 0.00032   19.3   1.2   33   12-44     12-47  (52)
160 COG2331 Uncharacterized protei  44.2     7.3 0.00016   22.1  -0.0   10   63-72     13-22  (82)
161 TIGR01206 lysW lysine biosynth  44.0      16 0.00035   19.3   1.3   30    9-42      3-32  (54)
162 PRK00432 30S ribosomal protein  43.9      16 0.00036   18.9   1.3    8   63-70     38-45  (50)
163 PF13824 zf-Mss51:  Zinc-finger  43.0      23 0.00049   18.8   1.7   13   29-41     11-23  (55)
164 TIGR01384 TFS_arch transcripti  42.3      13 0.00029   22.3   0.9   40   32-73     62-101 (104)
165 KOG1280|consensus               42.1      29 0.00063   26.0   2.6   39   31-69     78-116 (381)
166 PTZ00255 60S ribosomal protein  42.0      11 0.00025   22.2   0.5   13   89-101    54-66  (90)
167 PRK05580 primosome assembly pr  41.5      23 0.00051   29.1   2.4   27    8-40    390-416 (679)
168 PF01927 Mut7-C:  Mut7-C RNAse   41.4      15 0.00033   23.7   1.1   46   63-108    92-143 (147)
169 PRK03681 hypA hydrogenase nick  41.4      14  0.0003   22.8   0.9   13   89-101    70-82  (114)
170 PF05191 ADK_lid:  Adenylate ki  41.3      15 0.00032   17.6   0.8   11  119-129    22-32  (36)
171 PRK14873 primosome assembly pr  40.8      21 0.00046   29.3   2.0   17   23-39    401-417 (665)
172 KOG2907|consensus               40.7      11 0.00023   23.2   0.3   13  118-130   102-114 (116)
173 KOG4377|consensus               39.9      33 0.00072   26.3   2.7  111   29-143   268-428 (480)
174 COG1779 C4-type Zn-finger prot  39.8     8.6 0.00019   26.2  -0.2   11  119-129    44-54  (201)
175 COG1998 RPS31 Ribosomal protei  39.8      18  0.0004   18.7   1.0   10    7-16     18-27  (51)
176 smart00154 ZnF_AN1 AN1-like Zi  39.0      16 0.00034   17.8   0.7   11  119-129    13-23  (39)
177 KOG4727|consensus               37.6      18 0.00039   24.1   1.0   27  113-139    70-96  (193)
178 PF01363 FYVE:  FYVE zinc finge  37.2      16 0.00034   20.0   0.6   10   64-73     11-20  (69)
179 PF01155 HypA:  Hydrogenase exp  36.9      12 0.00026   23.0   0.1   13   90-102    71-83  (113)
180 PF10276 zf-CHCC:  Zinc-finger   36.7      14 0.00031   18.2   0.3   22   21-42     18-39  (40)
181 PF15269 zf-C2H2_7:  Zinc-finge  36.2      23 0.00051   17.8   1.0   22  119-140    21-42  (54)
182 cd00924 Cyt_c_Oxidase_Vb Cytoc  36.1      16 0.00035   21.9   0.5   18   25-43     73-90  (97)
183 PF10537 WAC_Acf1_DNA_bd:  ATP-  36.1      34 0.00074   20.7   2.0   37   32-71      3-39  (102)
184 PF14311 DUF4379:  Domain of un  35.9      19 0.00041   18.8   0.8   12   90-101    29-40  (55)
185 smart00132 LIM Zinc-binding do  35.1      20 0.00044   16.5   0.8   10  119-128    28-37  (39)
186 KOG4317|consensus               35.1      12 0.00026   27.5  -0.1   19  119-137    20-38  (383)
187 KOG4167|consensus               35.1     9.9 0.00021   31.3  -0.6   25   61-85    791-815 (907)
188 PRK05978 hypothetical protein;  35.0      22 0.00047   23.2   1.0    8   92-99     55-62  (148)
189 COG4391 Uncharacterized protei  34.7      11 0.00025   20.4  -0.2   44   82-130    16-60  (62)
190 PF08209 Sgf11:  Sgf11 (transcr  34.7      30 0.00065   16.2   1.2   21  118-139     4-24  (33)
191 PF07282 OrfB_Zn_ribbon:  Putat  34.7      39 0.00085   18.4   2.0   12   61-72     45-56  (69)
192 PF01428 zf-AN1:  AN1-like Zinc  34.4      24 0.00052   17.4   1.0   11  119-129    14-24  (43)
193 COG0068 HypF Hydrogenase matur  34.3      16 0.00035   30.0   0.5    9   89-97    173-181 (750)
194 TIGR00280 L37a ribosomal prote  34.2      16 0.00035   21.6   0.3   14   89-102    53-66  (91)
195 COG4888 Uncharacterized Zn rib  33.8      14  0.0003   22.2   0.1   40   28-73     18-57  (104)
196 COG1571 Predicted DNA-binding   33.2      23 0.00049   27.3   1.0   30   91-132   352-381 (421)
197 COG4957 Predicted transcriptio  33.1   1E+02  0.0022   19.8   3.7   35   17-54     61-95  (148)
198 PLN02294 cytochrome c oxidase   33.1      21 0.00045   23.8   0.7   20   83-102   135-154 (174)
199 PF07295 DUF1451:  Protein of u  32.9      16 0.00036   23.7   0.2   30   89-129   112-141 (146)
200 smart00064 FYVE Protein presen  32.8      28  0.0006   18.9   1.1   10   64-73     12-21  (68)
201 PRK04023 DNA polymerase II lar  32.7      63  0.0014   28.1   3.5    8   33-40    627-634 (1121)
202 KOG2785|consensus               32.6      37 0.00079   25.8   2.0   25   61-85    165-189 (390)
203 KOG2231|consensus               32.0      45 0.00097   27.5   2.5   98   44-150   161-275 (669)
204 KOG2785|consensus               31.1      29 0.00063   26.3   1.3   52   89-140   166-242 (390)
205 PF10083 DUF2321:  Uncharacteri  30.9      17 0.00038   23.8   0.1   13  119-131    69-81  (158)
206 PF04780 DUF629:  Protein of un  30.4      27 0.00059   27.3   1.1   21   90-110    58-78  (466)
207 PF00412 LIM:  LIM domain;  Int  30.1      24 0.00053   18.2   0.6   12  119-130    27-38  (58)
208 PRK03976 rpl37ae 50S ribosomal  29.8      21 0.00045   21.1   0.3   13   89-101    54-66  (90)
209 TIGR03831 YgiT_finger YgiT-typ  29.8      25 0.00054   17.2   0.6   14  117-130    31-44  (46)
210 PF10263 SprT-like:  SprT-like   29.6      22 0.00047   22.9   0.4   32   89-129   123-154 (157)
211 PF10013 DUF2256:  Uncharacteri  29.5      30 0.00066   17.2   0.8   11   92-102    11-21  (42)
212 PF08792 A2L_zn_ribbon:  A2L zi  29.5      25 0.00054   16.4   0.5   12  118-129    21-32  (33)
213 smart00731 SprT SprT homologue  29.4      26 0.00056   22.6   0.7   33   89-129   112-144 (146)
214 PF04423 Rad50_zn_hook:  Rad50   28.8      21 0.00045   18.6   0.2   12  120-131    22-33  (54)
215 PTZ00448 hypothetical protein;  28.6      35 0.00076   25.8   1.4   22  119-140   315-336 (373)
216 PRK04351 hypothetical protein;  28.3      28 0.00061   22.7   0.7   33   89-130   112-144 (149)
217 PF01286 XPA_N:  XPA protein N-  28.1      27 0.00059   16.5   0.5   14   91-104     5-18  (34)
218 TIGR03830 CxxCG_CxxCG_HTH puta  28.0      30 0.00065   21.3   0.8   12  119-130    32-43  (127)
219 PRK00762 hypA hydrogenase nick  27.8      31 0.00067   21.7   0.9   13   89-102    70-82  (124)
220 KOG3507|consensus               27.8      16 0.00035   19.6  -0.3   12  119-130    38-49  (62)
221 PF11781 RRN7:  RNA polymerase   27.5      36 0.00078   16.2   0.9   15    3-17      3-17  (36)
222 PF14787 zf-CCHC_5:  GAG-polypr  27.2      30 0.00066   16.6   0.6   15  120-134     4-18  (36)
223 PF12773 DZR:  Double zinc ribb  26.9      50  0.0011   16.6   1.4    9  119-127    30-38  (50)
224 TIGR00686 phnA alkylphosphonat  26.8      27 0.00059   21.4   0.4   13   89-101    19-31  (109)
225 PF06220 zf-U1:  U1 zinc finger  26.7      48   0.001   16.0   1.2   12  119-130     4-15  (38)
226 COG1773 Rubredoxin [Energy pro  26.2      27 0.00057   18.6   0.3   13  119-131     4-16  (55)
227 PRK10220 hypothetical protein;  24.9      36 0.00079   20.9   0.7   14   89-102    20-33  (111)
228 COG4640 Predicted membrane pro  24.8      44 0.00096   25.6   1.3   18  119-136    16-33  (465)
229 KOG0978|consensus               24.8      23  0.0005   29.2  -0.2   21  113-134   674-694 (698)
230 COG5216 Uncharacterized conser  24.7      20 0.00044   19.2  -0.3    8   62-69     44-51  (67)
231 TIGR00244 transcriptional regu  24.6      32 0.00069   22.4   0.5   14  119-132    29-42  (147)
232 PF08394 Arc_trans_TRASH:  Arch  24.0      12 0.00026   18.1  -1.2   33   92-129     1-34  (37)
233 KOG3002|consensus               23.1 1.5E+02  0.0033   21.9   3.8   57   63-123    81-141 (299)
234 PRK00420 hypothetical protein;  23.1      42 0.00092   20.7   0.8    8   90-97     41-48  (112)
235 KOG1842|consensus               23.1      26 0.00057   27.2  -0.1   23   61-83     14-36  (505)
236 KOG0717|consensus               22.7      55  0.0012   25.7   1.5   21   33-53    293-313 (508)
237 COG3364 Zn-ribbon containing p  22.6      43 0.00093   20.3   0.7   14   89-102     2-15  (112)
238 PF04780 DUF629:  Protein of un  22.1      40 0.00086   26.5   0.7   24   61-84     56-79  (466)
239 PF07800 DUF1644:  Protein of u  21.8 2.5E+02  0.0055   18.6   6.0   59   89-150    80-141 (162)
240 TIGR03655 anti_R_Lar restricti  21.7      66  0.0014   16.6   1.3   35   10-44      3-38  (53)
241 KOG1842|consensus               21.3      48   0.001   25.8   0.9   29   89-117    15-43  (505)
242 PF06397 Desulfoferrod_N:  Desu  21.1      35 0.00075   16.4   0.1   11  118-128     6-16  (36)
243 PF14122 YokU:  YokU-like prote  21.1      53  0.0012   19.2   0.9   22  114-135    31-52  (87)
244 KOG3362|consensus               21.1      59  0.0013   21.1   1.2   18   33-50    130-147 (156)
245 COG5236 Uncharacterized conser  21.1      82  0.0018   23.8   2.0   20   92-111   223-242 (493)
246 KOG2807|consensus               20.9      99  0.0021   23.1   2.4   24  119-142   346-369 (378)
247 PRK11823 DNA repair protein Ra  20.8      46   0.001   25.9   0.8    7   90-96     22-28  (446)
248 KOG0782|consensus               20.8      49  0.0011   26.8   0.9   35   91-131   255-289 (1004)
249 KOG2071|consensus               20.6      49  0.0011   26.7   0.9   27  115-142   416-442 (579)

No 1  
>KOG2462|consensus
Probab=99.95  E-value=2.9e-28  Score=165.97  Aligned_cols=119  Identities=22%  Similarity=0.352  Sum_probs=107.3

Q ss_pred             CCCccccccccccccChHHHHHHHhhhhcCC--CCccccccccccccChhhHHHHHhhhCCCcccCccccccccCccchh
Q psy16646         29 LPPQFHCYVCKKKYRHKRQLVRHFQVNHTNN--YDRVICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRDKHSK  106 (159)
Q Consensus        29 ~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~--~~~~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~~~l~  106 (159)
                      ....|.|.+||+.+.+.++|.+|..+ |..-  .+.+.|..|++.+.+..+|..|+++|+ .+++|.+||+.|.+..-|+
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~-H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~-l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQT-HRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT-LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             cCCceeccccccccccccccchhhcc-cccccccccccCCCCCceeeehHHHhhHhhccC-CCcccccccccccchHHhh
Confidence            34568999999999999999999998 5542  156889999999999999999999994 5899999999999999999


Q ss_pred             hhhhhhhhhhccccccccCccccchhhHHHhhccCCCccccccC
Q psy16646        107 GDDIREEIEREMKTRNSIGITVRQNQTNKNHRSGDQKKKTAKQL  150 (159)
Q Consensus       107 ~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~~~  150 (159)
                      .|+|+|+|||| |.|+.|++.|+.+++|+.|+++|.+.|.|+|.
T Consensus       205 GHiRTHTGEKP-F~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~  247 (279)
T KOG2462|consen  205 GHIRTHTGEKP-FSCPHCGKAFADRSNLRAHMQTHSDVKKHQCP  247 (279)
T ss_pred             cccccccCCCC-ccCCcccchhcchHHHHHHHHhhcCCccccCc
Confidence            99999999999 99999999999999999999999999999985


No 2  
>KOG2462|consensus
Probab=99.93  E-value=1.6e-26  Score=157.54  Aligned_cols=131  Identities=21%  Similarity=0.310  Sum_probs=117.5

Q ss_pred             hhhcccCCCCCCCCCCC----CCcccCC---CCCccccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhh
Q psy16646          5 KKKSVKNPNAKKRYRPY----VPRVDSS---LPPQFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSS   77 (159)
Q Consensus         5 ~~~~~~~~~~~~~~~~~----~~~~~h~---~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~   77 (159)
                      +...++|+.|++.+...    .|...|-   ..+.+.|.+|++.|.+-..|..|+++ |.   -++.|.+||+.|+..=-
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirT-H~---l~c~C~iCGKaFSRPWL  202 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRT-HT---LPCECGICGKAFSRPWL  202 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhc-cC---CCcccccccccccchHH
Confidence            34568899999998854    4555553   36779999999999999999999999 54   47899999999999999


Q ss_pred             HHHHHhhh-CCCcccCccccccccCccchhhhhhhhhhhhccccccccCccccchhhHHHhhcc
Q psy16646         78 LAEHRVLH-FPAQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHRSG  140 (159)
Q Consensus        78 l~~h~~~h-~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  140 (159)
                      |+.|+++| |||||.|..|+++|...++|+.|+++|.+.|. |.|..|++.|+..+-|..|...
T Consensus       203 LQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  203 LQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-HQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc-ccCcchhhHHHHHHHHHHhhhh
Confidence            99999999 99999999999999999999999999999998 9999999999999999999754


No 3  
>KOG3576|consensus
Probab=99.77  E-value=1.1e-19  Score=119.04  Aligned_cols=122  Identities=25%  Similarity=0.377  Sum_probs=106.5

Q ss_pred             CcccCCCCCccccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHhhh-CCCcccCccccccccC
Q psy16646         23 PRVDSSLPPQFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRVLH-FPAQHKCSLCQQAFKR  101 (159)
Q Consensus        23 ~~~~h~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h-~~k~~~C~~C~~~f~~  101 (159)
                      .+.+..+...+.|.+|++.|.....|.+|++. |... +.+.|..||+.|.+.-+|..|.++| |.+||+|..|+++|..
T Consensus       108 t~gsssd~d~ftCrvCgK~F~lQRmlnrh~kc-h~~v-kr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftq  185 (267)
T KOG3576|consen  108 TIGSSSDQDSFTCRVCGKKFGLQRMLNRHLKC-HSDV-KRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQ  185 (267)
T ss_pred             cccCCCCCCeeeeehhhhhhhHHHHHHHHhhh-ccHH-HHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHh
Confidence            33334455679999999999999999999999 7777 7899999999999999999999999 9999999999999999


Q ss_pred             ccchhhhhhhhhhhh----------ccccccccCccccchhhHHHhhccCCCccc
Q psy16646        102 DKHSKGDDIREEIER----------EMKTRNSIGITVRQNQTNKNHRSGDQKKKT  146 (159)
Q Consensus       102 ~~~l~~h~~~~~~~~----------~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~  146 (159)
                      .-+|..|++..+|-.          ..|.|++||.+-.....+..|+..|+...+
T Consensus       186 rcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  186 RCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             hccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            999999998755431          239999999999999999999988886554


No 4  
>KOG3608|consensus
Probab=99.71  E-value=1.6e-18  Score=122.15  Aligned_cols=133  Identities=18%  Similarity=0.236  Sum_probs=104.1

Q ss_pred             CCCCCCCCCCcccCCCCCccccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHhhhCCCcccCc
Q psy16646         14 AKKRYRPYVPRVDSSLPPQFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRVLHFPAQHKCS   93 (159)
Q Consensus        14 ~~~~~~~~~~~~~h~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~   93 (159)
                      .+.++++..|+++|++++...|+.||..|.....|..|.+........+|+|..|.+.|.....|..|+..| ..-|.|+
T Consensus       189 ~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rH-vn~ykCp  267 (467)
T KOG3608|consen  189 MGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRH-VNCYKCP  267 (467)
T ss_pred             hccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHh-hhccccc
Confidence            455666788889999999999999999998888888888764444436788888888888888888888777 2367888


Q ss_pred             cccccccCccchhhhhhhhhh-hhccccccccCccccchhhHHHhhccCCCcccccc
Q psy16646         94 LCQQAFKRDKHSKGDDIREEI-EREMKTRNSIGITVRQNQTNKNHRSGDQKKKTAKQ  149 (159)
Q Consensus        94 ~C~~~f~~~~~l~~h~~~~~~-~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~~  149 (159)
                      .|..+....++|..|++.-+. ++| |+|+.|+++|.+.+.|..|..+|. +..|.|
T Consensus       268 lCdmtc~~~ssL~~H~r~rHs~dkp-fKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C  322 (467)
T KOG3608|consen  268 LCDMTCSSASSLTTHIRYRHSKDKP-FKCDECDTRCVRESDLAKHVQVHS-KTVYQC  322 (467)
T ss_pred             ccccCCCChHHHHHHHHhhhccCCC-ccccchhhhhccHHHHHHHHHhcc-ccceec
Confidence            888888888888888876544 455 888888888888888888887777 445554


No 5  
>KOG1074|consensus
Probab=99.69  E-value=5.8e-18  Score=130.20  Aligned_cols=64  Identities=16%  Similarity=0.106  Sum_probs=49.8

Q ss_pred             ccCccccccccCccchhhhhhhhhhhhccccccccCccccchhhHHHhhccCCCccccccCccch
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHRSGDQKKKTAKQLSMLN  154 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~~~~~~~  154 (159)
                      -.|-+|.+...-.+.|+.|.++|+||+| |+|..||+.|.++.+|..|..+|.-..++.-.-.+|
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERP-FkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP  669 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERP-FKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCP  669 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCc-cccccccchhccccchhhcccccccCccccccccCC
Confidence            4677888888888888888888888888 888888888888888888888887766665555555


No 6  
>KOG3623|consensus
Probab=99.68  E-value=1e-17  Score=127.33  Aligned_cols=108  Identities=23%  Similarity=0.382  Sum_probs=97.0

Q ss_pred             ccccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHhhh--C------------CCcccCccccc
Q psy16646         32 QFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRVLH--F------------PAQHKCSLCQQ   97 (159)
Q Consensus        32 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h--~------------~k~~~C~~C~~   97 (159)
                      ...|++|.+.+.....|+.|+...|...+..|.|..|.++|.+..-|..|+.+|  +            .+.|+|.+||+
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccch
Confidence            367999999999999999999865655546799999999999999999999988  2            24699999999


Q ss_pred             cccCccchhhhhhhhhhhhccccccccCccccchhhHHHhhcc
Q psy16646         98 AFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHRSG  140 (159)
Q Consensus        98 ~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  140 (159)
                      +|.++-.|+.|+|+|.||+| |.|+.|+++|.+..++..|+..
T Consensus       290 AFKfKHHLKEHlRIHSGEKP-feCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  290 AFKFKHHLKEHLRIHSGEKP-FECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             hhhhHHHHHhhheeecCCCC-cCCcccccccccCCcccccccc
Confidence            99999999999999999999 9999999999999999999743


No 7  
>KOG1074|consensus
Probab=99.64  E-value=3.4e-17  Score=126.04  Aligned_cols=57  Identities=11%  Similarity=0.046  Sum_probs=53.2

Q ss_pred             ccCccccccccCccchhhhhhhhhhhhccccccccCccccchhhHHHhhccCCCcccc
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHRSGDQKKKTA  147 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~  147 (159)
                      ..|..||+.|...+.|..|+++|+++++ |.|..|++.|..+..|..|+.+|..-.+.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KP-F~C~fC~~aFttrgnLKvHMgtH~w~q~~  936 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKP-FFCHFCEEAFTTRGNLKVHMGTHMWVQPP  936 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCC-ccchhhhhhhhhhhhhhhhhccccccCCC
Confidence            6799999999999999999999999999 99999999999999999999999865543


No 8  
>KOG3608|consensus
Probab=99.59  E-value=3e-16  Score=110.81  Aligned_cols=139  Identities=19%  Similarity=0.282  Sum_probs=105.1

Q ss_pred             hhhcccCCCCCCCCCCCC----CcccCC--CCCccccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhH
Q psy16646          5 KKKSVKNPNAKKRYRPYV----PRVDSS--LPPQFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSL   78 (159)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~----~~~~h~--~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l   78 (159)
                      .+|.+.||.|+.-|+...    |++..+  ...+|.|..|.+.|.+...|..|+.. |-.   -|.|+.|..+....++|
T Consensus       204 ~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~r-Hvn---~ykCplCdmtc~~~ssL  279 (467)
T KOG3608|consen  204 NEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVR-HVN---CYKCPLCDMTCSSASSL  279 (467)
T ss_pred             CCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHH-hhh---cccccccccCCCChHHH
Confidence            457889999888777543    333322  34689999999999999999999887 543   47899999988889999


Q ss_pred             HHHHhh-h-CCCcccCccccccccCccchhhhhhhhhhhhccccccc--cCccccchhhHHHhhc-cCCCcc--cccc
Q psy16646         79 AEHRVL-H-FPAQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNS--IGITVRQNQTNKNHRS-GDQKKK--TAKQ  149 (159)
Q Consensus        79 ~~h~~~-h-~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~-~h~~~k--~~~~  149 (159)
                      ..|++. | .++||+|..|.+.|.+.+.|..|+.+|.  ++.|.|+.  |-.+|.+...++.|.+ +|.|..  +|.|
T Consensus       280 ~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS--~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~C  355 (467)
T KOG3608|consen  280 TTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS--KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYAC  355 (467)
T ss_pred             HHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc--ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceee
Confidence            999775 5 7789999999999999999999988665  55588854  8888888888888844 443443  3544


No 9  
>KOG3576|consensus
Probab=99.57  E-value=1.7e-16  Score=104.24  Aligned_cols=81  Identities=20%  Similarity=0.285  Sum_probs=75.7

Q ss_pred             CccccccccccccChhhHHHHHhhh-CCCcccCccccccccCccchhhhhhhhhhhhccccccccCccccchhhHHHhhc
Q psy16646         61 DRVICEICNKEFTHKSSLAEHRVLH-FPAQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHRS  139 (159)
Q Consensus        61 ~~~~c~~c~~~f~~~~~l~~h~~~h-~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  139 (159)
                      ..+.|..|++.|....-|+.|++.| ..+.+.|..||+.|...-.|++|.++|+|-+| |+|+.|++.|.++.+|-.|++
T Consensus       116 d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  116 DSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccc-cchhhhhHHHHhhccHHHHHH
Confidence            5689999999999999999999999 77899999999999999999999999999999 999999999999999999954


Q ss_pred             -cCC
Q psy16646        140 -GDQ  142 (159)
Q Consensus       140 -~h~  142 (159)
                       +|.
T Consensus       195 kvhg  198 (267)
T KOG3576|consen  195 KVHG  198 (267)
T ss_pred             HHcC
Confidence             454


No 10 
>KOG3623|consensus
Probab=99.56  E-value=6.1e-16  Score=117.89  Aligned_cols=77  Identities=23%  Similarity=0.381  Sum_probs=73.9

Q ss_pred             CccccccccccccChhhHHHHHhhh-CCCcccCccccccccCccchhhhhhhhhhhhccccccccCccccchhhHHHhh
Q psy16646         61 DRVICEICNKEFTHKSSLAEHRVLH-FPAQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHR  138 (159)
Q Consensus        61 ~~~~c~~c~~~f~~~~~l~~h~~~h-~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  138 (159)
                      .+|.|+.|++.|.-.++|..|.--| |.+||+|.+|.++|..+-.|..|.|.|.||+| |.|+.|+++|.+..++..|+
T Consensus       893 gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  893 GMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             ccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccccchHhhh
Confidence            6899999999999999999999999 88999999999999999999999999999999 99999999999999999997


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.35  E-value=1.8e-12  Score=98.57  Aligned_cols=119  Identities=17%  Similarity=0.306  Sum_probs=90.2

Q ss_pred             cccCCC--CCCCCCCCCCcccCCCCCccccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHhhh
Q psy16646          8 SVKNPN--AKKRYRPYVPRVDSSLPPQFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRVLH   85 (159)
Q Consensus         8 ~~~~~~--~~~~~~~~~~~~~h~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h   85 (159)
                      .+.||+  |+..+.      ....++++.|+.|+..|. ...|..|+.. +.   .++.|. |+..+ ....|..|+..|
T Consensus       433 ~V~Cp~~~Cg~v~~------r~el~~H~~C~~Cgk~f~-~s~LekH~~~-~H---kpv~Cp-Cg~~~-~R~~L~~H~~th  499 (567)
T PLN03086        433 NVVCPHDGCGIVLR------VEEAKNHVHCEKCGQAFQ-QGEMEKHMKV-FH---EPLQCP-CGVVL-EKEQMVQHQAST  499 (567)
T ss_pred             ceeCCcccccceee------ccccccCccCCCCCCccc-hHHHHHHHHh-cC---CCccCC-CCCCc-chhHHHhhhhcc
Confidence            445664  555552      333345578999999986 6789999988 42   578999 99755 568899999888


Q ss_pred             -CCCcccCccccccccC----------ccchhhhhhhhhhhhccccccccCccccchhhHHHhh-ccCC
Q psy16646         86 -FPAQHKCSLCQQAFKR----------DKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHR-SGDQ  142 (159)
Q Consensus        86 -~~k~~~C~~C~~~f~~----------~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~-~~h~  142 (159)
                       ..+++.|..|++.|..          .+.|..|... .|.++ +.|..||+.|..+ .+..|+ ..|.
T Consensus       500 Cp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~-CG~rt-~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        500 CPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI-CGSRT-APCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             CCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh-cCCcc-eEccccCCeeeeh-hHHHHHHHhhc
Confidence             8899999999999853          3478889877 48888 9999999998887 567774 3443


No 12 
>PHA00733 hypothetical protein
Probab=99.19  E-value=1.2e-11  Score=77.82  Aligned_cols=79  Identities=18%  Similarity=0.203  Sum_probs=64.1

Q ss_pred             CccccccccccccChhhHHHH------HhhhCCCcccCccccccccCccchhhhhhhhhhhhccccccccCccccchhhH
Q psy16646         61 DRVICEICNKEFTHKSSLAEH------RVLHFPAQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTN  134 (159)
Q Consensus        61 ~~~~c~~c~~~f~~~~~l~~h------~~~h~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l  134 (159)
                      +++.|.+|...|.....|..+      +..++++||.|..||+.|...+.|..|++.+  +.+ +.|+.|++.|.....|
T Consensus        39 ~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~-~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHS-KVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcC-ccCCCCCCccCCHHHH
Confidence            678899998877776666554      2233678999999999999999999999875  345 8999999999999999


Q ss_pred             HHhhccCC
Q psy16646        135 KNHRSGDQ  142 (159)
Q Consensus       135 ~~H~~~h~  142 (159)
                      ..|++..+
T Consensus       116 ~~H~~~~h  123 (128)
T PHA00733        116 LDHVCKKH  123 (128)
T ss_pred             HHHHHHhc
Confidence            99976544


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.08  E-value=2.7e-11  Score=63.79  Aligned_cols=43  Identities=7%  Similarity=0.112  Sum_probs=27.5

Q ss_pred             ccCccccccccCccchhhhhhhhhhhhccccccccCccccchhhHH
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNK  135 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~  135 (159)
                      |+|+.||+.|...+.|..|+++|+  ++ ++|..|++.|.+.+.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceecccceeE
Confidence            566666666666666666666666  34 66666666666665553


No 14 
>PHA00733 hypothetical protein
Probab=99.04  E-value=1.2e-10  Score=73.35  Aligned_cols=83  Identities=14%  Similarity=0.280  Sum_probs=67.1

Q ss_pred             CCccccccccccccChHHHHHH--Hh--hhhcCCCCccccccccccccChhhHHHHHhhhCCCcccCccccccccCccch
Q psy16646         30 PPQFHCYVCKKKYRHKRQLVRH--FQ--VNHTNNYDRVICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRDKHS  105 (159)
Q Consensus        30 ~~~~~C~~c~~~f~~~~~l~~h--~~--~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~~~l  105 (159)
                      .+++.|..|...|.....|..+  +.  ..+... .||.|..|++.|.+...|..|++.+ +.++.|..|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~-kPy~C~~Cgk~Fss~s~L~~H~r~h-~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAV-SPYVCPLCLMPFSSSVSLKQHIRYT-EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCC-CCccCCCCCCcCCCHHHHHHHHhcC-CcCccCCCCCCccCCHHHH
Confidence            5678999999888776666554  11  112234 7999999999999999999998876 4579999999999999999


Q ss_pred             hhhhhhhhh
Q psy16646        106 KGDDIREEI  114 (159)
Q Consensus       106 ~~h~~~~~~  114 (159)
                      ..|+...|+
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            999987775


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.02  E-value=2.6e-10  Score=87.05  Aligned_cols=83  Identities=19%  Similarity=0.260  Sum_probs=70.4

Q ss_pred             CccccccccccccChhhHHHHHhhhCCCcccCccccccccCccchhhhhhhhhhhhccccccccCccccc----------
Q psy16646         61 DRVICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQ----------  130 (159)
Q Consensus        61 ~~~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~----------  130 (159)
                      .++.|..|++.|. ...|..|+..+ .+++.|+ ||+.+ ....|..|+.+|...++ +.|+.|++.|..          
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~~~-Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v~~g~~~~d~~d~  526 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMKVF-HEPLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMVQAGGSAMDVRDR  526 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHHhc-CCCccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCccccCccccchhhh
Confidence            5678999999986 67799998886 3789999 99765 56899999999999999 999999999952          


Q ss_pred             hhhHHHhhccCCCcccccc
Q psy16646        131 NQTNKNHRSGDQKKKTAKQ  149 (159)
Q Consensus       131 ~~~l~~H~~~h~~~k~~~~  149 (159)
                      .+.|..|..++ +.++++|
T Consensus       527 ~s~Lt~HE~~C-G~rt~~C  544 (567)
T PLN03086        527 LRGMSEHESIC-GSRTAPC  544 (567)
T ss_pred             hhhHHHHHHhc-CCcceEc
Confidence            45899998875 8888888


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.93  E-value=7.2e-10  Score=58.43  Aligned_cols=44  Identities=23%  Similarity=0.337  Sum_probs=36.4

Q ss_pred             ccccccccccccChhhHHHHHhhhCCCcccCccccccccCccchh
Q psy16646         62 RVICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRDKHSK  106 (159)
Q Consensus        62 ~~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~~~l~  106 (159)
                      .|.|+.||+.|...++|..|+++|. ++++|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceecccceeE
Confidence            4688888888888888888888885 6888888888888877765


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.69  E-value=4.6e-09  Score=47.46  Aligned_cols=24  Identities=8%  Similarity=-0.083  Sum_probs=15.5

Q ss_pred             hhhhhhhhhhhhccccccccCcccc
Q psy16646        105 SKGDDIREEIEREMKTRNSIGITVR  129 (159)
Q Consensus       105 l~~h~~~~~~~~~~~~C~~C~~~f~  129 (159)
                      |.+|+++|+|+++ |.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~-~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKP-YKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSS-EEESSSSEEES
T ss_pred             HHHHhhhcCCCCC-CCCCCCcCeeC
Confidence            5566666666666 66666666664


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.57  E-value=3.7e-08  Score=44.44  Aligned_cols=23  Identities=30%  Similarity=0.545  Sum_probs=16.2

Q ss_pred             HHHHHhhh-CCCcccCcccccccc
Q psy16646         78 LAEHRVLH-FPAQHKCSLCQQAFK  100 (159)
Q Consensus        78 l~~h~~~h-~~k~~~C~~C~~~f~  100 (159)
                      |..|+++| +++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            56677777 777777777777664


No 19 
>PHA00616 hypothetical protein
Probab=98.55  E-value=1.3e-08  Score=51.13  Aligned_cols=28  Identities=14%  Similarity=0.316  Sum_probs=13.8

Q ss_pred             ccCccccccccCccchhhhhhhhhhhhc
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIREEIERE  117 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~  117 (159)
                      |.|..||+.|...+.|..|++.|||+++
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            4444455555555555555544554444


No 20 
>PHA00616 hypothetical protein
Probab=98.54  E-value=2.8e-08  Score=49.96  Aligned_cols=32  Identities=13%  Similarity=-0.013  Sum_probs=29.8

Q ss_pred             ccccccCccccchhhHHHhhccCCCccccccC
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGDQKKKTAKQL  150 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~~~  150 (159)
                      |.|+.||+.|.+.+.|..|++.|++++++.+-
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            89999999999999999999999999988653


No 21 
>PHA00732 hypothetical protein
Probab=98.45  E-value=7.7e-08  Score=55.33  Aligned_cols=44  Identities=20%  Similarity=0.428  Sum_probs=22.0

Q ss_pred             cccccccccccChhhHHHHHhh-hCCCcccCccccccccCccchhhhhhh
Q psy16646         63 VICEICNKEFTHKSSLAEHRVL-HFPAQHKCSLCQQAFKRDKHSKGDDIR  111 (159)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~-h~~k~~~C~~C~~~f~~~~~l~~h~~~  111 (159)
                      |.|..|++.|.....|..|++. |.  ++.|+.||+.|.   .+..|.++
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC---Chhhhhcc
Confidence            4555555555555555555542 32  234555555554   24445443


No 22 
>KOG3993|consensus
Probab=98.33  E-value=2.7e-07  Score=67.55  Aligned_cols=130  Identities=18%  Similarity=0.202  Sum_probs=82.5

Q ss_pred             CCCCCCCCC----CCCCcccCCCCCccccccccccccChHHHHHHHhhhhcCC---------------------------
Q psy16646         11 NPNAKKRYR----PYVPRVDSSLPPQFHCYVCKKKYRHKRQLVRHFQVNHTNN---------------------------   59 (159)
Q Consensus        11 ~~~~~~~~~----~~~~~~~h~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~---------------------------   59 (159)
                      |.-|+..+.    +..|.-..+.-..|+|++|++.|....+|..|.++ |...                           
T Consensus       270 CqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRW-HKPR~eaa~a~~~P~k~~~~~rae~~ea~rs  348 (500)
T KOG3993|consen  270 CQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRW-HKPRPEAAKAGSPPPKQAVETRAEVQEAERS  348 (500)
T ss_pred             HHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcc-cCCchhhhhcCCCChhhhhhhhhhhhhcccc
Confidence            334555444    44555444555668899999999999999999888 4321                           


Q ss_pred             -----CCccccccccccccChhhHHHHHhhh--CCCc-------------------------------------------
Q psy16646         60 -----YDRVICEICNKEFTHKSSLAEHRVLH--FPAQ-------------------------------------------   89 (159)
Q Consensus        60 -----~~~~~c~~c~~~f~~~~~l~~h~~~h--~~k~-------------------------------------------   89 (159)
                           +.-|.|..|++.|.....|..|+.+|  .+..                                           
T Consensus       349 g~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sa  428 (500)
T KOG3993|consen  349 GDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSA  428 (500)
T ss_pred             CCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccc
Confidence                 01256777888887777777776665  1110                                           


Q ss_pred             --ccCccccccccCccchhhhhhhhhhhhccccccccCccccchhhHHHhhccCC
Q psy16646         90 --HKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHRSGDQ  142 (159)
Q Consensus        90 --~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  142 (159)
                        ..|..||..+..+..--.+.+..+.+.. |.|..|-..|.....|.+|+...+
T Consensus       429 el~~pp~~~~ppsss~~sgg~~rlg~~~q~-f~~ky~~atfyss~~ltrhin~~H  482 (500)
T KOG3993|consen  429 ELELPPYDGSPPSSSGSSGGYGRLGIAEQG-FTCKYCPATFYSSPGLTRHINKCH  482 (500)
T ss_pred             cccCCCCCCCCcccCCCCCccccccchhhc-cccccchHhhhcCcchHhHhhhcC
Confidence              2334455444444443444444444444 889999999999999999965543


No 23 
>KOG3993|consensus
Probab=98.23  E-value=1.7e-07  Score=68.54  Aligned_cols=83  Identities=17%  Similarity=0.385  Sum_probs=50.3

Q ss_pred             cccccccccccChhhHHHHHhhh-CCCcccCccccccccCccchhhhhhhhh----------------------------
Q psy16646         63 VICEICNKEFTHKSSLAEHRVLH-FPAQHKCSLCQQAFKRDKHSKGDDIREE----------------------------  113 (159)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~h-~~k~~~C~~C~~~f~~~~~l~~h~~~~~----------------------------  113 (159)
                      |.|..|...+.+.-.|.+|+-.. -.--|+|++|++.|.-..+|..|.+-|-                            
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            45555555555555555553222 1123555555555555555555544220                            


Q ss_pred             ----hhhccccccccCccccchhhHHHhhccCCCcc
Q psy16646        114 ----IEREMKTRNSIGITVRQNQTNKNHRSGDQKKK  145 (159)
Q Consensus       114 ----~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k  145 (159)
                          .+...|.|..|++.|.+..-|+.|+-+|+..-
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence                11123999999999999999999988887543


No 24 
>PHA00732 hypothetical protein
Probab=98.11  E-value=2.1e-06  Score=49.35  Aligned_cols=47  Identities=30%  Similarity=0.528  Sum_probs=26.1

Q ss_pred             ccccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHhhh
Q psy16646         32 QFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRVLH   85 (159)
Q Consensus        32 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h   85 (159)
                      ||.|..|++.|.....|..|++.+|.    ++.|+.|++.|.   .+..|..+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~----~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT----LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC----CCccCCCCCEeC---Chhhhhccc
Confidence            35566666666666666666653122    235666666665   255555443


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.09  E-value=1.1e-06  Score=38.36  Aligned_cols=22  Identities=14%  Similarity=0.051  Sum_probs=16.4

Q ss_pred             ccccccCccccchhhHHHhhcc
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSG  140 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~  140 (159)
                      |.|+.|++.|.+.+.|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4677777777777777777665


No 26 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.88  E-value=9.2e-06  Score=36.81  Aligned_cols=25  Identities=12%  Similarity=0.112  Sum_probs=21.7

Q ss_pred             ccccccCccccchhhHHHhhccCCC
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGDQK  143 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h~~  143 (159)
                      |.|+.|++.|.+...|..|++.|..
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhcC
Confidence            7899999999999999999887754


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.75  E-value=3.3e-05  Score=41.22  Aligned_cols=8  Identities=0%  Similarity=-0.375  Sum_probs=3.2

Q ss_pred             ccccccCc
Q psy16646        119 KTRNSIGI  126 (159)
Q Consensus       119 ~~C~~C~~  126 (159)
                      +.|+.|..
T Consensus        32 v~CPiC~~   39 (54)
T PF05605_consen   32 VVCPICSS   39 (54)
T ss_pred             ccCCCchh
Confidence            33444443


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.75  E-value=6.8e-06  Score=35.75  Aligned_cols=22  Identities=27%  Similarity=0.566  Sum_probs=14.4

Q ss_pred             ccCccccccccCccchhhhhhh
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIR  111 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~  111 (159)
                      |.|+.|++.|...+.|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 29 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.74  E-value=8.8e-05  Score=39.54  Aligned_cols=48  Identities=23%  Similarity=0.319  Sum_probs=22.4

Q ss_pred             cccccccccccChhhHHHHHhh-h--CCCcccCccccccccCccchhhhhhhhh
Q psy16646         63 VICEICNKEFTHKSSLAEHRVL-H--FPAQHKCSLCQQAFKRDKHSKGDDIREE  113 (159)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~-h--~~k~~~C~~C~~~f~~~~~l~~h~~~~~  113 (159)
                      |.|+.|++ ..+...|..|... |  ..+.+.|++|...+.  ..|..|+..+|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            44555555 2334455555332 3  223455555555433  25555555443


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.70  E-value=1.4e-05  Score=34.88  Aligned_cols=23  Identities=13%  Similarity=0.095  Sum_probs=15.0

Q ss_pred             ccccccCccccchhhHHHhhccC
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGD  141 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h  141 (159)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45777777777777777776654


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.44  E-value=3.7e-05  Score=33.46  Aligned_cols=23  Identities=13%  Similarity=0.501  Sum_probs=13.2

Q ss_pred             ccCccccccccCccchhhhhhhh
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIRE  112 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~~  112 (159)
                      |.|+.|++.|.....|..|+.++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666554


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.42  E-value=7.9e-05  Score=44.70  Aligned_cols=74  Identities=14%  Similarity=0.099  Sum_probs=22.0

Q ss_pred             ccccccccccChhhHHHHHhh-hCCCcccCccccccccCccchhhhhhhhhhhhccccccccCccccchhhHHHhhccCC
Q psy16646         64 ICEICNKEFTHKSSLAEHRVL-HFPAQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHRSGDQ  142 (159)
Q Consensus        64 ~c~~c~~~f~~~~~l~~h~~~-h~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  142 (159)
                      +|..|+..|.+...|..|+.. |+-. ..   ....+.....+..+++.... .. +.|..|++.|.+...|..|++.+.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~-~~---~~~~l~~~~~~~~~~~~~~~-~~-~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFD-IP---DQKYLVDPNRLLNYLRKKVK-ES-FRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             -----------------------------------------------------SS-EEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             Cccccccccccccccccccccccccc-cc---cccccccccccccccccccC-CC-CCCCccCCCCcCHHHHHHHHcCcc
Confidence            488999999999999999754 4321 11   11122233344444433222 24 889999999999999999988654


Q ss_pred             C
Q psy16646        143 K  143 (159)
Q Consensus       143 ~  143 (159)
                      .
T Consensus        75 H   75 (100)
T PF12756_consen   75 H   75 (100)
T ss_dssp             T
T ss_pred             C
Confidence            3


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.41  E-value=3.9e-05  Score=34.67  Aligned_cols=25  Identities=12%  Similarity=0.274  Sum_probs=13.8

Q ss_pred             cccCccccccccCccchhhhhhhhh
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREE  113 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~  113 (159)
                      ||.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            3455555555555555555555443


No 34 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.36  E-value=0.00012  Score=32.31  Aligned_cols=24  Identities=13%  Similarity=0.104  Sum_probs=17.4

Q ss_pred             ccccccCccccchhhHHHhhccCC
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGDQ  142 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h~  142 (159)
                      |.|+.|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            457778888877777777776553


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.29  E-value=8.4e-05  Score=44.59  Aligned_cols=73  Identities=14%  Similarity=0.337  Sum_probs=21.0

Q ss_pred             ccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHhhhCCCcccCccccccccCccchhhhhhhh
Q psy16646         34 HCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRDKHSKGDDIRE  112 (159)
Q Consensus        34 ~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~~~l~~h~~~~  112 (159)
                      .|..|+..|.+...|..|+...|.-. .+     ....+.....+..+....-...+.|..|++.|.....|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~-~~-----~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFD-IP-----DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccc-cc-----cccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            47889999999999999987644332 21     111122333333333222223689999999999999999999864


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.23  E-value=0.00014  Score=37.45  Aligned_cols=28  Identities=25%  Similarity=0.227  Sum_probs=15.9

Q ss_pred             ccccccCccccchhhHHHhhccCCCccc
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGDQKKKT  146 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~  146 (159)
                      -.|+.|+..+.+..+|+.|+.+.++.||
T Consensus        25 atCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   25 ATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCcchhhccchhhHHHHHHHHhcccC
Confidence            6677777777777777777666555554


No 37 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.95  E-value=0.00039  Score=30.63  Aligned_cols=23  Identities=4%  Similarity=-0.000  Sum_probs=19.1

Q ss_pred             ccccccCccccchhhHHHhhccC
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGD  141 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h  141 (159)
                      |.|+.|+..|.+...|..|.+.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56889999999999999988654


No 38 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.92  E-value=0.00035  Score=49.93  Aligned_cols=52  Identities=15%  Similarity=0.198  Sum_probs=37.7

Q ss_pred             CCCcccCcc--ccccccCccchhhhhhhh-------------------hhhhccccccccCccccchhhHHHhh
Q psy16646         86 FPAQHKCSL--CQQAFKRDKHSKGDDIRE-------------------EIEREMKTRNSIGITVRQNQTNKNHR  138 (159)
Q Consensus        86 ~~k~~~C~~--C~~~f~~~~~l~~h~~~~-------------------~~~~~~~~C~~C~~~f~~~~~l~~H~  138 (159)
                      +++||+|++  |.+++.....|+=|+.-.                   ..++| |+|+.|++++.....|.=|+
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KP-YrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKP-YRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCc-eeccccchhhccCccceecc
Confidence            356777765  777777666666665322                   33477 99999999999999887776


No 39 
>PRK04860 hypothetical protein; Provisional
Probab=96.79  E-value=0.00044  Score=45.29  Aligned_cols=39  Identities=15%  Similarity=0.163  Sum_probs=31.5

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccccccCccccchh
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQ  132 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~  132 (159)
                      +|.|. |+.   ....+.+|.+++.++++ |.|..|+..|....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~~  157 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFKG  157 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEec
Confidence            58887 886   66778888888998888 88999988876543


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.70  E-value=0.0006  Score=29.93  Aligned_cols=23  Identities=22%  Similarity=0.392  Sum_probs=14.0

Q ss_pred             ccCccccccccCccchhhhhhhh
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIRE  112 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~~  112 (159)
                      |.|..|++.|...+.|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            35666666666666666666533


No 41 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.62  E-value=0.00058  Score=29.80  Aligned_cols=22  Identities=9%  Similarity=0.001  Sum_probs=12.6

Q ss_pred             ccccccCccccchhhHHHhhccC
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGD  141 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h  141 (159)
                      |.|+.|++... ...|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            45666776666 66666666554


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.57  E-value=0.00068  Score=35.00  Aligned_cols=32  Identities=6%  Similarity=0.277  Sum_probs=19.5

Q ss_pred             CCCcccCccccccccCccchhhhhhhhhhhhc
Q psy16646         86 FPAQHKCSLCQQAFKRDKHSKGDDIREEIERE  117 (159)
Q Consensus        86 ~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~  117 (159)
                      .+.|-.|++|+..+...-+|.+|+...|+.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            45677788888888887788888777776655


No 43 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.52  E-value=0.0014  Score=29.48  Aligned_cols=22  Identities=9%  Similarity=-0.023  Sum_probs=18.6

Q ss_pred             ccccccCccccchhhHHHhhcc
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSG  140 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~  140 (159)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6789999999999999888765


No 44 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.21  E-value=0.0026  Score=45.66  Aligned_cols=71  Identities=21%  Similarity=0.345  Sum_probs=45.4

Q ss_pred             CCCCcccccc--ccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHh-hhCCCcccCccccccccCccc
Q psy16646         28 SLPPQFHCYV--CKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRV-LHFPAQHKCSLCQQAFKRDKH  104 (159)
Q Consensus        28 ~~~~~~~C~~--c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~-~h~~k~~~C~~C~~~f~~~~~  104 (159)
                      .+++||.|++  |++.+.....|+-|+.-=|... +...-+          +...+.. .-..|||.|+.|++.+.....
T Consensus       345 ~d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~-~~~~~p----------~p~~~~~F~~~~KPYrCevC~KRYKNlNG  413 (423)
T COG5189         345 KDGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQ-KLHENP----------SPEKMNIFSAKDKPYRCEVCDKRYKNLNG  413 (423)
T ss_pred             ecCceecCCCCCchhhhccccchhhhhhccccCc-ccCCCC----------CccccccccccCCceeccccchhhccCcc
Confidence            3458999987  9999999999998875311111 111100          0011111 115689999999999999888


Q ss_pred             hhhhh
Q psy16646        105 SKGDD  109 (159)
Q Consensus       105 l~~h~  109 (159)
                      |+=|+
T Consensus       414 LKYHr  418 (423)
T COG5189         414 LKYHR  418 (423)
T ss_pred             ceecc
Confidence            88775


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.14  E-value=0.0016  Score=28.32  Aligned_cols=23  Identities=22%  Similarity=0.316  Sum_probs=13.7

Q ss_pred             ccCccccccccCccchhhhhhhhh
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIREE  113 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~~~  113 (159)
                      |.|+.|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45677776666 666777766654


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.00  E-value=0.004  Score=40.83  Aligned_cols=37  Identities=19%  Similarity=0.447  Sum_probs=29.3

Q ss_pred             ccccccccccccChhhHHHHHhhh-CCCcccCccccccccCc
Q psy16646         62 RVICEICNKEFTHKSSLAEHRVLH-FPAQHKCSLCQQAFKRD  102 (159)
Q Consensus        62 ~~~c~~c~~~f~~~~~l~~h~~~h-~~k~~~C~~C~~~f~~~  102 (159)
                      +|.|. |+.   ....+..|.++| ++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            57887 876   566778888888 88889999998887654


No 47 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.51  E-value=0.0075  Score=26.35  Aligned_cols=17  Identities=29%  Similarity=0.849  Sum_probs=6.3

Q ss_pred             cccccccccChHHHHHH
Q psy16646         35 CYVCKKKYRHKRQLVRH   51 (159)
Q Consensus        35 C~~c~~~f~~~~~l~~h   51 (159)
                      |..|+..|.+...|..|
T Consensus         3 C~~C~~~f~s~~~~~~H   19 (25)
T PF12874_consen    3 CDICNKSFSSENSLRQH   19 (25)
T ss_dssp             ETTTTEEESSHHHHHHH
T ss_pred             CCCCCCCcCCHHHHHHH
Confidence            33333333333333333


No 48 
>KOG2231|consensus
Probab=95.21  E-value=0.039  Score=43.94  Aligned_cols=97  Identities=15%  Similarity=0.330  Sum_probs=46.9

Q ss_pred             cccccccccChHHHHHHHhhhhcCCCCcccccccccc---cc------ChhhHHHHHhhh--CCC----cccCccccccc
Q psy16646         35 CYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKE---FT------HKSSLAEHRVLH--FPA----QHKCSLCQQAF   99 (159)
Q Consensus        35 C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~---f~------~~~~l~~h~~~h--~~k----~~~C~~C~~~f   99 (159)
                      |..| ..|.+...|+.|+...|    +.+.|..|-..   |.      ....|+.|+...  +++    .-.|..|...|
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H----~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~f  192 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQH----KLHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERF  192 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhh----hhhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhh
Confidence            4444 34456666777765423    23344444321   21      224444454332  111    13466666666


Q ss_pred             cCccchhhhhhhhhhhhcccccccc------CccccchhhHHHhhccC
Q psy16646        100 KRDKHSKGDDIREEIEREMKTRNSI------GITVRQNQTNKNHRSGD  141 (159)
Q Consensus       100 ~~~~~l~~h~~~~~~~~~~~~C~~C------~~~f~~~~~l~~H~~~h  141 (159)
                      .....|.+|++.+|     |.|..|      +.-|.....|.+|.+-+
T Consensus       193 ld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~  235 (669)
T KOG2231|consen  193 LDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKG  235 (669)
T ss_pred             ccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhc
Confidence            66666666666555     333333      22355555666664443


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.01  E-value=0.017  Score=25.43  Aligned_cols=20  Identities=10%  Similarity=0.049  Sum_probs=13.5

Q ss_pred             ccccccCccccchhhHHHhhc
Q psy16646        119 KTRNSIGITVRQNQTNKNHRS  139 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~  139 (159)
                      ..|+.||+.| ....|..|..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4577788888 4556677754


No 50 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.88  E-value=0.0091  Score=26.74  Aligned_cols=22  Identities=18%  Similarity=0.412  Sum_probs=14.3

Q ss_pred             ccCccccccccCccchhhhhhh
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIR  111 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~  111 (159)
                      |.|..|++.|.....|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566777777776666666543


No 51 
>KOG2893|consensus
Probab=94.87  E-value=0.0052  Score=42.38  Aligned_cols=47  Identities=21%  Similarity=0.459  Sum_probs=27.5

Q ss_pred             CccccccccccccChhhHHHHHhhhCCCcccCccccccccCccchhhhhhh
Q psy16646         61 DRVICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRDKHSKGDDIR  111 (159)
Q Consensus        61 ~~~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~~~l~~h~~~  111 (159)
                      ++| |=.|...|.+...|.+|++.   +.|+|.+|-+.+.....|..|...
T Consensus        10 kpw-cwycnrefddekiliqhqka---khfkchichkkl~sgpglsihcmq   56 (341)
T KOG2893|consen   10 KPW-CWYCNREFDDEKILIQHQKA---KHFKCHICHKKLFSGPGLSIHCMQ   56 (341)
T ss_pred             Cce-eeecccccchhhhhhhhhhh---ccceeeeehhhhccCCCceeehhh
Confidence            455 44566666666666666542   356666666666665566655543


No 52 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.37  E-value=0.019  Score=43.12  Aligned_cols=63  Identities=17%  Similarity=0.104  Sum_probs=52.3

Q ss_pred             cccCccccccccCccchhhhhh--hhhhh--hcccccc--ccCccccchhhHHHhhccCCCccccccCcc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDI--REEIE--REMKTRN--SIGITVRQNQTNKNHRSGDQKKKTAKQLSM  152 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~--~~~~~--~~~~~C~--~C~~~f~~~~~l~~H~~~h~~~k~~~~~~~  152 (159)
                      ++.|..|...|.....|..|.+  .|.++  ++ +.|+  .|++.|.....+..|..+|.+.+++.+...
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  357 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLL  357 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCc-eeeeccCCCccccccccccCCcccccCCCccccccc
Confidence            6788889999999999999988  78888  77 8888  799999999888899888888776665543


No 53 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.82  E-value=0.042  Score=26.00  Aligned_cols=23  Identities=13%  Similarity=0.107  Sum_probs=19.6

Q ss_pred             ccccccCccccchhhHHHhhccC
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGD  141 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h  141 (159)
                      |.|+.|+..|.....+..|+...
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             eEccccCCccCCHHHHHHHHChH
Confidence            77999999999988999997653


No 54 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=92.94  E-value=0.035  Score=38.35  Aligned_cols=44  Identities=16%  Similarity=0.205  Sum_probs=25.0

Q ss_pred             CcccCccccccccCccchhhhhhhh----------hhhhc----cccccccCccccch
Q psy16646         88 AQHKCSLCQQAFKRDKHSKGDDIRE----------EIERE----MKTRNSIGITVRQN  131 (159)
Q Consensus        88 k~~~C~~C~~~f~~~~~l~~h~~~~----------~~~~~----~~~C~~C~~~f~~~  131 (159)
                      +...|+.|++.|.....+....+.-          .+..|    +..|+.||..|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            4566777777776654444444321          11111    16789999887644


No 55 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.93  E-value=0.067  Score=25.21  Aligned_cols=8  Identities=13%  Similarity=-0.118  Sum_probs=4.6

Q ss_pred             ccccccCc
Q psy16646        119 KTRNSIGI  126 (159)
Q Consensus       119 ~~C~~C~~  126 (159)
                      +.|+.||.
T Consensus        18 ~~CP~Cg~   25 (33)
T cd00350          18 WVCPVCGA   25 (33)
T ss_pred             CcCcCCCC
Confidence            55666654


No 56 
>KOG2893|consensus
Probab=92.81  E-value=0.047  Score=37.83  Aligned_cols=46  Identities=24%  Similarity=0.689  Sum_probs=38.1

Q ss_pred             ccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHH-Hhhh
Q psy16646         34 HCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEH-RVLH   85 (159)
Q Consensus        34 ~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h-~~~h   85 (159)
                      +|=+|++-|.....|.+|++.      +.|.|.+|.+.+.+-..|..| +..|
T Consensus        12 wcwycnrefddekiliqhqka------khfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA------KHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeeecccccchhhhhhhhhhh------ccceeeeehhhhccCCCceeehhhhh
Confidence            677899999999999999877      789999999987777777777 3444


No 57 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.58  E-value=0.12  Score=24.40  Aligned_cols=23  Identities=17%  Similarity=0.515  Sum_probs=14.5

Q ss_pred             ccccccccccccChHHHHHHHhh
Q psy16646         32 QFHCYVCKKKYRHKRQLVRHFQV   54 (159)
Q Consensus        32 ~~~C~~c~~~f~~~~~l~~h~~~   54 (159)
                      +|.|..|+..|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            45666677766666666666543


No 58 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.22  E-value=0.11  Score=31.77  Aligned_cols=25  Identities=16%  Similarity=0.209  Sum_probs=22.6

Q ss_pred             ccc----cccCccccchhhHHHhhccCCC
Q psy16646        119 KTR----NSIGITVRQNQTNKNHRSGDQK  143 (159)
Q Consensus       119 ~~C----~~C~~~f~~~~~l~~H~~~h~~  143 (159)
                      |.|    ..|++.+.+...++.|++.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            999    9999999999999999887654


No 59 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.40  E-value=0.36  Score=29.67  Aligned_cols=49  Identities=18%  Similarity=0.012  Sum_probs=31.4

Q ss_pred             cCccccccccCccchhhhhhhhhhhhccccccccCccccchhhHHHhhccCC
Q psy16646         91 KCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHRSGDQ  142 (159)
Q Consensus        91 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  142 (159)
                      .|..|...|........-   ...+...|.|+.|..-|--.-..-.|...|.
T Consensus        57 ~C~~C~~~f~~~~~~~~~---~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFD---ELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCccccccc---ccccccceeCCCCCCccccccchhhhhhccC
Confidence            388888888764321100   0112223889999999888877778877776


No 60 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=91.34  E-value=0.077  Score=25.73  Aligned_cols=34  Identities=21%  Similarity=0.461  Sum_probs=22.6

Q ss_pred             ccCCCCCCCCCCCCCcccCCCCCcccccccccccc
Q psy16646          9 VKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKYR   43 (159)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f~   43 (159)
                      ..||+|...|.....+.. .+.....|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~l~-~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKLP-AGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHHcc-cCCcEEECCCCCcEee
Confidence            468888888886665422 4444678888877663


No 61 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.08  E-value=0.068  Score=28.18  Aligned_cols=20  Identities=15%  Similarity=0.190  Sum_probs=11.2

Q ss_pred             ccccccCccccchhhHHHhh
Q psy16646        119 KTRNSIGITVRQNQTNKNHR  138 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~  138 (159)
                      +.|+.||..|....++..|.
T Consensus        18 lrCPRC~~~FR~~K~Y~RHV   37 (65)
T COG4049          18 LRCPRCGMVFRRRKDYIRHV   37 (65)
T ss_pred             eeCCchhHHHHHhHHHHHHh
Confidence            55555555555555555553


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.50  E-value=0.11  Score=39.09  Aligned_cols=59  Identities=22%  Similarity=0.347  Sum_probs=51.8

Q ss_pred             ccccccccccccChhhHHHHHh--hh-CC--CcccCc--cccccccCccchhhhhhhhhhhhccccc
Q psy16646         62 RVICEICNKEFTHKSSLAEHRV--LH-FP--AQHKCS--LCQQAFKRDKHSKGDDIREEIEREMKTR  121 (159)
Q Consensus        62 ~~~c~~c~~~f~~~~~l~~h~~--~h-~~--k~~~C~--~C~~~f~~~~~l~~h~~~~~~~~~~~~C  121 (159)
                      ++.|..|...|.....+..|.+  .| ++  +++.|.  .|++.|.+...+..|...+++..+ +.+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~  354 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP-AKE  354 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCc-ccc
Confidence            5778889999999999999988  78 77  899999  799999999999999999988876 555


No 63 
>PF12907 zf-met2:  Zinc-binding
Probab=90.42  E-value=0.097  Score=25.85  Aligned_cols=35  Identities=17%  Similarity=0.051  Sum_probs=24.1

Q ss_pred             ccccccCccccc---hhhHHHhhc-cCCCccccccCccc
Q psy16646        119 KTRNSIGITVRQ---NQTNKNHRS-GDQKKKTAKQLSML  153 (159)
Q Consensus       119 ~~C~~C~~~f~~---~~~l~~H~~-~h~~~k~~~~~~~~  153 (159)
                      +.|..|-..|..   ...|..|.. -|.+....+|++.|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~CFP~l   40 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTFEECFPNL   40 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHcCCCC
Confidence            568888866644   456888844 57776677777764


No 64 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.40  E-value=0.084  Score=27.83  Aligned_cols=29  Identities=17%  Similarity=0.206  Sum_probs=23.4

Q ss_pred             CCCcccCccccccccCccchhhhhhhhhh
Q psy16646         86 FPAQHKCSLCQQAFKRDKHSKGDDIREEI  114 (159)
Q Consensus        86 ~~k~~~C~~C~~~f~~~~~l~~h~~~~~~  114 (159)
                      ||.-+.|+.||..|....+..+|+...|+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            56667899999999888888888876665


No 65 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=90.33  E-value=0.12  Score=24.85  Aligned_cols=33  Identities=15%  Similarity=0.424  Sum_probs=21.7

Q ss_pred             ccCCCCCCCCCCCCCcccCCCCCccccccccccc
Q psy16646          9 VKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKY   42 (159)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f   42 (159)
                      ..||+|..+|...+.+.. .......|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~ip-~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKIP-PKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHHCC-CCCcEEECCCCCCEe
Confidence            457888888887666533 333457787777665


No 66 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=89.58  E-value=0.099  Score=25.37  Aligned_cols=33  Identities=18%  Similarity=0.435  Sum_probs=17.9

Q ss_pred             ccCCCCCCCCCCCCCcccCCCCCccccccccccc
Q psy16646          9 VKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKY   42 (159)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f   42 (159)
                      +.||+|...+........-.+ ....|+.|+..|
T Consensus         3 ~~CP~C~~~~~v~~~~~~~~~-~~v~C~~C~~~~   35 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLGANG-GKVRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEEEeCHHHcCCCC-CEEECCCCCCEE
Confidence            457777777665443322222 245677776655


No 67 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=89.00  E-value=0.37  Score=23.21  Aligned_cols=35  Identities=20%  Similarity=0.261  Sum_probs=27.5

Q ss_pred             hhhhcccCCCCCCCCCCCCCcccCCCCCccccccc
Q psy16646          4 MKKKSVKNPNAKKRYRPYVPRVDSSLPPQFHCYVC   38 (159)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c   38 (159)
                      |-+..+.||.|........+=....|...|.|..|
T Consensus         1 Ma~i~v~CP~C~s~~~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    1 MAKIDVHCPRCQSTEGVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             CCcEeeeCCCCCCCCcceeCCCCCCCCEeEecCcC
Confidence            45667889999888877777777777778888776


No 68 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=88.68  E-value=0.16  Score=33.19  Aligned_cols=12  Identities=25%  Similarity=0.786  Sum_probs=5.8

Q ss_pred             ccCccccccccC
Q psy16646         90 HKCSLCQQAFKR  101 (159)
Q Consensus        90 ~~C~~C~~~f~~  101 (159)
                      +.|+.||..|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            445555555444


No 69 
>KOG1146|consensus
Probab=87.71  E-value=0.21  Score=42.75  Aligned_cols=90  Identities=13%  Similarity=0.126  Sum_probs=55.3

Q ss_pred             cccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHhhhCCCcccCccccccccCccchhhhhhhh
Q psy16646         33 FHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRDKHSKGDDIRE  112 (159)
Q Consensus        33 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~~~l~~h~~~~  112 (159)
                      +.|..|+..+.....+. ++-.    . .+|.|..|...|.....|..|++.          |-+.+.......-+.-.+
T Consensus      1261 ~~c~~~~~~~~~~~~~~-~l~~----~-~~~~~~~~~~~~~~~~~l~~~~~k----------~~~~~~~~~~~~~~~l~~ 1324 (1406)
T KOG1146|consen 1261 GECGAVDELLTPSFGIS-TLDV----T-HRYLCRQCKMAFDGEAPLTAHQRK----------FCFAGRGSGGSMPPPLRV 1324 (1406)
T ss_pred             chhhhccccccCcccee-eccc----c-hhHHHHHHHhhhcchhHHHHHHHH----------HHhccCccccCCCCcccC
Confidence            66777777776655555 4332    2 567888888888888888777622          222333333333333333


Q ss_pred             hhhhccccccccCccccchhhHHHhhcc
Q psy16646        113 EIEREMKTRNSIGITVRQNQTNKNHRSG  140 (159)
Q Consensus       113 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~  140 (159)
                      -.... | |..|...|.....|..|.++
T Consensus      1325 ~d~~~-~-c~~c~~~~~~~~alqihm~~ 1350 (1406)
T KOG1146|consen 1325 PDCTY-H-CLACEVLLSGREALQIHMRS 1350 (1406)
T ss_pred             ccccc-c-chHHHhhcchhHHHHHHHHH
Confidence            33333 5 88888888888888888665


No 70 
>KOG2186|consensus
Probab=86.36  E-value=0.32  Score=34.09  Aligned_cols=52  Identities=17%  Similarity=0.336  Sum_probs=32.8

Q ss_pred             cccccccccccChhhHHHHHhhhCCCcccCccccccccCccchhhhhhhhhhhh
Q psy16646         63 VICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRDKHSKGDDIREEIER  116 (159)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~  116 (159)
                      |.|..||.+..- ..+..|+..-....|.|-.||+.|.+ .+...|..--+...
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~kCITEaQ   55 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTKCITEAQ   55 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccCCeeEEeeccccccc-chhhhhhhhcchHH
Confidence            678888876654 33555654432367788888888887 55566766444333


No 71 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=86.14  E-value=0.33  Score=23.04  Aligned_cols=8  Identities=13%  Similarity=0.048  Sum_probs=4.3

Q ss_pred             ccccccCc
Q psy16646        119 KTRNSIGI  126 (159)
Q Consensus       119 ~~C~~C~~  126 (159)
                      ..|+.||.
T Consensus        19 ~~CP~Cg~   26 (34)
T cd00729          19 EKCPICGA   26 (34)
T ss_pred             CcCcCCCC
Confidence            45555554


No 72 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=84.86  E-value=0.5  Score=23.86  Aligned_cols=11  Identities=18%  Similarity=0.452  Sum_probs=6.3

Q ss_pred             ccCcccccccc
Q psy16646         90 HKCSLCQQAFK  100 (159)
Q Consensus        90 ~~C~~C~~~f~  100 (159)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            55666665544


No 73 
>KOG4173|consensus
Probab=84.52  E-value=0.4  Score=32.63  Aligned_cols=77  Identities=17%  Similarity=0.324  Sum_probs=52.0

Q ss_pred             ccccc--ccccccChhhHHHHHhh-hCCCcccCccccccccCccchhhhhhhhhh---------hhccccc--cccCccc
Q psy16646         63 VICEI--CNKEFTHKSSLAEHRVL-HFPAQHKCSLCQQAFKRDKHSKGDDIREEI---------EREMKTR--NSIGITV  128 (159)
Q Consensus        63 ~~c~~--c~~~f~~~~~l~~h~~~-h~~k~~~C~~C~~~f~~~~~l~~h~~~~~~---------~~~~~~C--~~C~~~f  128 (159)
                      +.|..  |...|.+...+..|..+ |+   -.|..|.+.|.+.--|..|+.-+|.         ..+.|.|  ..|+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            45665  66677776666666433 32   3688898999888888888754332         2456888  7899999


Q ss_pred             cchhhHHHh-hccCC
Q psy16646        129 RQNQTNKNH-RSGDQ  142 (159)
Q Consensus       129 ~~~~~l~~H-~~~h~  142 (159)
                      .+...-..| +++|.
T Consensus       157 kT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  157 KTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhHHHHhcc
Confidence            888777777 44443


No 74 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.21  E-value=0.36  Score=23.63  Aligned_cols=30  Identities=13%  Similarity=0.256  Sum_probs=15.8

Q ss_pred             cccCCCCCCCCCCCCCcccCCCCCccccccccc
Q psy16646          8 SVKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKK   40 (159)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~   40 (159)
                      .+.|+.|+..|........   .....|+.||.
T Consensus         5 ~y~C~~Cg~~fe~~~~~~~---~~~~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKISD---DPLATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEecCC---CCCCCCCCCCC
Confidence            3566666666664433322   33445666664


No 75 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=84.12  E-value=0.45  Score=26.81  Aligned_cols=42  Identities=21%  Similarity=0.267  Sum_probs=21.5

Q ss_pred             ccCccccccccCccchhhhhhhhhhhhcccccc--ccCccccchhhH
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDIREEIEREMKTRN--SIGITVRQNQTN  134 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~--~C~~~f~~~~~l  134 (159)
                      +.|+.||....-..+-....  ...++ ++.|.  +||.+|....++
T Consensus         2 m~CP~Cg~~a~irtSr~~s~--~~~~~-Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITD--TTKER-YHQCQNVNCSATFITYESV   45 (72)
T ss_pred             ccCCCCCCccEEEEChhcCh--hhhee-eeecCCCCCCCEEEEEEEE
Confidence            35777775543222222111  13333 37776  788888766554


No 76 
>PF14353 CpXC:  CpXC protein
Probab=83.75  E-value=0.43  Score=30.06  Aligned_cols=21  Identities=10%  Similarity=0.018  Sum_probs=11.8

Q ss_pred             ccCCCCCCCCCCCCCcccCCC
Q psy16646          9 VKNPNAKKRYRPYVPRVDSSL   29 (159)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~h~~   29 (159)
                      ..||+|+..|.......+...
T Consensus         2 itCP~C~~~~~~~v~~~I~~~   22 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINAD   22 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCc
Confidence            357777777665444444433


No 77 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=83.70  E-value=0.22  Score=24.42  Aligned_cols=33  Identities=15%  Similarity=0.357  Sum_probs=17.1

Q ss_pred             cCCCCCCCCCCCCCcccCCCCCc----cccccccccc
Q psy16646         10 KNPNAKKRYRPYVPRVDSSLPPQ----FHCYVCKKKY   42 (159)
Q Consensus        10 ~~~~~~~~~~~~~~~~~h~~~~~----~~C~~c~~~f   42 (159)
                      +||+|+.+-.......+..++.+    |.|..|+..|
T Consensus         2 ~Cp~Cg~~~a~~~~~Q~rsaDE~~T~fy~C~~C~~~w   38 (39)
T PF01096_consen    2 KCPKCGHNEAVFFQIQTRSADEPMTLFYVCCNCGHRW   38 (39)
T ss_dssp             --SSS-SSEEEEEEESSSSSSSSSEEEEEESSSTEEE
T ss_pred             CCcCCCCCeEEEEEeeccCCCCCCeEEEEeCCCCCee
Confidence            57777776654444444444444    6677777654


No 78 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=83.58  E-value=0.33  Score=31.42  Aligned_cols=14  Identities=29%  Similarity=0.816  Sum_probs=8.3

Q ss_pred             CccccccccccccC
Q psy16646         31 PQFHCYVCKKKYRH   44 (159)
Q Consensus        31 ~~~~C~~c~~~f~~   44 (159)
                      .-|.|+.|+..|..
T Consensus        98 ~~Y~Cp~C~~~y~~  111 (147)
T smart00531       98 AYYKCPNCQSKYTF  111 (147)
T ss_pred             cEEECcCCCCEeeH
Confidence            34666666666653


No 79 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=83.52  E-value=0.97  Score=33.36  Aligned_cols=12  Identities=8%  Similarity=-0.047  Sum_probs=7.3

Q ss_pred             cccchhhHHHhh
Q psy16646        127 TVRQNQTNKNHR  138 (159)
Q Consensus       127 ~f~~~~~l~~H~  138 (159)
                      .|.....|..|+
T Consensus       290 vf~~~~el~~h~  301 (493)
T COG5236         290 VFPYHTELLEHL  301 (493)
T ss_pred             EeccHHHHHHHH
Confidence            366666666663


No 80 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=82.32  E-value=0.64  Score=22.92  Aligned_cols=33  Identities=15%  Similarity=0.377  Sum_probs=16.4

Q ss_pred             cCCCCCCCCCCCCCcccCCCCCc----cccccccccc
Q psy16646         10 KNPNAKKRYRPYVPRVDSSLPPQ----FHCYVCKKKY   42 (159)
Q Consensus        10 ~~~~~~~~~~~~~~~~~h~~~~~----~~C~~c~~~f   42 (159)
                      +||+|+.+-.....+.+...+.+    |.|..|+..|
T Consensus         2 ~Cp~C~~~~a~~~q~Q~RsaDE~mT~fy~C~~C~~~w   38 (40)
T smart00440        2 PCPKCGNREATFFQLQTRSADEPMTVFYVCTKCGHRW   38 (40)
T ss_pred             cCCCCCCCeEEEEEEcccCCCCCCeEEEEeCCCCCEe
Confidence            57777655443333333333333    5666666544


No 81 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=82.22  E-value=0.71  Score=23.42  Aligned_cols=29  Identities=10%  Similarity=0.107  Sum_probs=16.2

Q ss_pred             cccCCCCCCCCCCCCCcccCCCCCccccccccccc
Q psy16646          8 SVKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKY   42 (159)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f   42 (159)
                      .+.||+|+..+.......      ...|+.||..+
T Consensus         3 ~y~C~~CG~~~~~~~~~~------~~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDEYGT------GVRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECCCCC------ceECCCCCCeE
Confidence            466777776665432221      46677776543


No 82 
>KOG1146|consensus
Probab=82.11  E-value=0.37  Score=41.40  Aligned_cols=25  Identities=8%  Similarity=0.062  Sum_probs=19.4

Q ss_pred             CCcccCccccccccCccchhhhhhh
Q psy16646         87 PAQHKCSLCQQAFKRDKHSKGDDIR  111 (159)
Q Consensus        87 ~k~~~C~~C~~~f~~~~~l~~h~~~  111 (159)
                      .++|.|..|...+.....|.+|++.
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHH
Confidence            3578888888888888888888753


No 83 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=81.90  E-value=0.85  Score=24.51  Aligned_cols=10  Identities=20%  Similarity=0.624  Sum_probs=5.4

Q ss_pred             CCcccCcccc
Q psy16646         87 PAQHKCSLCQ   96 (159)
Q Consensus        87 ~k~~~C~~C~   96 (159)
                      ..+|.|+.||
T Consensus        48 g~~Y~Cp~CG   57 (61)
T COG2888          48 GNPYRCPKCG   57 (61)
T ss_pred             CCceECCCcC
Confidence            3455555555


No 84 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=80.88  E-value=0.59  Score=24.30  Aligned_cols=29  Identities=17%  Similarity=0.305  Sum_probs=15.7

Q ss_pred             ccCCCCCCCCCCCCCcccCCCCCccccccccc
Q psy16646          9 VKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKK   40 (159)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~   40 (159)
                      |.|+.|+..|..+.....   +....|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~---~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMSD---DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecCC---CCCCCCCCCCC
Confidence            566666666665433322   34445666664


No 85 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=80.88  E-value=0.67  Score=23.95  Aligned_cols=11  Identities=27%  Similarity=0.763  Sum_probs=6.2

Q ss_pred             cccCccccccc
Q psy16646         89 QHKCSLCQQAF   99 (159)
Q Consensus        89 ~~~C~~C~~~f   99 (159)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            35566666555


No 86 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=80.72  E-value=1.2  Score=27.34  Aligned_cols=29  Identities=21%  Similarity=0.565  Sum_probs=16.3

Q ss_pred             ccccccccccChhhHHHHHhhhCCCcccCccccccccCc
Q psy16646         64 ICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRD  102 (159)
Q Consensus        64 ~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~  102 (159)
                      .|..||..|-...          -.|..|++||..|...
T Consensus        11 ~Cp~CG~kFYDLn----------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   11 TCPSCGAKFYDLN----------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCcchhccCC----------CCCccCCCCCCccCcc
Confidence            5666666553311          1366677777666655


No 87 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=79.86  E-value=1  Score=29.75  Aligned_cols=8  Identities=25%  Similarity=0.841  Sum_probs=4.9

Q ss_pred             cccCcccc
Q psy16646         89 QHKCSLCQ   96 (159)
Q Consensus        89 ~~~C~~C~   96 (159)
                      .|.|++||
T Consensus       134 ~~vC~vCG  141 (166)
T COG1592         134 VWVCPVCG  141 (166)
T ss_pred             EEEcCCCC
Confidence            46666665


No 88 
>KOG3408|consensus
Probab=79.76  E-value=0.48  Score=29.36  Aligned_cols=36  Identities=14%  Similarity=0.012  Sum_probs=19.9

Q ss_pred             ccccccCccccchhhHHHhhccCCCccccccCccch
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGDQKKKTAKQLSMLN  154 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~~~~~~~  154 (159)
                      |.|-.|.+-|.+...|..|.++-..++..+.+.-.|
T Consensus        58 fyCi~CaRyFi~~~~l~~H~ktK~HKrRvK~l~~~P   93 (129)
T KOG3408|consen   58 FYCIECARYFIDAKALKTHFKTKVHKRRVKELREVP   93 (129)
T ss_pred             eehhhhhhhhcchHHHHHHHhccHHHHHHHhcccCC
Confidence            556666666666666666665544444444444333


No 89 
>PHA02998 RNA polymerase subunit; Provisional
Probab=79.23  E-value=1.1  Score=29.90  Aligned_cols=37  Identities=19%  Similarity=0.321  Sum_probs=23.3

Q ss_pred             hcccCCCCCCCCCCCCCcccCCCCCc----ccccccccccc
Q psy16646          7 KSVKNPNAKKRYRPYVPRVDSSLPPQ----FHCYVCKKKYR   43 (159)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~h~~~~~----~~C~~c~~~f~   43 (159)
                      ...+||.|+..-.....+.+...+.|    |.|..||..|.
T Consensus       142 t~v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG~~wk  182 (195)
T PHA02998        142 YNTPCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCKKHFK  182 (195)
T ss_pred             cCCCCCCCCCCceEEEEEeeccCCCCceEEEEcCCCCCccC
Confidence            45677777766665555555555544    56777776654


No 90 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=78.77  E-value=0.65  Score=30.50  Aligned_cols=31  Identities=13%  Similarity=0.054  Sum_probs=20.6

Q ss_pred             CcccCccccccccCccchhhhhhhhhhhhccccccccCccc
Q psy16646         88 AQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITV  128 (159)
Q Consensus        88 k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f  128 (159)
                      .-|.|+.|+..|+....+.         -. |.|+.||...
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~---------~~-F~Cp~Cg~~L  138 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME---------LN-FTCPRCGAML  138 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH---------cC-CcCCCCCCEe
Confidence            3577888887777665543         13 8888888764


No 91 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=78.48  E-value=0.66  Score=31.12  Aligned_cols=32  Identities=16%  Similarity=0.200  Sum_probs=21.2

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccccccCccccc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQ  130 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~  130 (159)
                      -|.|+.|+..|+....+.         -. |.|+.||-....
T Consensus       117 ~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L~~  148 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME---------YG-FRCPQCGEMLEE  148 (178)
T ss_pred             EEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCCee
Confidence            577888887777664432         23 888888876433


No 92 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=78.27  E-value=0.98  Score=26.31  Aligned_cols=12  Identities=33%  Similarity=0.728  Sum_probs=5.7

Q ss_pred             cccCcccccccc
Q psy16646         89 QHKCSLCQQAFK  100 (159)
Q Consensus        89 ~~~C~~C~~~f~  100 (159)
                      -|.|..||..|.
T Consensus        53 IW~C~kCg~~fA   64 (89)
T COG1997          53 IWKCRKCGAKFA   64 (89)
T ss_pred             eEEcCCCCCeec
Confidence            344555544443


No 93 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=78.06  E-value=0.65  Score=23.13  Aligned_cols=12  Identities=0%  Similarity=0.122  Sum_probs=5.6

Q ss_pred             ccCCCCCCCCCC
Q psy16646          9 VKNPNAKKRYRP   20 (159)
Q Consensus         9 ~~~~~~~~~~~~   20 (159)
                      |.|+.|+..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            344444444443


No 94 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=74.73  E-value=1.6  Score=23.49  Aligned_cols=8  Identities=25%  Similarity=0.165  Sum_probs=4.3

Q ss_pred             ccccccCc
Q psy16646        119 KTRNSIGI  126 (159)
Q Consensus       119 ~~C~~C~~  126 (159)
                      |.|+.||.
T Consensus        49 Y~CP~CGF   56 (59)
T PRK14890         49 YTCPKCGF   56 (59)
T ss_pred             eECCCCCC
Confidence            55555554


No 95 
>KOG2186|consensus
Probab=74.27  E-value=2.3  Score=30.04  Aligned_cols=46  Identities=30%  Similarity=0.571  Sum_probs=31.8

Q ss_pred             cccccccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHh
Q psy16646         33 FHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRV   83 (159)
Q Consensus        33 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~   83 (159)
                      |.|..||.+.. ...+..|+.. -++  .-|.|--|+..|.. .++..|..
T Consensus         4 FtCnvCgEsvK-Kp~vekH~sr-Crn--~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSR-CRN--AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHh-ccC--CeeEEeeccccccc-chhhhhhh
Confidence            67888887654 4567778765 344  45788888888887 55666644


No 96 
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=73.70  E-value=1.6  Score=26.93  Aligned_cols=11  Identities=18%  Similarity=0.588  Sum_probs=6.2

Q ss_pred             ccccccccccc
Q psy16646         63 VICEICNKEFT   73 (159)
Q Consensus        63 ~~c~~c~~~f~   73 (159)
                      |.|..||..|.
T Consensus       101 y~C~~Cg~~wr  111 (113)
T COG1594         101 YKCTRCGYRWR  111 (113)
T ss_pred             EEecccCCEee
Confidence            55666665543


No 97 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=73.69  E-value=2.5  Score=21.80  Aligned_cols=21  Identities=10%  Similarity=0.132  Sum_probs=12.7

Q ss_pred             ccccccCccccch-----hhHHHhhc
Q psy16646        119 KTRNSIGITVRQN-----QTNKNHRS  139 (159)
Q Consensus       119 ~~C~~C~~~f~~~-----~~l~~H~~  139 (159)
                      -.|..|++.+...     +.|..|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4566666666443     46666665


No 98 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=73.57  E-value=2.5  Score=26.78  Aligned_cols=39  Identities=13%  Similarity=0.171  Sum_probs=23.9

Q ss_pred             hhhcccCCCCCCCCCCCCCcccCCCCCccccccccccccC
Q psy16646          5 KKKSVKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKYRH   44 (159)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f~~   44 (159)
                      -+....||.|..-. ....-....+...|.|..|+++|..
T Consensus        27 ~~~~~~cP~C~s~~-~~k~g~~~~~~qRyrC~~C~~tf~~   65 (129)
T COG3677          27 QITKVNCPRCKSSN-VVKIGGIRRGHQRYKCKSCGSTFTV   65 (129)
T ss_pred             hcccCcCCCCCccc-eeeECCccccccccccCCcCcceee
Confidence            33456777777666 3333334444666888888877753


No 99 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=73.52  E-value=2.7  Score=18.52  Aligned_cols=19  Identities=11%  Similarity=-0.106  Sum_probs=13.2

Q ss_pred             cccccCccccchhhHHHhhc
Q psy16646        120 TRNSIGITVRQNQTNKNHRS  139 (159)
Q Consensus       120 ~C~~C~~~f~~~~~l~~H~~  139 (159)
                      .|+.|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            578888877 5556777764


No 100
>PHA00626 hypothetical protein
Probab=71.93  E-value=1.7  Score=23.09  Aligned_cols=14  Identities=7%  Similarity=-0.062  Sum_probs=11.9

Q ss_pred             cccccccCccccch
Q psy16646        118 MKTRNSIGITVRQN  131 (159)
Q Consensus       118 ~~~C~~C~~~f~~~  131 (159)
                      .|+|+.||+.|+..
T Consensus        23 rYkCkdCGY~ft~~   36 (59)
T PHA00626         23 DYVCCDCGYNDSKD   36 (59)
T ss_pred             ceEcCCCCCeechh
Confidence            39999999999764


No 101
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=71.51  E-value=1.9  Score=19.04  Aligned_cols=10  Identities=10%  Similarity=-0.004  Sum_probs=6.5

Q ss_pred             cccccCcccc
Q psy16646        120 TRNSIGITVR  129 (159)
Q Consensus       120 ~C~~C~~~f~  129 (159)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            3777777664


No 102
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=71.48  E-value=3.4  Score=34.03  Aligned_cols=25  Identities=20%  Similarity=0.348  Sum_probs=13.2

Q ss_pred             ccCCCCCCCCCCCCCcccCCCCCcccccccc
Q psy16646          9 VKNPNAKKRYRPYVPRVDSSLPPQFHCYVCK   39 (159)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~   39 (159)
                      .+||+|+..      +..|...+...|..||
T Consensus       445 ~~Cp~Cd~~------lt~H~~~~~L~CH~Cg  469 (730)
T COG1198         445 AECPNCDSP------LTLHKATGQLRCHYCG  469 (730)
T ss_pred             ccCCCCCcc------eEEecCCCeeEeCCCC
Confidence            455655543      3444444555666665


No 103
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=70.96  E-value=2.4  Score=22.57  Aligned_cols=42  Identities=14%  Similarity=0.057  Sum_probs=17.3

Q ss_pred             cccCcc-ccccccCccchhhhhhhhhhhhccccccc----cCccccch
Q psy16646         89 QHKCSL-CQQAFKRDKHSKGDDIREEIEREMKTRNS----IGITVRQN  131 (159)
Q Consensus        89 ~~~C~~-C~~~f~~~~~l~~h~~~~~~~~~~~~C~~----C~~~f~~~  131 (159)
                      +..|+. |+..-.....|..|+...-..++ ..|+.    |+..+...
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~-v~C~~~~~GC~~~~~~~   55 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENECPKRP-VPCPYSPYGCKERVPRE   55 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTSTTSE-EE-SS----S--EEEHH
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccCCCCc-EECCCCCCCCCCccchh
Confidence            445555 33222223456666654444444 55665    66655443


No 104
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=70.14  E-value=3  Score=20.74  Aligned_cols=20  Identities=15%  Similarity=0.165  Sum_probs=9.6

Q ss_pred             ccccccCccccch----hhHHHhh
Q psy16646        119 KTRNSIGITVRQN----QTNKNHR  138 (159)
Q Consensus       119 ~~C~~C~~~f~~~----~~l~~H~  138 (159)
                      ..|..|++.+...    +.|..|+
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhh
Confidence            5566666665442    4566665


No 105
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=69.90  E-value=1.9  Score=27.44  Aligned_cols=28  Identities=21%  Similarity=0.195  Sum_probs=17.0

Q ss_pred             CCcccCccccccccCccchhhhhhhhhhhhc
Q psy16646         87 PAQHKCSLCQQAFKRDKHSKGDDIREEIERE  117 (159)
Q Consensus        87 ~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~  117 (159)
                      +.-..|-+||+.|..   |.+|++.|+|-.+
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCCCH
Confidence            345789999998865   5999999977543


No 106
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=69.02  E-value=3  Score=19.48  Aligned_cols=10  Identities=10%  Similarity=0.036  Sum_probs=5.3

Q ss_pred             ccccccCccc
Q psy16646        119 KTRNSIGITV  128 (159)
Q Consensus       119 ~~C~~C~~~f  128 (159)
                      ..|+.||.+.
T Consensus        18 irC~~CG~RI   27 (32)
T PF03604_consen   18 IRCPECGHRI   27 (32)
T ss_dssp             SSBSSSS-SE
T ss_pred             EECCcCCCeE
Confidence            4566666553


No 107
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=68.85  E-value=2  Score=26.23  Aligned_cols=25  Identities=16%  Similarity=0.234  Sum_probs=22.9

Q ss_pred             ccC----ccccccccCccchhhhhhhhhh
Q psy16646         90 HKC----SLCQQAFKRDKHSKGDDIREEI  114 (159)
Q Consensus        90 ~~C----~~C~~~f~~~~~l~~h~~~~~~  114 (159)
                      |.|    ..|+..+.....+..|++.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999998775


No 108
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=68.68  E-value=3.1  Score=26.33  Aligned_cols=15  Identities=27%  Similarity=0.569  Sum_probs=9.2

Q ss_pred             ccccccccccccChh
Q psy16646         62 RVICEICNKEFTHKS   76 (159)
Q Consensus        62 ~~~c~~c~~~f~~~~   76 (159)
                      |+.|..||..|.+.+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            456777777766543


No 109
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=68.30  E-value=1.8  Score=19.53  Aligned_cols=17  Identities=12%  Similarity=0.134  Sum_probs=7.4

Q ss_pred             cccccCccccchhhHHHh
Q psy16646        120 TRNSIGITVRQNQTNKNH  137 (159)
Q Consensus       120 ~C~~C~~~f~~~~~l~~H  137 (159)
                      .|-.|++.| ....+..|
T Consensus         2 sCiDC~~~F-~~~~y~~H   18 (28)
T PF08790_consen    2 SCIDCSKDF-DGDSYKSH   18 (28)
T ss_dssp             EETTTTEEE-EGGGTTT-
T ss_pred             eeecCCCCc-CcCCcCCC
Confidence            345555555 33334444


No 110
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=68.17  E-value=1.8  Score=29.94  Aligned_cols=30  Identities=20%  Similarity=0.475  Sum_probs=23.2

Q ss_pred             CCcccCccccccccCccchhhhhhhhhhhh
Q psy16646         87 PAQHKCSLCQQAFKRDKHSKGDDIREEIER  116 (159)
Q Consensus        87 ~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~  116 (159)
                      +..|.|..|+|.|........|+..-|.++
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            447999999999999999999998877764


No 111
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=67.52  E-value=4  Score=25.71  Aligned_cols=30  Identities=13%  Similarity=0.182  Sum_probs=16.7

Q ss_pred             cccccccccccChhhHHHHHhhhCCCcccCccccccccCc
Q psy16646         63 VICEICNKEFTHKSSLAEHRVLHFPAQHKCSLCQQAFKRD  102 (159)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C~~~f~~~  102 (159)
                      ..|..||..|-..          +..|..|++||..|...
T Consensus        10 r~Cp~cg~kFYDL----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc----------CCCCccCCCcCCccCcc
Confidence            3566666655331          12366677777666544


No 112
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=66.11  E-value=4.1  Score=21.17  Aligned_cols=8  Identities=13%  Similarity=-0.118  Sum_probs=4.1

Q ss_pred             ccccccCc
Q psy16646        119 KTRNSIGI  126 (159)
Q Consensus       119 ~~C~~C~~  126 (159)
                      |.|+.|+.
T Consensus        35 w~CP~C~a   42 (50)
T cd00730          35 WVCPVCGA   42 (50)
T ss_pred             CCCCCCCC
Confidence            45555543


No 113
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=65.55  E-value=3.5  Score=17.88  Aligned_cols=10  Identities=20%  Similarity=0.132  Sum_probs=7.6

Q ss_pred             hcccCCCCCC
Q psy16646          7 KSVKNPNAKK   16 (159)
Q Consensus         7 ~~~~~~~~~~   16 (159)
                      ..|.||+|+.
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            5788888863


No 114
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=65.45  E-value=4.2  Score=21.46  Aligned_cols=32  Identities=16%  Similarity=0.185  Sum_probs=22.5

Q ss_pred             ccCCCCCCCCCCCCCcccCCCCCccccccccc
Q psy16646          9 VKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKK   40 (159)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~   40 (159)
                      ..||.|+.+.+...-..+-...-|.-|+.|-.
T Consensus         5 i~CP~CgnKTR~kir~DT~LkNfPlyCpKCK~   36 (55)
T PF14205_consen    5 ILCPICGNKTRLKIREDTVLKNFPLYCPKCKQ   36 (55)
T ss_pred             EECCCCCCccceeeecCceeccccccCCCCCc
Confidence            46888888888766655555566777777764


No 115
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=65.04  E-value=2.9  Score=21.83  Aligned_cols=25  Identities=4%  Similarity=-0.266  Sum_probs=13.4

Q ss_pred             cccccccCccccchhhHHHhhccCC
Q psy16646        118 MKTRNSIGITVRQNQTNKNHRSGDQ  142 (159)
Q Consensus       118 ~~~C~~C~~~f~~~~~l~~H~~~h~  142 (159)
                      .|.|+.|+..|--.-.+-.|...|.
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             eEECCCCCCccccCcChhhhccccC
Confidence            3888888888877766667766664


No 116
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=63.30  E-value=8  Score=19.81  Aligned_cols=8  Identities=13%  Similarity=-0.118  Sum_probs=3.4

Q ss_pred             ccccccCc
Q psy16646        119 KTRNSIGI  126 (159)
Q Consensus       119 ~~C~~C~~  126 (159)
                      |.|+.|+.
T Consensus        35 w~CP~C~a   42 (47)
T PF00301_consen   35 WVCPVCGA   42 (47)
T ss_dssp             -B-TTTSS
T ss_pred             CcCcCCCC
Confidence            55666654


No 117
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=62.12  E-value=7.3  Score=27.79  Aligned_cols=19  Identities=16%  Similarity=0.291  Sum_probs=8.4

Q ss_pred             CcccCccccccccCccchh
Q psy16646         88 AQHKCSLCQQAFKRDKHSK  106 (159)
Q Consensus        88 k~~~C~~C~~~f~~~~~l~  106 (159)
                      +++.|+.||........|.
T Consensus       208 k~~PCPKCg~et~eTkdLS  226 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDLS  226 (314)
T ss_pred             CCCCCCCCCCcccccccce
Confidence            3445555554444333333


No 118
>KOG2482|consensus
Probab=61.27  E-value=9.2  Score=28.45  Aligned_cols=22  Identities=32%  Similarity=0.766  Sum_probs=15.6

Q ss_pred             cccccccccccChHHHHHHHhh
Q psy16646         33 FHCYVCKKKYRHKRQLVRHFQV   54 (159)
Q Consensus        33 ~~C~~c~~~f~~~~~l~~h~~~   54 (159)
                      +.|-.|.+.|.....|..||+.
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            5677777777777777777764


No 119
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=60.02  E-value=3.2  Score=21.47  Aligned_cols=13  Identities=23%  Similarity=0.468  Sum_probs=5.7

Q ss_pred             cccCccccccccC
Q psy16646         89 QHKCSLCQQAFKR  101 (159)
Q Consensus        89 ~~~C~~C~~~f~~  101 (159)
                      .+.|..||..|..
T Consensus         4 ~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    4 TLTCKDCGAEFVF   16 (49)
T ss_pred             eEEcccCCCeEEE
Confidence            3444444444433


No 120
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=59.86  E-value=2.9  Score=19.20  Aligned_cols=8  Identities=13%  Similarity=-0.068  Sum_probs=3.9

Q ss_pred             ccccccCc
Q psy16646        119 KTRNSIGI  126 (159)
Q Consensus       119 ~~C~~C~~  126 (159)
                      +.|+.|+.
T Consensus        20 ~vCp~C~~   27 (30)
T PF08274_consen   20 LVCPECGH   27 (30)
T ss_dssp             EEETTTTE
T ss_pred             EeCCcccc
Confidence            44555543


No 121
>KOG2482|consensus
Probab=58.80  E-value=18  Score=27.05  Aligned_cols=50  Identities=24%  Similarity=0.462  Sum_probs=33.1

Q ss_pred             ccccccccccccC-hhhHHHHHh-hhC---CC-------------------cccCccccccccCccchhhhhhh
Q psy16646         62 RVICEICNKEFTH-KSSLAEHRV-LHF---PA-------------------QHKCSLCQQAFKRDKHSKGDDIR  111 (159)
Q Consensus        62 ~~~c~~c~~~f~~-~~~l~~h~~-~h~---~k-------------------~~~C~~C~~~f~~~~~l~~h~~~  111 (159)
                      ..+|-.|...+.. .+.+..|.. .|+   +.                   .+.|.+|.+.|.....|+.|++.
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            4568888876543 455555643 342   12                   26888888888888888888864


No 122
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=57.83  E-value=9.4  Score=30.13  Aligned_cols=26  Identities=19%  Similarity=0.318  Sum_probs=16.0

Q ss_pred             ccCCCCCCCCCCCCCcccCCCCCccccccccc
Q psy16646          9 VKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKK   40 (159)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~   40 (159)
                      ..||+|+      ..+..|.......|..||.
T Consensus       223 ~~C~~C~------~~l~~h~~~~~l~Ch~Cg~  248 (505)
T TIGR00595       223 LCCPNCD------VSLTYHKKEGKLRCHYCGY  248 (505)
T ss_pred             cCCCCCC------CceEEecCCCeEEcCCCcC
Confidence            3455553      4566666666677777774


No 123
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=57.80  E-value=1.9  Score=26.12  Aligned_cols=33  Identities=18%  Similarity=0.184  Sum_probs=19.2

Q ss_pred             ccccccCccccchhhHHHhhccCCCccccccCc
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGDQKKKTAKQLS  151 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~~~~  151 (159)
                      +.|-.|.+-|.+...|..|.+........+.+.
T Consensus        56 hYCieCaryf~t~~aL~~HkkgkvHkRR~KelR   88 (126)
T COG5112          56 HYCIECARYFITEKALMEHKKGKVHKRRAKELR   88 (126)
T ss_pred             eeeehhHHHHHHHHHHHHHhccchhHHHHHHHh
Confidence            446667777777777777765544333333333


No 124
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=57.38  E-value=5.3  Score=25.51  Aligned_cols=14  Identities=21%  Similarity=0.508  Sum_probs=10.0

Q ss_pred             cccCccccccccCc
Q psy16646         89 QHKCSLCQQAFKRD  102 (159)
Q Consensus        89 ~~~C~~C~~~f~~~  102 (159)
                      .+.|..||..|...
T Consensus        70 ~~~C~~CG~~~~~~   83 (135)
T PRK03824         70 VLKCRNCGNEWSLK   83 (135)
T ss_pred             EEECCCCCCEEecc
Confidence            47788888777654


No 125
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=56.88  E-value=5.6  Score=24.09  Aligned_cols=8  Identities=38%  Similarity=1.173  Sum_probs=3.7

Q ss_pred             cccccccc
Q psy16646         63 VICEICNK   70 (159)
Q Consensus        63 ~~c~~c~~   70 (159)
                      ..|+.||.
T Consensus         3 ~~CpYCg~   10 (102)
T PF11672_consen    3 IICPYCGG   10 (102)
T ss_pred             cccCCCCC
Confidence            34555543


No 126
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=56.76  E-value=16  Score=17.68  Aligned_cols=31  Identities=23%  Similarity=0.203  Sum_probs=18.0

Q ss_pred             cccCCCCCCCCCCCCCcccCCCCCccccccccc
Q psy16646          8 SVKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKK   40 (159)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~   40 (159)
                      ..+||.|..+=+..  .....+...+.|..|+.
T Consensus         3 ~~pCP~CGG~DrFr--~~d~~g~G~~~C~~Cg~   33 (37)
T smart00778        3 HGPCPNCGGSDRFR--FDDKDGRGTWFCSVCGA   33 (37)
T ss_pred             ccCCCCCCCccccc--cccCCCCcCEEeCCCCC
Confidence            56788887744433  23333445677777753


No 127
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=56.40  E-value=11  Score=18.49  Aligned_cols=37  Identities=16%  Similarity=0.145  Sum_probs=19.0

Q ss_pred             cCCCCCCCCCCCCCcccCCCCCccccccccccccChHHHHH
Q psy16646         10 KNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKYRHKRQLVR   50 (159)
Q Consensus        10 ~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f~~~~~l~~   50 (159)
                      +||.|...-.   .... .+-.-..|+.|+..+.....|..
T Consensus         1 ~CP~C~~~l~---~~~~-~~~~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen    1 KCPRCGTELE---PVRL-GDVEIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             CcCCCCcccc---eEEE-CCEEEEECCCCCeEEccHHHHHH
Confidence            4677755222   1111 22344667777776665555543


No 128
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=56.39  E-value=7.5  Score=23.16  Aligned_cols=39  Identities=13%  Similarity=0.168  Sum_probs=13.4

Q ss_pred             CCcccCccccccccCccchhhhhhhhhhhhccccccccCccccch
Q psy16646         87 PAQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQN  131 (159)
Q Consensus        87 ~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~  131 (159)
                      .+.-.|..||.++..-      -.--.|++-.|.|+.|.+.|.+.
T Consensus        12 ~ke~~CalCG~tWg~~------y~Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   12 TKEMGCALCGATWGDY------YEEVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             SGGGS-SS---S---S------S-B-TT--BSSS--SSSS-TTS-
T ss_pred             cccccccccCCcHHHH------HHhhcCCEEEEEcHHHHHHHHHH
Confidence            3445566666655422      12245666656667777766654


No 129
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=55.53  E-value=6  Score=19.94  Aligned_cols=8  Identities=0%  Similarity=-0.280  Sum_probs=4.4

Q ss_pred             ccccccCc
Q psy16646        119 KTRNSIGI  126 (159)
Q Consensus       119 ~~C~~C~~  126 (159)
                      |+|..|++
T Consensus        38 ~~C~~C~~   45 (46)
T PF12760_consen   38 YRCKACRK   45 (46)
T ss_pred             EECCCCCC
Confidence            55655553


No 130
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=55.34  E-value=3.3  Score=24.44  Aligned_cols=11  Identities=36%  Similarity=0.912  Sum_probs=5.1

Q ss_pred             ccCcccccccc
Q psy16646         90 HKCSLCQQAFK  100 (159)
Q Consensus        90 ~~C~~C~~~f~  100 (159)
                      |.|..|++.|.
T Consensus        54 W~C~~C~~~~A   64 (90)
T PF01780_consen   54 WKCKKCGKKFA   64 (90)
T ss_dssp             EEETTTTEEEE
T ss_pred             eecCCCCCEEe
Confidence            44444444443


No 131
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=54.84  E-value=3.3  Score=28.91  Aligned_cols=41  Identities=12%  Similarity=0.187  Sum_probs=23.7

Q ss_pred             CCcccCccccccccCccchhhhhhhhhhhhc--------------cccccccCcc
Q psy16646         87 PAQHKCSLCQQAFKRDKHSKGDDIREEIERE--------------MKTRNSIGIT  127 (159)
Q Consensus        87 ~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~--------------~~~C~~C~~~  127 (159)
                      .+.+.|+.|+..|.....+..-+++-.|+-.              +..|+.|+..
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~yA   71 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYYA   71 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhHH
Confidence            4456677777777665554444444443321              1678888775


No 132
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=54.50  E-value=7.3  Score=19.23  Aligned_cols=12  Identities=17%  Similarity=0.174  Sum_probs=6.8

Q ss_pred             ccccccCccccc
Q psy16646        119 KTRNSIGITVRQ  130 (159)
Q Consensus       119 ~~C~~C~~~f~~  130 (159)
                      -.|+.||..|..
T Consensus        14 ~~C~~CgM~Y~~   25 (41)
T PF13878_consen   14 TTCPTCGMLYSP   25 (41)
T ss_pred             cCCCCCCCEECC
Confidence            346666666544


No 133
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=54.09  E-value=7.3  Score=22.96  Aligned_cols=13  Identities=23%  Similarity=0.731  Sum_probs=8.5

Q ss_pred             cccCccccccccC
Q psy16646         89 QHKCSLCQQAFKR  101 (159)
Q Consensus        89 ~~~C~~C~~~f~~  101 (159)
                      |-.|..||..|..
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            5667777766655


No 134
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=53.32  E-value=5.1  Score=26.06  Aligned_cols=34  Identities=21%  Similarity=0.302  Sum_probs=22.4

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccccccCccc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITV  128 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f  128 (159)
                      +|.|. |+..+.+.   .+|-..-.|+ . |.|..|+-..
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~-~-YrC~~C~gkL  150 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGE-V-YRCGKCGGKL  150 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccc-e-EEeccCCceE
Confidence            68888 88776554   4455545555 4 8888887643


No 135
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=53.16  E-value=6.1  Score=24.78  Aligned_cols=14  Identities=21%  Similarity=0.465  Sum_probs=7.5

Q ss_pred             cccCccccccccCc
Q psy16646         89 QHKCSLCQQAFKRD  102 (159)
Q Consensus        89 ~~~C~~C~~~f~~~  102 (159)
                      |--|..||..|++.
T Consensus        68 psfchncgs~fpwt   81 (160)
T COG4306          68 PSFCHNCGSRFPWT   81 (160)
T ss_pred             cchhhcCCCCCCcH
Confidence            44455566555543


No 136
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=52.85  E-value=2.7  Score=24.31  Aligned_cols=10  Identities=40%  Similarity=1.122  Sum_probs=2.7

Q ss_pred             CCcccccccc
Q psy16646         30 PPQFHCYVCK   39 (159)
Q Consensus        30 ~~~~~C~~c~   39 (159)
                      +..|.|+.|+
T Consensus        20 ~~~F~CPfC~   29 (81)
T PF05129_consen   20 PKVFDCPFCN   29 (81)
T ss_dssp             SS----TTT-
T ss_pred             CceEcCCcCC
Confidence            3446666665


No 137
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=52.57  E-value=7.6  Score=23.96  Aligned_cols=25  Identities=16%  Similarity=0.066  Sum_probs=15.4

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccccccCc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGI  126 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~  126 (159)
                      ...|..||..|....            . .+.|+.||.
T Consensus        70 ~~~C~~Cg~~~~~~~------------~-~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ------------H-DAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC------------c-CccCcCCCC
Confidence            367888886665432            1 155888874


No 138
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=52.48  E-value=4.9  Score=20.46  Aligned_cols=38  Identities=13%  Similarity=0.097  Sum_probs=19.3

Q ss_pred             CccccccccCccchhhhhhhhhhhhcccccc--ccCccccchh
Q psy16646         92 CSLCQQAFKRDKHSKGDDIREEIEREMKTRN--SIGITVRQNQ  132 (159)
Q Consensus        92 C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~--~C~~~f~~~~  132 (159)
                      |+.||....-..+...+   ....+.++.|.  +||..|....
T Consensus         2 CP~Cg~~a~ir~S~~~s---~~~~~~Y~qC~N~~Cg~tfv~~~   41 (47)
T PF04606_consen    2 CPHCGSKARIRTSRQLS---PLTRELYCQCTNPECGHTFVANL   41 (47)
T ss_pred             cCCCCCeeEEEEchhhC---cceEEEEEEECCCcCCCEEEEEE
Confidence            67777544333322211   12223447774  4888886543


No 139
>KOG4173|consensus
Probab=51.89  E-value=8.2  Score=26.53  Aligned_cols=75  Identities=25%  Similarity=0.515  Sum_probs=49.1

Q ss_pred             cccccc--ccccccChHHHHHHHhhhhcCCCCccccccccccccChhhHHHHHhh-h----------CCCcccCc--ccc
Q psy16646         32 QFHCYV--CKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHKSSLAEHRVL-H----------FPAQHKCS--LCQ   96 (159)
Q Consensus        32 ~~~C~~--c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~-h----------~~k~~~C~--~C~   96 (159)
                      .+.|+.  |-..|.....+..|....|.     ..|..|.+.|....-|..|+.- |          |.--|+|.  .|+
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~-----~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt  153 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG-----NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCT  153 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc-----chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhh
Confidence            356765  66667766667777654222     2588899988888877777542 2          11136775  488


Q ss_pred             ccccCccchhhhhhh
Q psy16646         97 QAFKRDKHSKGDDIR  111 (159)
Q Consensus        97 ~~f~~~~~l~~h~~~  111 (159)
                      -.|.+......|+..
T Consensus       154 ~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  154 EKFKTSRDRKDHMIR  168 (253)
T ss_pred             hhhhhhhhhhhHHHH
Confidence            888887777777654


No 140
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=51.82  E-value=12  Score=27.53  Aligned_cols=48  Identities=17%  Similarity=0.095  Sum_probs=30.7

Q ss_pred             CccccccccCccchhhhhhhhhhhhccccccccCccccchhhHHHhhccCC
Q psy16646         92 CSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQTNKNHRSGDQ  142 (159)
Q Consensus        92 C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  142 (159)
                      |-.|.-.|.....-..-..  +..-+ |.|+.|...|-.....-.|...|-
T Consensus       365 Cf~CQ~~fp~~~~~~~~~~--~ss~r-Y~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         365 CFVCQGPFPKPPVSPFDES--TSSGR-YQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             ceeccCCCCCCCCCccccc--ccccc-eechhhhhhhhhhhHHHHHHHHhh
Confidence            6677766765543222211  22223 999999999988887778866654


No 141
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=51.34  E-value=3.1  Score=30.98  Aligned_cols=45  Identities=9%  Similarity=0.130  Sum_probs=22.5

Q ss_pred             ccCccccccccCccch---hhhh-hhhhhhhccccccccCccccchhhH
Q psy16646         90 HKCSLCQQAFKRDKHS---KGDD-IREEIEREMKTRNSIGITVRQNQTN  134 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l---~~h~-~~~~~~~~~~~C~~C~~~f~~~~~l  134 (159)
                      +.|..|.+.....+..   ..|. ..+.+.++.|+|..|+.+......|
T Consensus       253 v~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~Rt~sl~r~  301 (344)
T PF09332_consen  253 VTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNRTISLERL  301 (344)
T ss_dssp             EEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-EEEESSSS
T ss_pred             EEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCeeeecccC
Confidence            6788887766554432   2232 2356677779999999987665444


No 142
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=51.17  E-value=8.4  Score=23.83  Aligned_cols=26  Identities=8%  Similarity=0.096  Sum_probs=16.7

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccccccCcc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGIT  127 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~  127 (159)
                      ...|..||..|.....            . +.||.||..
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~-~~CP~Cgs~   95 (115)
T TIGR00100        70 ECECEDCSEEVSPEID------------L-YRCPKCHGI   95 (115)
T ss_pred             EEEcccCCCEEecCCc------------C-ccCcCCcCC
Confidence            3678888866665422            2 668888854


No 143
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=49.56  E-value=5.8  Score=26.91  Aligned_cols=38  Identities=13%  Similarity=0.176  Sum_probs=24.4

Q ss_pred             hhhhcccCCCCCCCCCCCCCcccCC--CCCcccccccccccc
Q psy16646          4 MKKKSVKNPNAKKRYRPYVPRVDSS--LPPQFHCYVCKKKYR   43 (159)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~h~--~~~~~~C~~c~~~f~   43 (159)
                      +.+.-..||+|+  +....|...-.  .+-.+.|..||..++
T Consensus         2 ~~~iy~~Cp~Cg--~eev~hEVik~~g~~~lvrC~eCG~V~~   41 (201)
T COG1326           2 TEEIYIECPSCG--SEEVSHEVIKERGREPLVRCEECGTVHP   41 (201)
T ss_pred             cceEEEECCCCC--cchhhHHHHHhcCCceEEEccCCCcEee
Confidence            344567899998  55454443333  334688999998764


No 144
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=49.02  E-value=6  Score=18.73  Aligned_cols=10  Identities=10%  Similarity=0.006  Sum_probs=6.0

Q ss_pred             cccccccCcc
Q psy16646        118 MKTRNSIGIT  127 (159)
Q Consensus       118 ~~~C~~C~~~  127 (159)
                      .+.|+.||..
T Consensus        22 R~vC~~Cg~I   31 (34)
T PF14803_consen   22 RLVCPACGFI   31 (34)
T ss_dssp             EEEETTTTEE
T ss_pred             ceECCCCCCE
Confidence            3667777653


No 145
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=48.81  E-value=8.9  Score=18.72  Aligned_cols=9  Identities=22%  Similarity=-0.008  Sum_probs=4.1

Q ss_pred             ccccccCcc
Q psy16646        119 KTRNSIGIT  127 (159)
Q Consensus       119 ~~C~~C~~~  127 (159)
                      +.|+.|+..
T Consensus        25 w~C~~C~~~   33 (40)
T PF04810_consen   25 WICNFCGTK   33 (40)
T ss_dssp             EEETTT--E
T ss_pred             EECcCCCCc
Confidence            556666554


No 146
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=47.98  E-value=7.9  Score=23.80  Aligned_cols=31  Identities=23%  Similarity=0.302  Sum_probs=16.6

Q ss_pred             hhcccCCCCCCCCCCCCCcccCCCCCccccccccccccC
Q psy16646          6 KKSVKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKYRH   44 (159)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f~~   44 (159)
                      -+.+.||+|.+.++..        .+...|..|+....-
T Consensus        67 av~V~CP~C~K~TKmL--------Gr~D~CM~C~~pLTL   97 (114)
T PF11023_consen   67 AVQVECPNCGKQTKML--------GRVDACMHCKEPLTL   97 (114)
T ss_pred             ceeeECCCCCChHhhh--------chhhccCcCCCcCcc
Confidence            3556677777665421        122466666655433


No 147
>KOG3408|consensus
Probab=47.96  E-value=12  Score=23.32  Aligned_cols=26  Identities=27%  Similarity=0.543  Sum_probs=19.9

Q ss_pred             CCCccccccccccccChHHHHHHHhh
Q psy16646         29 LPPQFHCYVCKKKYRHKRQLVRHFQV   54 (159)
Q Consensus        29 ~~~~~~C~~c~~~f~~~~~l~~h~~~   54 (159)
                      |-..|.|-+|.+-|.....|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            44557888888888888888888764


No 148
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=47.91  E-value=9.8  Score=24.78  Aligned_cols=13  Identities=23%  Similarity=0.575  Sum_probs=7.2

Q ss_pred             ccCccccccccCc
Q psy16646         90 HKCSLCQQAFKRD  102 (159)
Q Consensus        90 ~~C~~C~~~f~~~  102 (159)
                      -.|..||..|++.
T Consensus        29 ReC~~C~~RFTTf   41 (156)
T COG1327          29 RECLECGERFTTF   41 (156)
T ss_pred             hcccccccccchh
Confidence            3466666655553


No 149
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=47.41  E-value=13  Score=22.39  Aligned_cols=9  Identities=33%  Similarity=0.803  Sum_probs=4.5

Q ss_pred             Ccccccccc
Q psy16646         31 PQFHCYVCK   39 (159)
Q Consensus        31 ~~~~C~~c~   39 (159)
                      ..+.|+.|+
T Consensus        20 t~f~CP~Cg   28 (99)
T PRK14892         20 KIFECPRCG   28 (99)
T ss_pred             cEeECCCCC
Confidence            345555555


No 150
>KOG3214|consensus
Probab=47.16  E-value=13  Score=22.40  Aligned_cols=42  Identities=26%  Similarity=0.633  Sum_probs=21.6

Q ss_pred             CCCCccccccccccccChHHHHHHHhhhhcCCCCccccccccccccCh
Q psy16646         28 SLPPQFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFTHK   75 (159)
Q Consensus        28 ~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~   75 (159)
                      ..+..|.|..|+---...-.|..-    +.-  ....|.+|+.+|+..
T Consensus        19 ~ldt~FnClfcnHek~v~~~~Dk~----~~i--G~~sC~iC~esFqt~   60 (109)
T KOG3214|consen   19 PLDTQFNCLFCNHEKSVSCTLDKK----HNI--GKASCRICEESFQTT   60 (109)
T ss_pred             chheeeccCccccccceeeeehhh----cCc--ceeeeeehhhhhccc
Confidence            344557777776433222222211    111  235688888888754


No 151
>TIGR00240 ATCase_reg aspartate carbamoyltransferase, regulatory subunit. The presence of this regulatory subunit allows feedback inhibition by CTP on aspartate carbamoyltransferase, the first step in the synthesis of CTP from aspartate. In many species, this regulatory subunit is not present. In Thermotoga maritima, the catalytic and regulatory subunits are encoded by a fused gene and the regulatory region has enough sequence differences to score below the trusted cutoff.
Probab=46.78  E-value=15  Score=24.00  Aligned_cols=35  Identities=23%  Similarity=0.483  Sum_probs=20.9

Q ss_pred             ccCCC--CCCCCCCCCCcccCCCCC---cccccccccccc
Q psy16646          9 VKNPN--AKKRYRPYVPRVDSSLPP---QFHCYVCKKKYR   43 (159)
Q Consensus         9 ~~~~~--~~~~~~~~~~~~~h~~~~---~~~C~~c~~~f~   43 (159)
                      .+|||  |.-+..+..+.-.-....   .|+|.+|++.|.
T Consensus       104 ~kC~Np~CIT~~E~v~~~F~v~~~~~~~~lrC~YCe~~~~  143 (150)
T TIGR00240       104 LKCPNPNCISNAEPVSSKFYVRSEEPDIALRCYYCEKEIE  143 (150)
T ss_pred             EECCCCCCccCCCCCCcEEEEecCCCceEEEEECCCCEEe
Confidence            44544  776666555443322333   489999988764


No 152
>KOG2593|consensus
Probab=46.35  E-value=7.5  Score=29.77  Aligned_cols=34  Identities=24%  Similarity=0.379  Sum_probs=17.4

Q ss_pred             hcccCCCCCCCCCCCCCcccC-CCCCccccccccc
Q psy16646          7 KSVKNPNAKKRYRPYVPRVDS-SLPPQFHCYVCKK   40 (159)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~h-~~~~~~~C~~c~~   40 (159)
                      ..|.||+|.+.|....-.+.- .....|.|..|+.
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGG  161 (436)
T ss_pred             ccccCCccccchhhhHHHHhhcccCceEEEecCCC
Confidence            356666666666643333222 2234566666654


No 153
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=46.20  E-value=11  Score=23.41  Aligned_cols=14  Identities=29%  Similarity=0.788  Sum_probs=9.1

Q ss_pred             cccCccccccccCc
Q psy16646         89 QHKCSLCQQAFKRD  102 (159)
Q Consensus        89 ~~~C~~C~~~f~~~  102 (159)
                      .+.|..||..|...
T Consensus        71 ~~~C~~Cg~~~~~~   84 (117)
T PRK00564         71 ELECKDCSHVFKPN   84 (117)
T ss_pred             EEEhhhCCCccccC
Confidence            36788888666543


No 154
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=46.06  E-value=20  Score=18.23  Aligned_cols=11  Identities=27%  Similarity=0.646  Sum_probs=6.3

Q ss_pred             ccccccccccc
Q psy16646         32 QFHCYVCKKKY   42 (159)
Q Consensus        32 ~~~C~~c~~~f   42 (159)
                      .+.|+.||..+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            45666666544


No 155
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=45.47  E-value=15  Score=26.02  Aligned_cols=38  Identities=26%  Similarity=0.491  Sum_probs=25.3

Q ss_pred             hhcccCCCCCCCCCCCCCcccCCCCCccccccccccccC
Q psy16646          6 KKSVKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKYRH   44 (159)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f~~   44 (159)
                      |+.-.|-.|.+++++.- -..-.|-..|.|+.|+..|..
T Consensus       130 KeVSRCr~C~~rYDPVP-~dkmwG~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  130 KEVSRCRKCRKRYDPVP-CDKMWGIAEFHCPKCRHNFRG  167 (278)
T ss_pred             cccccccccccccCCCc-cccccceeeeecccccccchh
Confidence            34566777777777644 334456666888888887764


No 156
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=45.27  E-value=17  Score=19.26  Aligned_cols=29  Identities=21%  Similarity=0.352  Sum_probs=17.8

Q ss_pred             hhcccCCCCCCCCCCCCCcccCCCCCccccccccccc
Q psy16646          6 KKSVKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKY   42 (159)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f   42 (159)
                      ....+|+.|++.+.+...+        ..|+.|+..+
T Consensus         3 ~~~~~C~~Cg~~~~~~dDi--------VvCp~Cgapy   31 (54)
T PF14446_consen    3 YEGCKCPVCGKKFKDGDDI--------VVCPECGAPY   31 (54)
T ss_pred             ccCccChhhCCcccCCCCE--------EECCCCCCcc
Confidence            3445777888777644333        5677777543


No 157
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=45.24  E-value=1.9  Score=31.30  Aligned_cols=8  Identities=38%  Similarity=0.621  Sum_probs=3.0

Q ss_pred             cccccccc
Q psy16646         33 FHCYVCKK   40 (159)
Q Consensus        33 ~~C~~c~~   40 (159)
                      -.|++||.
T Consensus       173 g~CPvCGs  180 (290)
T PF04216_consen  173 GYCPVCGS  180 (290)
T ss_dssp             SS-TTT--
T ss_pred             CcCCCCCC
Confidence            45666664


No 158
>KOG4167|consensus
Probab=45.01  E-value=4.3  Score=33.21  Aligned_cols=27  Identities=15%  Similarity=0.253  Sum_probs=22.6

Q ss_pred             cccCccccccccCccchhhhhhhhhhh
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIE  115 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~  115 (159)
                      -|.|.+|++.|..-.++..|+++|.-.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHHH
Confidence            489999999999888888888887543


No 159
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=44.90  E-value=15  Score=19.28  Aligned_cols=33  Identities=21%  Similarity=0.436  Sum_probs=17.9

Q ss_pred             CCCCCC-CCCCCCcc--cCCCCCccccccccccccC
Q psy16646         12 PNAKKR-YRPYVPRV--DSSLPPQFHCYVCKKKYRH   44 (159)
Q Consensus        12 ~~~~~~-~~~~~~~~--~h~~~~~~~C~~c~~~f~~   44 (159)
                      |+|.-+ ..+..+.-  ...+...++|.+|++.+..
T Consensus        12 p~CITn~~E~v~~~F~v~~~~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   12 PNCITNSNEPVESRFYVIDKEPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTBTTT-TSSS--EEEEEETTTCEEEETTT--EEEH
T ss_pred             CCcccCCCCCCCceEEEEeCCCCEEEeeCCCCEecc
Confidence            446666 33433333  3456677999999987653


No 160
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.16  E-value=7.3  Score=22.11  Aligned_cols=10  Identities=30%  Similarity=0.833  Sum_probs=5.3

Q ss_pred             cccccccccc
Q psy16646         63 VICEICNKEF   72 (159)
Q Consensus        63 ~~c~~c~~~f   72 (159)
                      |.|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            4556665543


No 161
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=44.03  E-value=16  Score=19.30  Aligned_cols=30  Identities=13%  Similarity=0.228  Sum_probs=17.6

Q ss_pred             ccCCCCCCCCCCCCCcccCCCCCccccccccccc
Q psy16646          9 VKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKKKY   42 (159)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~~f   42 (159)
                      +.||.|+..........   |+ ...|+.||..+
T Consensus         3 ~~CP~CG~~iev~~~~~---Ge-iV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPEL---GE-LVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCcc---CC-EEeCCCCCCEE
Confidence            46777777665543332   33 45777777654


No 162
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=43.95  E-value=16  Score=18.88  Aligned_cols=8  Identities=25%  Similarity=0.567  Sum_probs=3.6

Q ss_pred             cccccccc
Q psy16646         63 VICEICNK   70 (159)
Q Consensus        63 ~~c~~c~~   70 (159)
                      +.|..||.
T Consensus        38 ~~C~~Cgy   45 (50)
T PRK00432         38 WHCGKCGY   45 (50)
T ss_pred             EECCCcCC
Confidence            34444443


No 163
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=42.98  E-value=23  Score=18.85  Aligned_cols=13  Identities=23%  Similarity=0.442  Sum_probs=8.4

Q ss_pred             CCCcccccccccc
Q psy16646         29 LPPQFHCYVCKKK   41 (159)
Q Consensus        29 ~~~~~~C~~c~~~   41 (159)
                      +...|.|+.||..
T Consensus        11 ~~v~~~Cp~cGip   23 (55)
T PF13824_consen   11 AHVNFECPDCGIP   23 (55)
T ss_pred             cccCCcCCCCCCc
Confidence            3445777777764


No 164
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=42.25  E-value=13  Score=22.30  Aligned_cols=40  Identities=15%  Similarity=0.201  Sum_probs=18.9

Q ss_pred             ccccccccccccChHHHHHHHhhhhcCCCCcccccccccccc
Q psy16646         32 QFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFT   73 (159)
Q Consensus        32 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~   73 (159)
                      ...|+.||..-.....++  ++.--.+...-|.|..|+..+.
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q--~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQ--TRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             cCCCCCCCCCeeEEEEec--cCCCCCCcEEEEEeCCCCCeeE
Confidence            367888876432222111  1110011113477888887664


No 165
>KOG1280|consensus
Probab=42.08  E-value=29  Score=25.97  Aligned_cols=39  Identities=28%  Similarity=0.528  Sum_probs=20.9

Q ss_pred             CccccccccccccChHHHHHHHhhhhcCCCCcccccccc
Q psy16646         31 PQFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICN   69 (159)
Q Consensus        31 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~   69 (159)
                      ..|.|++|+.+--+...|..|....|........|..|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            346667776665566666666655444432223344443


No 166
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=41.98  E-value=11  Score=22.20  Aligned_cols=13  Identities=15%  Similarity=0.539  Sum_probs=7.4

Q ss_pred             cccCccccccccC
Q psy16646         89 QHKCSLCQQAFKR  101 (159)
Q Consensus        89 ~~~C~~C~~~f~~  101 (159)
                      .|.|..|++.|.-
T Consensus        54 IW~C~~C~~~~AG   66 (90)
T PTZ00255         54 IWRCKGCKKTVAG   66 (90)
T ss_pred             EEEcCCCCCEEeC
Confidence            4566666655544


No 167
>PRK05580 primosome assembly protein PriA; Validated
Probab=41.55  E-value=23  Score=29.14  Aligned_cols=27  Identities=11%  Similarity=0.277  Sum_probs=13.3

Q ss_pred             cccCCCCCCCCCCCCCcccCCCCCccccccccc
Q psy16646          8 SVKNPNAKKRYRPYVPRVDSSLPPQFHCYVCKK   40 (159)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~h~~~~~~~C~~c~~   40 (159)
                      ...||+|.-      .+..|...+...|..||.
T Consensus       390 ~~~C~~C~~------~l~~h~~~~~l~Ch~Cg~  416 (679)
T PRK05580        390 VAECPHCDA------SLTLHRFQRRLRCHHCGY  416 (679)
T ss_pred             ccCCCCCCC------ceeEECCCCeEECCCCcC
Confidence            345555554      333444444455555553


No 168
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=41.43  E-value=15  Score=23.70  Aligned_cols=46  Identities=15%  Similarity=0.303  Sum_probs=27.4

Q ss_pred             cccccccccccChhhHHHHHhh------hCCCcccCccccccccCccchhhh
Q psy16646         63 VICEICNKEFTHKSSLAEHRVL------HFPAQHKCSLCQQAFKRDKHSKGD  108 (159)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~------h~~k~~~C~~C~~~f~~~~~l~~h  108 (159)
                      ..|..|+..+...+.-..-...      ..+.=+.|+.||+.|...+++.+-
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~~  143 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRRM  143 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHHH
Confidence            4688888755433221110001      123357899999999998876644


No 169
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=41.40  E-value=14  Score=22.84  Aligned_cols=13  Identities=31%  Similarity=0.514  Sum_probs=8.2

Q ss_pred             cccCccccccccC
Q psy16646         89 QHKCSLCQQAFKR  101 (159)
Q Consensus        89 ~~~C~~C~~~f~~  101 (159)
                      ...|..||..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (114)
T PRK03681         70 ECWCETCQQYVTL   82 (114)
T ss_pred             EEEcccCCCeeec
Confidence            3677888765543


No 170
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=41.35  E-value=15  Score=17.57  Aligned_cols=11  Identities=9%  Similarity=0.018  Sum_probs=5.2

Q ss_pred             ccccccCcccc
Q psy16646        119 KTRNSIGITVR  129 (159)
Q Consensus       119 ~~C~~C~~~f~  129 (159)
                      -.|+.||-.+.
T Consensus        22 ~~Cd~cg~~L~   32 (36)
T PF05191_consen   22 GVCDNCGGELV   32 (36)
T ss_dssp             TBCTTTTEBEB
T ss_pred             CccCCCCCeeE
Confidence            33555554443


No 171
>PRK14873 primosome assembly protein PriA; Provisional
Probab=40.80  E-value=21  Score=29.33  Aligned_cols=17  Identities=24%  Similarity=0.210  Sum_probs=9.7

Q ss_pred             CcccCCCCCcccccccc
Q psy16646         23 PRVDSSLPPQFHCYVCK   39 (159)
Q Consensus        23 ~~~~h~~~~~~~C~~c~   39 (159)
                      .+..|...+...|..||
T Consensus       401 ~L~~h~~~~~l~Ch~CG  417 (665)
T PRK14873        401 PLGLPSAGGTPRCRWCG  417 (665)
T ss_pred             ceeEecCCCeeECCCCc
Confidence            44445555556666666


No 172
>KOG2907|consensus
Probab=40.67  E-value=11  Score=23.22  Aligned_cols=13  Identities=8%  Similarity=-0.054  Sum_probs=9.8

Q ss_pred             cccccccCccccc
Q psy16646        118 MKTRNSIGITVRQ  130 (159)
Q Consensus       118 ~~~C~~C~~~f~~  130 (159)
                      .|.|+.|++.|..
T Consensus       102 FYTC~kC~~k~~e  114 (116)
T KOG2907|consen  102 FYTCPKCKYKFTE  114 (116)
T ss_pred             EEEcCccceeeec
Confidence            3888888887764


No 173
>KOG4377|consensus
Probab=39.94  E-value=33  Score=26.31  Aligned_cols=111  Identities=21%  Similarity=0.337  Sum_probs=62.8

Q ss_pred             CCCccccc--cccccccChHHHHHHHhhhhcCCCC-----------ccccc--cccccccChhhHHHHHhhhCCC-----
Q psy16646         29 LPPQFHCY--VCKKKYRHKRQLVRHFQVNHTNNYD-----------RVICE--ICNKEFTHKSSLAEHRVLHFPA-----   88 (159)
Q Consensus        29 ~~~~~~C~--~c~~~f~~~~~l~~h~~~~~~~~~~-----------~~~c~--~c~~~f~~~~~l~~h~~~h~~k-----   88 (159)
                      +...|.|.  .|+.-+.....+.+|..+ |...+.           -|.|.  .|.+   +-++...|...|.++     
T Consensus       268 ~rEhyhcl~e~C~ykr~~k~DvirH~~~-hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gf  343 (480)
T KOG4377|consen  268 GREHYHCLNEYCFYKRGQKNDVIRHVEI-HKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGF  343 (480)
T ss_pred             cchhhcccCccccccccchhhhHHHHHH-HhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCce
Confidence            34557774  488887778889999888 433211           12332  3655   333444554444222     


Q ss_pred             ---cccCcccc--ccccCccchhhhhhhhhhhhcc-----------------------ccc--cccCccccchhhHHHhh
Q psy16646         89 ---QHKCSLCQ--QAFKRDKHSKGDDIREEIEREM-----------------------KTR--NSIGITVRQNQTNKNHR  138 (159)
Q Consensus        89 ---~~~C~~C~--~~f~~~~~l~~h~~~~~~~~~~-----------------------~~C--~~C~~~f~~~~~l~~H~  138 (159)
                         -|.|..||  ..|.....-.-|.+-+.++...                       +-|  ..|+..+...+....|.
T Consensus       344 rrthfhC~r~gCTdtfK~~khk~yh~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~shk  423 (480)
T KOG4377|consen  344 RRTHFHCQRIGCTDTFKDSKHKPYHYKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQMASHK  423 (480)
T ss_pred             ecceeEEeccCCccccccccccccccCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhhhhhhh
Confidence               36787777  4554333323333333332211                       333  56888899999999998


Q ss_pred             ccCCC
Q psy16646        139 SGDQK  143 (159)
Q Consensus       139 ~~h~~  143 (159)
                      +.|.+
T Consensus       424 rkheR  428 (480)
T KOG4377|consen  424 RKHER  428 (480)
T ss_pred             hhhhh
Confidence            87764


No 174
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=39.80  E-value=8.6  Score=26.24  Aligned_cols=11  Identities=9%  Similarity=0.027  Sum_probs=4.9

Q ss_pred             ccccccCcccc
Q psy16646        119 KTRNSIGITVR  129 (159)
Q Consensus       119 ~~C~~C~~~f~  129 (159)
                      +.|..||++++
T Consensus        44 ~~C~~CgYR~~   54 (201)
T COG1779          44 GVCERCGYRST   54 (201)
T ss_pred             EEccccCCccc
Confidence            33444444443


No 175
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=39.76  E-value=18  Score=18.71  Aligned_cols=10  Identities=20%  Similarity=0.125  Sum_probs=4.5

Q ss_pred             hcccCCCCCC
Q psy16646          7 KSVKNPNAKK   16 (159)
Q Consensus         7 ~~~~~~~~~~   16 (159)
                      +.-.||.|+.
T Consensus        18 k~~~CPrCG~   27 (51)
T COG1998          18 KNRFCPRCGP   27 (51)
T ss_pred             ccccCCCCCC
Confidence            3344555444


No 176
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=39.02  E-value=16  Score=17.80  Aligned_cols=11  Identities=9%  Similarity=-0.179  Sum_probs=5.3

Q ss_pred             ccccccCcccc
Q psy16646        119 KTRNSIGITVR  129 (159)
Q Consensus       119 ~~C~~C~~~f~  129 (159)
                      +.|..|+..|-
T Consensus        13 f~C~~C~~~FC   23 (39)
T smart00154       13 FKCRHCGNLFC   23 (39)
T ss_pred             eECCccCCccc
Confidence            44555554443


No 177
>KOG4727|consensus
Probab=37.59  E-value=18  Score=24.09  Aligned_cols=27  Identities=7%  Similarity=-0.002  Sum_probs=22.0

Q ss_pred             hhhhccccccccCccccchhhHHHhhc
Q psy16646        113 EIEREMKTRNSIGITVRQNQTNKNHRS  139 (159)
Q Consensus       113 ~~~~~~~~C~~C~~~f~~~~~l~~H~~  139 (159)
                      .++...|.|..|+-.|.....+..|+.
T Consensus        70 ~sq~~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   70 RSQKGGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ccccCceeeeecceeehhhHHHHHHhc
Confidence            445555899999999999999988874


No 178
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=37.22  E-value=16  Score=19.98  Aligned_cols=10  Identities=50%  Similarity=1.182  Sum_probs=3.6

Q ss_pred             cccccccccc
Q psy16646         64 ICEICNKEFT   73 (159)
Q Consensus        64 ~c~~c~~~f~   73 (159)
                      .|..|+..|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            4666766663


No 179
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=36.94  E-value=12  Score=23.02  Aligned_cols=13  Identities=31%  Similarity=0.843  Sum_probs=8.0

Q ss_pred             ccCccccccccCc
Q psy16646         90 HKCSLCQQAFKRD  102 (159)
Q Consensus        90 ~~C~~C~~~f~~~  102 (159)
                      ..|..||..|...
T Consensus        71 ~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   71 ARCRDCGHEFEPD   83 (113)
T ss_dssp             EEETTTS-EEECH
T ss_pred             EECCCCCCEEecC
Confidence            5677777766554


No 180
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=36.69  E-value=14  Score=18.17  Aligned_cols=22  Identities=23%  Similarity=0.312  Sum_probs=12.7

Q ss_pred             CCCcccCCCCCccccccccccc
Q psy16646         21 YVPRVDSSLPPQFHCYVCKKKY   42 (159)
Q Consensus        21 ~~~~~~h~~~~~~~C~~c~~~f   42 (159)
                      .+-+.+-...++..|+.|+..|
T Consensus        18 rVyl~l~~~~~~~~CpYCg~~y   39 (40)
T PF10276_consen   18 RVYLNLDDEPGPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEE-TTTTCEEEETTTTEEE
T ss_pred             eEEEecCCCCCeEECCCCCCEE
Confidence            3334444433567888888765


No 181
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=36.20  E-value=23  Score=17.84  Aligned_cols=22  Identities=14%  Similarity=-0.084  Sum_probs=15.2

Q ss_pred             ccccccCccccchhhHHHhhcc
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSG  140 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~  140 (159)
                      |+|=+|..+....+.|..|+.-
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            6677777777777777777643


No 182
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=36.13  E-value=16  Score=21.95  Aligned_cols=18  Identities=11%  Similarity=0.176  Sum_probs=11.8

Q ss_pred             ccCCCCCcccccccccccc
Q psy16646         25 VDSSLPPQFHCYVCKKKYR   43 (159)
Q Consensus        25 ~~h~~~~~~~C~~c~~~f~   43 (159)
                      ..+.+ ++.+|.+||..|.
T Consensus        73 ~l~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          73 WLEKG-KPKRCPECGHVFK   90 (97)
T ss_pred             EEeCC-CceeCCCCCcEEE
Confidence            34445 5778887887764


No 183
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=36.11  E-value=34  Score=20.73  Aligned_cols=37  Identities=16%  Similarity=0.266  Sum_probs=22.2

Q ss_pred             ccccccccccccChHHHHHHHhhhhcCCCCcccccccccc
Q psy16646         32 QFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKE   71 (159)
Q Consensus        32 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~   71 (159)
                      .+.|+.-|..|.....+...+.. ...  ..|.|...|++
T Consensus         3 Vf~i~~T~EiF~dYe~Y~~R~~~-y~~--~vwtC~~TGk~   39 (102)
T PF10537_consen    3 VFYIPFTGEIFRDYEEYLKRMIL-YNQ--RVWTCEITGKS   39 (102)
T ss_pred             eEEeCCCCcccCCHHHHHHHHHH-HhC--CeeEEecCCCC
Confidence            45566667777776666655544 332  45777766653


No 184
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=35.95  E-value=19  Score=18.81  Aligned_cols=12  Identities=33%  Similarity=0.836  Sum_probs=5.8

Q ss_pred             ccCccccccccC
Q psy16646         90 HKCSLCQQAFKR  101 (159)
Q Consensus        90 ~~C~~C~~~f~~  101 (159)
                      ++|..||..|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            455555544443


No 185
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=35.15  E-value=20  Score=16.46  Aligned_cols=10  Identities=10%  Similarity=0.032  Sum_probs=5.7

Q ss_pred             ccccccCccc
Q psy16646        119 KTRNSIGITV  128 (159)
Q Consensus       119 ~~C~~C~~~f  128 (159)
                      |.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            5566666544


No 186
>KOG4317|consensus
Probab=35.13  E-value=12  Score=27.47  Aligned_cols=19  Identities=16%  Similarity=0.071  Sum_probs=8.2

Q ss_pred             ccccccCccccchhhHHHh
Q psy16646        119 KTRNSIGITVRQNQTNKNH  137 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H  137 (159)
                      |.|+.|+..|-+..-++.|
T Consensus        20 YtCPRCn~~YCsl~CYr~h   38 (383)
T KOG4317|consen   20 YTCPRCNLLYCSLKCYRNH   38 (383)
T ss_pred             ccCCCCCccceeeeeecCC
Confidence            4444444444444333333


No 187
>KOG4167|consensus
Probab=35.10  E-value=9.9  Score=31.27  Aligned_cols=25  Identities=28%  Similarity=0.375  Sum_probs=22.7

Q ss_pred             CccccccccccccChhhHHHHHhhh
Q psy16646         61 DRVICEICNKEFTHKSSLAEHRVLH   85 (159)
Q Consensus        61 ~~~~c~~c~~~f~~~~~l~~h~~~h   85 (159)
                      .-|.|..|++.|.-..+++.|+++|
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHH
Confidence            3478999999999999999999999


No 188
>PRK05978 hypothetical protein; Provisional
Probab=35.01  E-value=22  Score=23.22  Aligned_cols=8  Identities=38%  Similarity=1.261  Sum_probs=3.6

Q ss_pred             Cccccccc
Q psy16646         92 CSLCQQAF   99 (159)
Q Consensus        92 C~~C~~~f   99 (159)
                      |+.||..|
T Consensus        55 C~~CG~~~   62 (148)
T PRK05978         55 CAACGEDF   62 (148)
T ss_pred             ccccCCcc
Confidence            44444433


No 189
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.74  E-value=11  Score=20.39  Aligned_cols=44  Identities=5%  Similarity=-0.129  Sum_probs=23.5

Q ss_pred             Hhhh-CCCcccCccccccccCccchhhhhhhhhhhhccccccccCccccc
Q psy16646         82 RVLH-FPAQHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQ  130 (159)
Q Consensus        82 ~~~h-~~k~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~  130 (159)
                      ..++ +..++.|..-+-.|...-.+.     --|++..-.|+.|+..|..
T Consensus        16 ~~I~~~~~~l~C~g~~~p~~HPrV~L-----~mg~~gev~CPYC~t~y~l   60 (62)
T COG4391          16 ETIEIGDLPLMCPGPEPPNDHPRVFL-----DMGDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             eEEEeCCeeEEcCCCCCCCCCCEEEE-----EcCCCCcEecCccccEEEe
Confidence            3344 566777776554544432222     1133333668888887753


No 190
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=34.70  E-value=30  Score=16.23  Aligned_cols=21  Identities=14%  Similarity=0.022  Sum_probs=12.3

Q ss_pred             cccccccCccccchhhHHHhhc
Q psy16646        118 MKTRNSIGITVRQNQTNKNHRS  139 (159)
Q Consensus       118 ~~~C~~C~~~f~~~~~l~~H~~  139 (159)
                      .+.|+.|++.+.. +-+..|+.
T Consensus         4 ~~~C~nC~R~v~a-~RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVAA-SRFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEEG-GGHHHHHH
T ss_pred             eEECCCCcCCcch-hhhHHHHH
Confidence            3678888886543 34566653


No 191
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=34.69  E-value=39  Score=18.39  Aligned_cols=12  Identities=25%  Similarity=0.534  Sum_probs=6.5

Q ss_pred             Cccccccccccc
Q psy16646         61 DRVICEICNKEF   72 (159)
Q Consensus        61 ~~~~c~~c~~~f   72 (159)
                      ..+.|+.||...
T Consensus        45 r~~~C~~Cg~~~   56 (69)
T PF07282_consen   45 RVFTCPNCGFEM   56 (69)
T ss_pred             ceEEcCCCCCEE
Confidence            345566666543


No 192
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=34.45  E-value=24  Score=17.44  Aligned_cols=11  Identities=9%  Similarity=-0.058  Sum_probs=4.4

Q ss_pred             ccccccCcccc
Q psy16646        119 KTRNSIGITVR  129 (159)
Q Consensus       119 ~~C~~C~~~f~  129 (159)
                      +.|+.|+..|-
T Consensus        14 ~~C~~C~~~FC   24 (43)
T PF01428_consen   14 FKCKHCGKSFC   24 (43)
T ss_dssp             EE-TTTS-EE-
T ss_pred             eECCCCCcccC
Confidence            55555555554


No 193
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=34.26  E-value=16  Score=30.01  Aligned_cols=9  Identities=22%  Similarity=0.641  Sum_probs=4.7

Q ss_pred             cccCccccc
Q psy16646         89 QHKCSLCQQ   97 (159)
Q Consensus        89 ~~~C~~C~~   97 (159)
                      |..|+.||-
T Consensus       173 p~aCp~CGP  181 (750)
T COG0068         173 PIACPKCGP  181 (750)
T ss_pred             cccCcccCC
Confidence            455555553


No 194
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=34.21  E-value=16  Score=21.61  Aligned_cols=14  Identities=21%  Similarity=0.529  Sum_probs=8.2

Q ss_pred             cccCccccccccCc
Q psy16646         89 QHKCSLCQQAFKRD  102 (159)
Q Consensus        89 ~~~C~~C~~~f~~~  102 (159)
                      .|.|..|++.|.-.
T Consensus        53 IW~C~~C~~~~AGG   66 (91)
T TIGR00280        53 IWTCRKCGAKFAGG   66 (91)
T ss_pred             EEEcCCCCCEEeCC
Confidence            56666666665543


No 195
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=33.85  E-value=14  Score=22.25  Aligned_cols=40  Identities=23%  Similarity=0.503  Sum_probs=22.3

Q ss_pred             CCCCccccccccccccChHHHHHHHhhhhcCCCCcccccccccccc
Q psy16646         28 SLPPQFHCYVCKKKYRHKRQLVRHFQVNHTNNYDRVICEICNKEFT   73 (159)
Q Consensus        28 ~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~   73 (159)
                      .-++.|.|+.||..-.+...++.-     ... ....|..||..|.
T Consensus        18 ~L~k~FtCp~Cghe~vs~ctvkk~-----~~~-g~~~Cg~CGls~e   57 (104)
T COG4888          18 VLPKTFTCPRCGHEKVSSCTVKKT-----VNI-GTAVCGNCGLSFE   57 (104)
T ss_pred             cCCceEecCccCCeeeeEEEEEec-----Cce-eEEEcccCcceEE
Confidence            356778898888654332222211     111 2356888887665


No 196
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=33.22  E-value=23  Score=27.32  Aligned_cols=30  Identities=17%  Similarity=0.218  Sum_probs=19.2

Q ss_pred             cCccccccccCccchhhhhhhhhhhhccccccccCccccchh
Q psy16646         91 KCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQNQ  132 (159)
Q Consensus        91 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~  132 (159)
                      .|+.||.....           .|.. .|+|+.||..+....
T Consensus       352 ~Cp~Cg~~m~S-----------~G~~-g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKS-----------AGRN-GFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhh-----------cCCC-CcccccccccCCccc
Confidence            68888743322           2333 388888888887654


No 197
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=33.11  E-value=1e+02  Score=19.80  Aligned_cols=35  Identities=31%  Similarity=0.525  Sum_probs=25.4

Q ss_pred             CCCCCCCcccCCCCCccccccccccccChHHHHHHHhh
Q psy16646         17 RYRPYVPRVDSSLPPQFHCYVCKKKYRHKRQLVRHFQV   54 (159)
Q Consensus        17 ~~~~~~~~~~h~~~~~~~C~~c~~~f~~~~~l~~h~~~   54 (159)
                      ...+.+..+......-..|-++|+.|.   +|++|..+
T Consensus        61 ~~~PAV~~kKSVtpD~IicLEDGkkfK---SLKRHL~t   95 (148)
T COG4957          61 KQKPAVPIKKSVTPDYIICLEDGKKFK---SLKRHLTT   95 (148)
T ss_pred             ccCCCCCcccccCCCeEEEeccCcchH---HHHHHHhc
Confidence            344556666666666678999999885   58888887


No 198
>PLN02294 cytochrome c oxidase subunit Vb
Probab=33.06  E-value=21  Score=23.81  Aligned_cols=20  Identities=25%  Similarity=0.537  Sum_probs=14.9

Q ss_pred             hhhCCCcccCccccccccCc
Q psy16646         83 VLHFPAQHKCSLCQQAFKRD  102 (159)
Q Consensus        83 ~~h~~k~~~C~~C~~~f~~~  102 (159)
                      ..+.++|..|++||..|.-.
T Consensus       135 ~L~kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        135 WLEKGKSFECPVCTQYFELE  154 (174)
T ss_pred             EecCCCceeCCCCCCEEEEE
Confidence            34445799999999888643


No 199
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=32.86  E-value=16  Score=23.68  Aligned_cols=30  Identities=13%  Similarity=0.097  Sum_probs=17.3

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccccccCcccc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVR  129 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~  129 (159)
                      .|.|..||......         +.+.-  -.|+.||..--
T Consensus       112 ~l~C~~Cg~~~~~~---------~~~~l--~~Cp~C~~~~F  141 (146)
T PF07295_consen  112 TLVCENCGHEVELT---------HPERL--PPCPKCGHTEF  141 (146)
T ss_pred             eEecccCCCEEEec---------CCCcC--CCCCCCCCCee
Confidence            48888888544332         22222  34888887643


No 200
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK04023 DNA polymerase II large subunit; Validated
Probab=32.67  E-value=63  Score=28.09  Aligned_cols=8  Identities=38%  Similarity=0.766  Sum_probs=3.8

Q ss_pred             cccccccc
Q psy16646         33 FHCYVCKK   40 (159)
Q Consensus        33 ~~C~~c~~   40 (159)
                      ..|+.||.
T Consensus       627 RfCpsCG~  634 (1121)
T PRK04023        627 RKCPSCGK  634 (1121)
T ss_pred             ccCCCCCC
Confidence            34555553


No 202
>KOG2785|consensus
Probab=32.62  E-value=37  Score=25.77  Aligned_cols=25  Identities=16%  Similarity=0.194  Sum_probs=19.3

Q ss_pred             CccccccccccccChhhHHHHHhhh
Q psy16646         61 DRVICEICNKEFTHKSSLAEHRVLH   85 (159)
Q Consensus        61 ~~~~c~~c~~~f~~~~~l~~h~~~h   85 (159)
                      .|..|..|+..+.+......|+..+
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~  189 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKE  189 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhc
Confidence            4567888988888888888887654


No 203
>KOG2231|consensus
Probab=32.04  E-value=45  Score=27.46  Aligned_cols=98  Identities=13%  Similarity=0.186  Sum_probs=61.6

Q ss_pred             ChHHHHHHHhhhhcC-CC---CccccccccccccChhhHHHHHhhhCCCcccCccc------cccccCccchhhhhhhhh
Q psy16646         44 HKRQLVRHFQVNHTN-NY---DRVICEICNKEFTHKSSLAEHRVLHFPAQHKCSLC------QQAFKRDKHSKGDDIREE  113 (159)
Q Consensus        44 ~~~~l~~h~~~~~~~-~~---~~~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~~C------~~~f~~~~~l~~h~~~~~  113 (159)
                      +...|..|+.. .-. ++   ..-.|..|...|.....|..|++.+   -|.|..|      +.-|..-..|..|-+.+|
T Consensus       161 t~~el~~h~~~-gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~---h~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  161 TRAELNLHLMF-GDPDDESCRGHPLCKFCHERFLDDDELYRHLRFD---HEFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             hHHHHHHHHhc-CCCccccccCCccchhhhhhhccHHHHHHhhccc---eeheeecCcccccchhcccchHHHHHhhhcC
Confidence            34667777654 221 10   1236889999999999999998754   3344444      455666777888877766


Q ss_pred             hhhcccccc--ccCc-----cccchhhHHHhhccCCCccccccC
Q psy16646        114 IEREMKTRN--SIGI-----TVRQNQTNKNHRSGDQKKKTAKQL  150 (159)
Q Consensus       114 ~~~~~~~C~--~C~~-----~f~~~~~l~~H~~~h~~~k~~~~~  150 (159)
                           |.|.  .|.-     .|.....|..|.+.++.++.|-+.
T Consensus       237 -----flCE~~~C~~~~f~~~~~~ei~lk~~~~~~~~e~~~~~~  275 (669)
T KOG2231|consen  237 -----FLCEEEFCRTKKFYVAFELEIELKAHNRFIQHEKCYICR  275 (669)
T ss_pred             -----ccccccccccceeeehhHHHHHHHhhccccchheeccCC
Confidence                 5564  3432     234455666666666667777665


No 204
>KOG2785|consensus
Probab=31.06  E-value=29  Score=26.28  Aligned_cols=52  Identities=10%  Similarity=-0.012  Sum_probs=41.0

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhcc----------------------ccccccC---ccccchhhHHHhhcc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREM----------------------KTRNSIG---ITVRQNQTNKNHRSG  140 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~----------------------~~C~~C~---~~f~~~~~l~~H~~~  140 (159)
                      |-.|..|++.+........|+-.+||---+                      +.|-.|+   +.|.+..+.+.|+..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            577999999999888888888777663211                      7777788   889999999999654


No 205
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=30.85  E-value=17  Score=23.78  Aligned_cols=13  Identities=8%  Similarity=-0.064  Sum_probs=7.9

Q ss_pred             ccccccCccccch
Q psy16646        119 KTRNSIGITVRQN  131 (159)
Q Consensus       119 ~~C~~C~~~f~~~  131 (159)
                      ..|..||+.|+..
T Consensus        69 sYC~~CGkpyPWt   81 (158)
T PF10083_consen   69 SYCHNCGKPYPWT   81 (158)
T ss_pred             hhHHhCCCCCchH
Confidence            5566666666553


No 206
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=30.40  E-value=27  Score=27.34  Aligned_cols=21  Identities=14%  Similarity=0.322  Sum_probs=10.1

Q ss_pred             ccCccccccccCccchhhhhh
Q psy16646         90 HKCSLCQQAFKRDKHSKGDDI  110 (159)
Q Consensus        90 ~~C~~C~~~f~~~~~l~~h~~  110 (159)
                      |.|+.|.+.|.....+..|+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            344445555555545554443


No 207
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=30.08  E-value=24  Score=18.22  Aligned_cols=12  Identities=8%  Similarity=0.061  Sum_probs=6.0

Q ss_pred             ccccccCccccc
Q psy16646        119 KTRNSIGITVRQ  130 (159)
Q Consensus       119 ~~C~~C~~~f~~  130 (159)
                      |.|..|+..+..
T Consensus        27 f~C~~C~~~l~~   38 (58)
T PF00412_consen   27 FKCSKCGKPLND   38 (58)
T ss_dssp             SBETTTTCBTTT
T ss_pred             cccCCCCCccCC
Confidence            455555554433


No 208
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=29.82  E-value=21  Score=21.14  Aligned_cols=13  Identities=23%  Similarity=0.595  Sum_probs=7.4

Q ss_pred             cccCccccccccC
Q psy16646         89 QHKCSLCQQAFKR  101 (159)
Q Consensus        89 ~~~C~~C~~~f~~  101 (159)
                      .|.|..|++.|.-
T Consensus        54 IW~C~~C~~~~AG   66 (90)
T PRK03976         54 IWECRKCGAKFAG   66 (90)
T ss_pred             EEEcCCCCCEEeC
Confidence            4566666655543


No 209
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=29.77  E-value=25  Score=17.18  Aligned_cols=14  Identities=7%  Similarity=-0.137  Sum_probs=8.6

Q ss_pred             ccccccccCccccc
Q psy16646        117 EMKTRNSIGITVRQ  130 (159)
Q Consensus       117 ~~~~C~~C~~~f~~  130 (159)
                      |.+.|+.||..+.+
T Consensus        31 p~~~C~~CGE~~~~   44 (46)
T TIGR03831        31 PALVCPQCGEEYLD   44 (46)
T ss_pred             CccccccCCCEeeC
Confidence            44667777766543


No 210
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=29.58  E-value=22  Score=22.95  Aligned_cols=32  Identities=16%  Similarity=0.307  Sum_probs=17.0

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccccccCcccc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVR  129 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~  129 (159)
                      .|.|..|+..+...      .+.  .... |.|..|+..+.
T Consensus       123 ~~~C~~C~~~~~r~------~~~--~~~~-~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRH------RRS--KRKR-YRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeee------ccc--chhh-EECCCCCCEEE
Confidence            46677777655332      222  2222 67777775543


No 211
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=29.48  E-value=30  Score=17.22  Aligned_cols=11  Identities=27%  Similarity=0.945  Sum_probs=6.3

Q ss_pred             CccccccccCc
Q psy16646         92 CSLCQQAFKRD  102 (159)
Q Consensus        92 C~~C~~~f~~~  102 (159)
                      |..||..|...
T Consensus        11 C~~C~rpf~WR   21 (42)
T PF10013_consen   11 CPVCGRPFTWR   21 (42)
T ss_pred             CcccCCcchHH
Confidence            55566555554


No 212
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=29.45  E-value=25  Score=16.43  Aligned_cols=12  Identities=8%  Similarity=-0.064  Sum_probs=7.9

Q ss_pred             cccccccCcccc
Q psy16646        118 MKTRNSIGITVR  129 (159)
Q Consensus       118 ~~~C~~C~~~f~  129 (159)
                      .+.|..||..|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            366777777664


No 213
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=29.38  E-value=26  Score=22.55  Aligned_cols=33  Identities=18%  Similarity=0.272  Sum_probs=17.7

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccccccCcccc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVR  129 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~  129 (159)
                      .|.|..|+..+.+.   .    ++..... |.|..|+-.+.
T Consensus       112 ~y~C~~C~~~~~~~---r----r~~~~~~-y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYLRV---R----RSNNVSR-YRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCceE---c----cccCcce-EEcCCCCCEEE
Confidence            57777777655321   1    1111133 77777776553


No 214
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=28.81  E-value=21  Score=18.60  Aligned_cols=12  Identities=8%  Similarity=0.047  Sum_probs=6.0

Q ss_pred             cccccCccccch
Q psy16646        120 TRNSIGITVRQN  131 (159)
Q Consensus       120 ~C~~C~~~f~~~  131 (159)
                      .|+.|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            689999988653


No 215
>PTZ00448 hypothetical protein; Provisional
Probab=28.62  E-value=35  Score=25.81  Aligned_cols=22  Identities=14%  Similarity=0.105  Sum_probs=19.6

Q ss_pred             ccccccCccccchhhHHHhhcc
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSG  140 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~  140 (159)
                      |.|..|+..|.+....+.|.++
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             ccccccccccCCHHHHHHHhhh
Confidence            7899999999998999999665


No 216
>PRK04351 hypothetical protein; Provisional
Probab=28.31  E-value=28  Score=22.69  Aligned_cols=33  Identities=15%  Similarity=0.208  Sum_probs=17.9

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccccccCccccc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQ  130 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~  130 (159)
                      .|.|..||..+.+.       +. +.... |.|..|+-.+..
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr-~n~~~-yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RR-INTKR-YRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee-------ee-cCCCc-EEeCCCCcEeee
Confidence            46777777554332       11 12344 777777766543


No 217
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=28.08  E-value=27  Score=16.52  Aligned_cols=14  Identities=29%  Similarity=0.631  Sum_probs=6.7

Q ss_pred             cCccccccccCccc
Q psy16646         91 KCSLCQQAFKRDKH  104 (159)
Q Consensus        91 ~C~~C~~~f~~~~~  104 (159)
                      .|..|++.|..+.-
T Consensus         5 ~C~eC~~~f~dSyL   18 (34)
T PF01286_consen    5 KCDECGKPFMDSYL   18 (34)
T ss_dssp             E-TTT--EES-SSC
T ss_pred             hHhHhCCHHHHHHH
Confidence            57788888876643


No 218
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=27.97  E-value=30  Score=21.34  Aligned_cols=12  Identities=8%  Similarity=-0.113  Sum_probs=5.7

Q ss_pred             ccccccCccccc
Q psy16646        119 KTRNSIGITVRQ  130 (159)
Q Consensus       119 ~~C~~C~~~f~~  130 (159)
                      +.|+.||..+..
T Consensus        32 ~~C~~CGe~~~~   43 (127)
T TIGR03830        32 WYCPACGEELLD   43 (127)
T ss_pred             eECCCCCCEEEc
Confidence            445555554433


No 219
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=27.82  E-value=31  Score=21.65  Aligned_cols=13  Identities=23%  Similarity=0.360  Sum_probs=8.6

Q ss_pred             cccCccccccccCc
Q psy16646         89 QHKCSLCQQAFKRD  102 (159)
Q Consensus        89 ~~~C~~C~~~f~~~  102 (159)
                      ...| .||..|...
T Consensus        70 ~~~C-~Cg~~~~~~   82 (124)
T PRK00762         70 EIEC-ECGYEGVVD   82 (124)
T ss_pred             eEEe-eCcCccccc
Confidence            3678 888766544


No 220
>KOG3507|consensus
Probab=27.80  E-value=16  Score=19.59  Aligned_cols=12  Identities=8%  Similarity=-0.003  Sum_probs=6.1

Q ss_pred             ccccccCccccc
Q psy16646        119 KTRNSIGITVRQ  130 (159)
Q Consensus       119 ~~C~~C~~~f~~  130 (159)
                      +.|.+||.+...
T Consensus        38 irCReCG~RIly   49 (62)
T KOG3507|consen   38 IRCRECGYRILY   49 (62)
T ss_pred             EehhhcchHHHH
Confidence            455555555433


No 221
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=27.52  E-value=36  Score=16.23  Aligned_cols=15  Identities=20%  Similarity=0.162  Sum_probs=7.4

Q ss_pred             chhhhcccCCCCCCC
Q psy16646          3 EMKKKSVKNPNAKKR   17 (159)
Q Consensus         3 ~~~~~~~~~~~~~~~   17 (159)
                      .++.....|++|..+
T Consensus         3 ~~~~~~~~C~~C~~~   17 (36)
T PF11781_consen    3 WMRGPNEPCPVCGSR   17 (36)
T ss_pred             ccccCCCcCCCCCCe
Confidence            333444456665554


No 222
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=27.21  E-value=30  Score=16.58  Aligned_cols=15  Identities=7%  Similarity=-0.137  Sum_probs=8.8

Q ss_pred             cccccCccccchhhH
Q psy16646        120 TRNSIGITVRQNQTN  134 (159)
Q Consensus       120 ~C~~C~~~f~~~~~l  134 (159)
                      .|+.|++.|...+.=
T Consensus         4 ~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    4 LCPRCGKGFHWASEC   18 (36)
T ss_dssp             C-TTTSSSCS-TTT-
T ss_pred             cCcccCCCcchhhhh
Confidence            478888888766553


No 223
>PF12773 DZR:  Double zinc ribbon
Probab=26.94  E-value=50  Score=16.61  Aligned_cols=9  Identities=22%  Similarity=0.187  Sum_probs=5.7

Q ss_pred             ccccccCcc
Q psy16646        119 KTRNSIGIT  127 (159)
Q Consensus       119 ~~C~~C~~~  127 (159)
                      ..|+.||..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            456777665


No 224
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=26.83  E-value=27  Score=21.38  Aligned_cols=13  Identities=23%  Similarity=0.552  Sum_probs=7.0

Q ss_pred             cccCccccccccC
Q psy16646         89 QHKCSLCQQAFKR  101 (159)
Q Consensus        89 ~~~C~~C~~~f~~  101 (159)
                      -|.|++|+..+..
T Consensus        19 ~~iCpeC~~EW~~   31 (109)
T TIGR00686        19 QLICPSCLYEWNE   31 (109)
T ss_pred             eeECccccccccc
Confidence            3556666555543


No 225
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=26.66  E-value=48  Score=16.00  Aligned_cols=12  Identities=0%  Similarity=-0.255  Sum_probs=4.3

Q ss_pred             ccccccCccccc
Q psy16646        119 KTRNSIGITVRQ  130 (159)
Q Consensus       119 ~~C~~C~~~f~~  130 (159)
                      |.|+.|+.-|..
T Consensus         4 yyCdyC~~~~~~   15 (38)
T PF06220_consen    4 YYCDYCKKYLTH   15 (38)
T ss_dssp             -B-TTT--B-S-
T ss_pred             eecccccceecC
Confidence            668888877743


No 226
>COG1773 Rubredoxin [Energy production and conversion]
Probab=26.17  E-value=27  Score=18.60  Aligned_cols=13  Identities=8%  Similarity=-0.046  Sum_probs=10.2

Q ss_pred             ccccccCccccch
Q psy16646        119 KTRNSIGITVRQN  131 (159)
Q Consensus       119 ~~C~~C~~~f~~~  131 (159)
                      |+|..||..|.-.
T Consensus         4 ~~C~~CG~vYd~e   16 (55)
T COG1773           4 WRCSVCGYVYDPE   16 (55)
T ss_pred             eEecCCceEeccc
Confidence            7888898887654


No 227
>PRK10220 hypothetical protein; Provisional
Probab=24.91  E-value=36  Score=20.87  Aligned_cols=14  Identities=14%  Similarity=0.479  Sum_probs=7.9

Q ss_pred             cccCccccccccCc
Q psy16646         89 QHKCSLCQQAFKRD  102 (159)
Q Consensus        89 ~~~C~~C~~~f~~~  102 (159)
                      -|.|++|+..+...
T Consensus        20 ~~vCpeC~hEW~~~   33 (111)
T PRK10220         20 MYICPECAHEWNDA   33 (111)
T ss_pred             eEECCcccCcCCcc
Confidence            46666666555543


No 228
>COG4640 Predicted membrane protein [Function unknown]
Probab=24.79  E-value=44  Score=25.60  Aligned_cols=18  Identities=17%  Similarity=0.167  Sum_probs=10.2

Q ss_pred             ccccccCccccchhhHHH
Q psy16646        119 KTRNSIGITVRQNQTNKN  136 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~  136 (159)
                      +.|++||..|....++..
T Consensus        16 ~qC~qCG~~~t~~~sqan   33 (465)
T COG4640          16 VQCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             ccccccCCcCCchhhhhh
Confidence            346666666665554433


No 229
>KOG0978|consensus
Probab=24.76  E-value=23  Score=29.18  Aligned_cols=21  Identities=10%  Similarity=0.075  Sum_probs=11.6

Q ss_pred             hhhhccccccccCccccchhhH
Q psy16646        113 EIEREMKTRNSIGITVRQNQTN  134 (159)
Q Consensus       113 ~~~~~~~~C~~C~~~f~~~~~l  134 (159)
                      .+.+. .+||.|+..|....-+
T Consensus       674 ~etRq-RKCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  674 YETRQ-RKCPKCNAAFGANDVH  694 (698)
T ss_pred             HHHhc-CCCCCCCCCCCccccc
Confidence            34444 5567777666554433


No 230
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=24.66  E-value=20  Score=19.24  Aligned_cols=8  Identities=25%  Similarity=0.721  Sum_probs=3.5

Q ss_pred             cccccccc
Q psy16646         62 RVICEICN   69 (159)
Q Consensus        62 ~~~c~~c~   69 (159)
                      ...|+.|.
T Consensus        44 VArCPSCS   51 (67)
T COG5216          44 VARCPSCS   51 (67)
T ss_pred             EEEcCCce
Confidence            33444443


No 231
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=24.63  E-value=32  Score=22.38  Aligned_cols=14  Identities=0%  Similarity=-0.218  Sum_probs=12.0

Q ss_pred             ccccccCccccchh
Q psy16646        119 KTRNSIGITVRQNQ  132 (159)
Q Consensus       119 ~~C~~C~~~f~~~~  132 (159)
                      -.|..||++|++.-
T Consensus        29 ReC~~C~~RFTTyE   42 (147)
T TIGR00244        29 RECLECHERFTTFE   42 (147)
T ss_pred             ccCCccCCccceee
Confidence            67999999998864


No 232
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=24.01  E-value=12  Score=18.13  Aligned_cols=33  Identities=6%  Similarity=0.059  Sum_probs=15.7

Q ss_pred             CccccccccCccchhhhhhhhhhhhccc-cccccCcccc
Q psy16646         92 CSLCQQAFKRDKHSKGDDIREEIEREMK-TRNSIGITVR  129 (159)
Q Consensus        92 C~~C~~~f~~~~~l~~h~~~~~~~~~~~-~C~~C~~~f~  129 (159)
                      |.+||..........     ..+.+.+| -|+.|-..|.
T Consensus         1 Cd~CG~~I~~eP~~~-----k~~~~~y~fCC~tC~~~fk   34 (37)
T PF08394_consen    1 CDYCGGEITGEPIVV-----KIGNKVYYFCCPTCLSQFK   34 (37)
T ss_pred             CCccCCcccCCEEEE-----EECCeEEEEECHHHHHHHH
Confidence            556665555443321     22333333 3366666654


No 233
>KOG3002|consensus
Probab=23.11  E-value=1.5e+02  Score=21.86  Aligned_cols=57  Identities=16%  Similarity=0.213  Sum_probs=25.1

Q ss_pred             cccccccccccChhhHHHHHhhhCCCcccCc----cccccccCccchhhhhhhhhhhhccccccc
Q psy16646         63 VICEICNKEFTHKSSLAEHRVLHFPAQHKCS----LCQQAFKRDKHSKGDDIREEIEREMKTRNS  123 (159)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~h~~k~~~C~----~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~  123 (159)
                      ..|+.|...+.....+....-. ......|+    .|.+.|.+... ..|.+.... ++ +.|+.
T Consensus        81 ~~CP~Cr~~~g~~R~~amEkV~-e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f-~~-~~CP~  141 (299)
T KOG3002|consen   81 NKCPTCRLPIGNIRCRAMEKVA-EAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF-RP-CSCPV  141 (299)
T ss_pred             ccCCccccccccHHHHHHHHHH-HhceecccccccCCceeeccccc-ccccccccc-CC-cCCCC
Confidence            3455555555544443332211 11123333    35566666555 335444443 34 55543


No 234
>PRK00420 hypothetical protein; Validated
Probab=23.10  E-value=42  Score=20.75  Aligned_cols=8  Identities=13%  Similarity=0.384  Sum_probs=3.6

Q ss_pred             ccCccccc
Q psy16646         90 HKCSLCQQ   97 (159)
Q Consensus        90 ~~C~~C~~   97 (159)
                      ..|+.||.
T Consensus        41 ~~Cp~Cg~   48 (112)
T PRK00420         41 VVCPVHGK   48 (112)
T ss_pred             eECCCCCC
Confidence            33444444


No 235
>KOG1842|consensus
Probab=23.06  E-value=26  Score=27.16  Aligned_cols=23  Identities=26%  Similarity=0.587  Sum_probs=17.1

Q ss_pred             CccccccccccccChhhHHHHHh
Q psy16646         61 DRVICEICNKEFTHKSSLAEHRV   83 (159)
Q Consensus        61 ~~~~c~~c~~~f~~~~~l~~h~~   83 (159)
                      ..|.|++|...|.+...|..|..
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHh
Confidence            45778888888888888777754


No 236
>KOG0717|consensus
Probab=22.71  E-value=55  Score=25.68  Aligned_cols=21  Identities=33%  Similarity=0.774  Sum_probs=19.0

Q ss_pred             cccccccccccChHHHHHHHh
Q psy16646         33 FHCYVCKKKYRHKRQLVRHFQ   53 (159)
Q Consensus        33 ~~C~~c~~~f~~~~~l~~h~~   53 (159)
                      +.|.+|+++|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            889999999999999988875


No 237
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=22.57  E-value=43  Score=20.30  Aligned_cols=14  Identities=29%  Similarity=0.897  Sum_probs=6.9

Q ss_pred             cccCccccccccCc
Q psy16646         89 QHKCSLCQQAFKRD  102 (159)
Q Consensus        89 ~~~C~~C~~~f~~~  102 (159)
                      |+.|..||..|...
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            34455555555443


No 238
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=22.09  E-value=40  Score=26.46  Aligned_cols=24  Identities=29%  Similarity=0.452  Sum_probs=19.9

Q ss_pred             CccccccccccccChhhHHHHHhh
Q psy16646         61 DRVICEICNKEFTHKSSLAEHRVL   84 (159)
Q Consensus        61 ~~~~c~~c~~~f~~~~~l~~h~~~   84 (159)
                      +-|.|..|.+.|.+...+..|+..
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHH
Confidence            567899999999999999888753


No 239
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=21.78  E-value=2.5e+02  Score=18.64  Aligned_cols=59  Identities=15%  Similarity=0.175  Sum_probs=35.1

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhccccc--cccCccccchhhHHHh-hccCCCccccccC
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIEREMKTR--NSIGITVRQNQTNKNH-RSGDQKKKTAKQL  150 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C--~~C~~~f~~~~~l~~H-~~~h~~~k~~~~~  150 (159)
                      ...|+.|.-........ ...+.+-..|+ ..|  +.|++.=+ ...|+.| +..|...+|-+--
T Consensus        80 ~L~CPLCRG~V~GWtvv-e~AR~~LN~K~-RsC~~e~C~F~Gt-Y~eLrKHar~~HP~~rP~~vD  141 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVV-EPARRFLNAKK-RSCSQESCSFSGT-YSELRKHARSEHPSARPSEVD  141 (162)
T ss_pred             cccCccccCceeceEEc-hHHHHHhccCC-ccCcccccccccC-HHHHHHHHHhhCCCCCCccCC
Confidence            56788885433333222 23555666666 667  45665543 4589999 4457777775543


No 240
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=21.66  E-value=66  Score=16.62  Aligned_cols=35  Identities=14%  Similarity=0.025  Sum_probs=16.0

Q ss_pred             cCCCCCCCCCCCCC-cccCCCCCccccccccccccC
Q psy16646         10 KNPNAKKRYRPYVP-RVDSSLPPQFHCYVCKKKYRH   44 (159)
Q Consensus        10 ~~~~~~~~~~~~~~-~~~h~~~~~~~C~~c~~~f~~   44 (159)
                      +||.|+..-....- ...-.+..-+.|..|+.....
T Consensus         3 PCPfCGg~~~~~~~~~~~~~~~~~~~C~~Cga~~~~   38 (53)
T TIGR03655         3 PCPFCGGADVYLRRGFDPLDLSHYFECSTCGASGPV   38 (53)
T ss_pred             CCCCCCCcceeeEeccCCCCCEEEEECCCCCCCccc
Confidence            57777775552211 011111122357777665443


No 241
>KOG1842|consensus
Probab=21.33  E-value=48  Score=25.81  Aligned_cols=29  Identities=14%  Similarity=0.204  Sum_probs=15.3

Q ss_pred             cccCccccccccCccchhhhhhhhhhhhc
Q psy16646         89 QHKCSLCQQAFKRDKHSKGDDIREEIERE  117 (159)
Q Consensus        89 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~  117 (159)
                      .|.|++|+..|.....|..|.-..|++..
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~ed   43 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEED   43 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccccc
Confidence            35555555555555555555555554444


No 242
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=21.11  E-value=35  Score=16.39  Aligned_cols=11  Identities=18%  Similarity=0.111  Sum_probs=5.6

Q ss_pred             cccccccCccc
Q psy16646        118 MKTRNSIGITV  128 (159)
Q Consensus       118 ~~~C~~C~~~f  128 (159)
                      .|+|..||-..
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            38888888653


No 243
>PF14122 YokU:  YokU-like protein
Probab=21.09  E-value=53  Score=19.21  Aligned_cols=22  Identities=9%  Similarity=0.172  Sum_probs=15.5

Q ss_pred             hhhccccccccCccccchhhHH
Q psy16646        114 IEREMKTRNSIGITVRQNQTNK  135 (159)
Q Consensus       114 ~~~~~~~C~~C~~~f~~~~~l~  135 (159)
                      .+-|...|..||..+.....+.
T Consensus        31 ~~tP~i~C~~CgmvYq~d~vi~   52 (87)
T PF14122_consen   31 TDTPAIICSNCGMVYQDDEVIK   52 (87)
T ss_pred             cCCceeeecCCCcEEehhHHHH
Confidence            3445588999999887775543


No 244
>KOG3362|consensus
Probab=21.06  E-value=59  Score=21.09  Aligned_cols=18  Identities=33%  Similarity=0.647  Sum_probs=7.2

Q ss_pred             cccccccccccChHHHHH
Q psy16646         33 FHCYVCKKKYRHKRQLVR   50 (159)
Q Consensus        33 ~~C~~c~~~f~~~~~l~~   50 (159)
                      |.|..||..+.+..-+..
T Consensus       130 ysC~~CG~kyCsv~C~~~  147 (156)
T KOG3362|consen  130 YSCVNCGTKYCSVRCLKT  147 (156)
T ss_pred             hHHHhcCCceeechhhhh
Confidence            334444444444333333


No 245
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=21.05  E-value=82  Score=23.76  Aligned_cols=20  Identities=20%  Similarity=0.384  Sum_probs=10.2

Q ss_pred             CccccccccCccchhhhhhh
Q psy16646         92 CSLCQQAFKRDKHSKGDDIR  111 (159)
Q Consensus        92 C~~C~~~f~~~~~l~~h~~~  111 (159)
                      |..|...|.....|..|.+.
T Consensus       223 C~FC~~~FYdDDEL~~HcR~  242 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRL  242 (493)
T ss_pred             hhhccceecChHHHHHHHHh
Confidence            55555555555555555443


No 246
>KOG2807|consensus
Probab=20.89  E-value=99  Score=23.14  Aligned_cols=24  Identities=13%  Similarity=-0.182  Sum_probs=18.7

Q ss_pred             ccccccCccccchhhHHHhhccCC
Q psy16646        119 KTRNSIGITVRQNQTNKNHRSGDQ  142 (159)
Q Consensus       119 ~~C~~C~~~f~~~~~l~~H~~~h~  142 (159)
                      |.|..|...|--.-..-.|...|.
T Consensus       346 y~C~~Ck~~FCldCDv~iHesLh~  369 (378)
T KOG2807|consen  346 YRCESCKNVFCLDCDVFIHESLHN  369 (378)
T ss_pred             EEchhccceeeccchHHHHhhhhc
Confidence            888888888887777777766664


No 247
>PRK11823 DNA repair protein RadA; Provisional
Probab=20.83  E-value=46  Score=25.93  Aligned_cols=7  Identities=29%  Similarity=0.994  Sum_probs=3.8

Q ss_pred             ccCcccc
Q psy16646         90 HKCSLCQ   96 (159)
Q Consensus        90 ~~C~~C~   96 (159)
                      +.|+.|+
T Consensus        22 g~Cp~C~   28 (446)
T PRK11823         22 GRCPECG   28 (446)
T ss_pred             eeCcCCC
Confidence            4555554


No 248
>KOG0782|consensus
Probab=20.81  E-value=49  Score=26.77  Aligned_cols=35  Identities=14%  Similarity=0.177  Sum_probs=16.0

Q ss_pred             cCccccccccCccchhhhhhhhhhhhccccccccCccccch
Q psy16646         91 KCSLCQQAFKRDKHSKGDDIREEIEREMKTRNSIGITVRQN  131 (159)
Q Consensus        91 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~  131 (159)
                      +|..||+.|.+...+.      ..|--...|++|...|...
T Consensus       255 kC~~CgKgFQQKf~Fh------sKEivAisCSWCKqayH~K  289 (1004)
T KOG0782|consen  255 KCNTCGKGFQQKFFFH------SKEIVAISCSWCKQAYHLK  289 (1004)
T ss_pred             ccchhhhhhhhheeec------cccEEEEEehHHHHHhhcc
Confidence            4555666655543321      1111114456665555444


No 249
>KOG2071|consensus
Probab=20.56  E-value=49  Score=26.66  Aligned_cols=27  Identities=11%  Similarity=0.220  Sum_probs=22.5

Q ss_pred             hhccccccccCccccchhhHHHhhccCC
Q psy16646        115 EREMKTRNSIGITVRQNQTNKNHRSGDQ  142 (159)
Q Consensus       115 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~  142 (159)
                      ..+ ..|..||.+|-.......|+..|.
T Consensus       416 ~~p-nqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSP-NQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCc-chhcccccccccchhhhhHhhhhh
Confidence            445 889999999999988888877776


Done!