Query         psy16648
Match_columns 56
No_of_seqs    103 out of 147
Neff          3.1 
Searched_HMMs 46136
Date          Fri Aug 16 18:25:14 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16648.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16648hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03200 Glyco_hydro_63:  Manno  99.8   6E-22 1.3E-26  155.6   3.5   51    4-55     42-92  (801)
  2 KOG2161|consensus               99.7 5.5E-18 1.2E-22  135.9   1.5   52    4-55     83-134 (849)
  3 PF04190 DUF410:  Protein of un  54.0       3 6.5E-05   29.1  -0.8   18   21-38    237-255 (260)
  4 KOG3024|consensus               49.7     3.3   7E-05   31.4  -1.2   13   20-32    278-290 (312)
  5 PF06820 Phage_fiber_C:  Putati  38.8      27 0.00059   21.2   1.9   31   24-54     17-47  (64)
  6 PF11283 DUF3084:  Protein of u  37.2     9.1  0.0002   23.9  -0.4   14   22-35     34-47  (79)
  7 PF00284 Cytochrom_B559a:  Lume  35.9      11 0.00024   21.0  -0.2   21   14-35      6-26  (40)
  8 PF13630 SdpI:  SdpI/YhfL prote  34.9      24 0.00053   19.5   1.2   13   17-29      3-15  (76)
  9 COG5321 Uncharacterized protei  29.6      26 0.00056   24.5   0.8   30   11-40     77-112 (164)
 10 PF04334 DUF478:  Protein of un  26.1      39 0.00084   20.6   1.1   35    2-42      3-39  (68)
 11 smart00047 LYZ2 Lysozyme subfa  22.2      66  0.0014   20.8   1.6   20   14-33     43-67  (147)
 12 PRK09855 PTS system N-acetylga  20.7      11 0.00023   27.3  -2.5   11    9-19    106-116 (263)

No 1  
>PF03200 Glyco_hydro_63:  Mannosyl oligosaccharide glucosidase;  InterPro: IPR004888 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.  This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63 (GH63 from CAZY). They catalyse the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase 3.2.1.106 from EC is the first enzyme in the N-linked oligosaccharide processing pathway. ; GO: 0004573 mannosyl-oligosaccharide glucosidase activity, 0009311 oligosaccharide metabolic process
Probab=99.84  E-value=6e-22  Score=155.62  Aligned_cols=51  Identities=43%  Similarity=0.851  Sum_probs=46.8

Q ss_pred             eccCCCCceeeecCCCCceeeeecCCCCCceEeeeeecCCccCCCccccccc
Q psy16648          4 KSGLAVRDRYWGSYRPGTYFGMKTREPYSPVVGLMWFFPNKLINGEGFIRKN   55 (56)
Q Consensus         4 ~s~~~n~sl~WGtYRp~lYFG~r~R~p~sl~~GLmW~~~~~~~~~~~~~r~~   55 (56)
                      .+..+|++|+|||||||+|||||||+|+||++||||+++++ .+++..+||.
T Consensus        42 ~~~~~n~sl~WGtYRP~lYFGmr~R~p~sl~~GLMW~~~~~-~~~~~~iRH~   92 (801)
T PF03200_consen   42 FSGEHNDSLLWGTYRPNLYFGMRPRSPKSLLTGLMWFDQDS-YDGQSKIRHT   92 (801)
T ss_pred             hccccCccccccccCCcceEeeccCCCCCceeeeeeeeccc-cccccceeEe
Confidence            47888999999999999999999999999999999999965 5678999985


No 2  
>KOG2161|consensus
Probab=99.69  E-value=5.5e-18  Score=135.85  Aligned_cols=52  Identities=33%  Similarity=0.682  Sum_probs=48.4

Q ss_pred             eccCCCCceeeecCCCCceeeeecCCCCCceEeeeeecCCccCCCccccccc
Q psy16648          4 KSGLAVRDRYWGSYRPGTYFGMKTREPYSPVVGLMWFFPNKLINGEGFIRKN   55 (56)
Q Consensus         4 ~s~~~n~sl~WGtYRp~lYFG~r~R~p~sl~~GLmW~~~~~~~~~~~~~r~~   55 (56)
                      .+++.+++++|||||||+|||||||+|+|+++||||+.+++.....-.+||+
T Consensus        83 ~~~~~~psl~WGtYRp~lYFGlr~r~p~slm~GLMW~~~~~~~p~~~~lRH~  134 (849)
T KOG2161|consen   83 LQGETNPSLLWGTYRPNLYFGLRPRSPHSLMTGLMWYNQKDTFPYKPKLRHF  134 (849)
T ss_pred             hccccCCcccccCCCcceEEeecCCCchhhhhhhheecccccCCcchhhhhh
Confidence            4678999999999999999999999999999999999999988877888886


No 3  
>PF04190 DUF410:  Protein of unknown function (DUF410) ;  InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function.; PDB: 3LKU_E 2WPV_G.
Probab=54.04  E-value=3  Score=29.13  Aligned_cols=18  Identities=22%  Similarity=0.506  Sum_probs=3.4

Q ss_pred             ceeeeecCCCCC-ceEeee
Q psy16648         21 TYFGMKTREPYS-PVVGLM   38 (56)
Q Consensus        21 lYFG~r~R~p~s-l~~GLm   38 (56)
                      +|||+++..+.+ .+.|||
T Consensus       237 ~yFgi~~~~~~~~~l~~mm  255 (260)
T PF04190_consen  237 LYFGIQPPQQQNGMLGDMM  255 (260)
T ss_dssp             HHH---S------------
T ss_pred             HHCCCCCCCCCCchHHHHH
Confidence            799999765555 777776


No 4  
>KOG3024|consensus
Probab=49.73  E-value=3.3  Score=31.44  Aligned_cols=13  Identities=38%  Similarity=0.994  Sum_probs=11.8

Q ss_pred             CceeeeecCCCCC
Q psy16648         20 GTYFGMKTREPYS   32 (56)
Q Consensus        20 ~lYFG~r~R~p~s   32 (56)
                      .+|||++|..|.|
T Consensus       278 elyFgi~~~~~~s  290 (312)
T KOG3024|consen  278 ELYFGIRPKQPLS  290 (312)
T ss_pred             HHHcCCCCCcccc
Confidence            3799999999999


No 5  
>PF06820 Phage_fiber_C:  Putative prophage tail fibre C-terminus;  InterPro: IPR009640 This entry represents the C terminus of phage 933W tail fibre protein. This domain is found together with conserved RLGP motif. The characteristics of the protein distribution suggest prophage matches.
Probab=38.78  E-value=27  Score=21.19  Aligned_cols=31  Identities=19%  Similarity=0.308  Sum_probs=25.6

Q ss_pred             eeecCCCCCceEeeeeecCCccCCCcccccc
Q psy16648         24 GMKTREPYSPVVGLMWFFPNKLINGEGFIRK   54 (56)
Q Consensus        24 G~r~R~p~sl~~GLmW~~~~~~~~~~~~~r~   54 (56)
                      |.-|-..-.+++||.-..+.+....|.+||+
T Consensus        17 G~~P~tdg~liT~ltfL~pkd~~~vq~~f~~   47 (64)
T PF06820_consen   17 GWFPETDGRLITGLTFLDPKDATRVQGVFRH   47 (64)
T ss_pred             ccccCCCcceEeeeEEecccCchhheeeeee
Confidence            3345555689999999999999999999987


No 6  
>PF11283 DUF3084:  Protein of unknown function (DUF3084);  InterPro: IPR021435  This bacterial family of proteins has no known function. 
Probab=37.19  E-value=9.1  Score=23.92  Aligned_cols=14  Identities=29%  Similarity=0.439  Sum_probs=10.6

Q ss_pred             eeeeecCCCCCceE
Q psy16648         22 YFGMKTREPYSPVV   35 (56)
Q Consensus        22 YFG~r~R~p~sl~~   35 (56)
                      .||+|||....+++
T Consensus        34 lFgLRPr~Ta~lVt   47 (79)
T PF11283_consen   34 LFGLRPRYTAILVT   47 (79)
T ss_pred             hhcCCCccceeehH
Confidence            59999998765543


No 7  
>PF00284 Cytochrom_B559a:  Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit family.;  InterPro: IPR013082 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  The alpha subunit (PsbE) of cytochrome b559, forms a haem-binding heterodimer with the beta subunit (PsbF) (IPR006241 from INTERPRO) within the reaction centre core of PSII. Both PsbE and PsbF are essential components for PSII assembly, and are probably involved in secondary electron transport mechanisms that help to protect PSII from photo-damage []. This domain occurs in the lumenal region of the alpha subunit. It is usually found in conjuction with an N-terminal domain (IPR013081 from INTERPRO).; GO: 0046872 metal ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0016021 integral to membrane; PDB: 1W5C_K 1S5L_e 3BZ2_E 3PRQ_E 2AXT_E 4FBY_R 3PRR_E 3BZ1_E 3KZI_E 3A0H_E ....
Probab=35.92  E-value=11  Score=21.03  Aligned_cols=21  Identities=29%  Similarity=0.699  Sum_probs=7.4

Q ss_pred             eecCCCCceeeeecCCCCCceE
Q psy16648         14 WGSYRPGTYFGMKTREPYSPVV   35 (56)
Q Consensus        14 WGtYRp~lYFG~r~R~p~sl~~   35 (56)
                      .||=|||-||- -.|..-||++
T Consensus         6 FGtPRPneYft-~~rq~iPli~   26 (40)
T PF00284_consen    6 FGTPRPNEYFT-ESRQEIPLIT   26 (40)
T ss_dssp             CT---TTCSS--SS--S-----
T ss_pred             cCCCCcccccc-cccccCcccc
Confidence            58889999994 3444555543


No 8  
>PF13630 SdpI:  SdpI/YhfL protein family
Probab=34.91  E-value=24  Score=19.46  Aligned_cols=13  Identities=23%  Similarity=0.555  Sum_probs=10.5

Q ss_pred             CCCCceeeeecCC
Q psy16648         17 YRPGTYFGMKTRE   29 (56)
Q Consensus        17 YRp~lYFG~r~R~   29 (56)
                      =+||-.+|+|++.
T Consensus         3 ~~~N~~~G~Rt~~   15 (76)
T PF13630_consen    3 KKPNSWIGYRTPW   15 (76)
T ss_pred             CCCCCeeeEeChH
Confidence            3689999999864


No 9  
>COG5321 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.61  E-value=26  Score=24.52  Aligned_cols=30  Identities=30%  Similarity=0.563  Sum_probs=23.4

Q ss_pred             ceeeecCCCC---ceeeeecCCCCCce---Eeeeee
Q psy16648         11 DRYWGSYRPG---TYFGMKTREPYSPV---VGLMWF   40 (56)
Q Consensus        11 sl~WGtYRp~---lYFG~r~R~p~sl~---~GLmW~   40 (56)
                      ..-|+-||++   +||..-|-.|.-+.   -|||-.
T Consensus        77 DrKWpdYr~~cDr~fFAthp~vP~~IfPeecGlils  112 (164)
T COG5321          77 DRKWPDYRLHCDRLFFATHPSVPDEIFPEECGLILS  112 (164)
T ss_pred             cccCcchhhhchheeeeccCCCccccCcccCCeEee
Confidence            6789999999   89999998876553   455543


No 10 
>PF04334 DUF478:  Protein of unknown function (DUF478);  InterPro: IPR007429 This family contains uncharacterised protein encoded on Trypanosomal kinetoplast minicircles.
Probab=26.07  E-value=39  Score=20.60  Aligned_cols=35  Identities=20%  Similarity=0.423  Sum_probs=22.1

Q ss_pred             ceeccCCCCceeeecCCCCceeeeecCC--CCCceEeeeeecC
Q psy16648          2 VIKSGLAVRDRYWGSYRPGTYFGMKTRE--PYSPVVGLMWFFP   42 (56)
Q Consensus         2 ~~~s~~~n~sl~WGtYRp~lYFG~r~R~--p~sl~~GLmW~~~   42 (56)
                      |+.+...|+-++||-      |-+|--+  ---+++-..|...
T Consensus         3 vq~~~ytnpvlfwgi------fevrgtskgvgviltrffwvfs   39 (68)
T PF04334_consen    3 VQKYTYTNPVLFWGI------FEVRGTSKGVGVILTRFFWVFS   39 (68)
T ss_pred             ceeecCcCceEEEEE------EEEeecccceEEEEEEeeeecc
Confidence            467888999999997      4455433  2234555566543


No 11 
>smart00047 LYZ2 Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
Probab=22.17  E-value=66  Score=20.82  Aligned_cols=20  Identities=25%  Similarity=0.615  Sum_probs=13.3

Q ss_pred             eecCC----CCceeeee-cCCCCCc
Q psy16648         14 WGSYR----PGTYFGMK-TREPYSP   33 (56)
Q Consensus        14 WGtYR----p~lYFG~r-~R~p~sl   33 (56)
                      ||+-+    -|-+|||| +-..+++
T Consensus        43 wG~S~La~~~nNlFGIK~~~~g~~~   67 (147)
T smart00047       43 WGTSKLAKKYNNLFGIKGAYDGRPV   67 (147)
T ss_pred             CCCCCccCCCCCeeccccCCCCCce
Confidence            78765    47899998 4344443


No 12 
>PRK09855 PTS system N-acetylgalactosamine-specific transporter subunit IID; Provisional
Probab=20.72  E-value=11  Score=27.31  Aligned_cols=11  Identities=18%  Similarity=0.446  Sum_probs=8.7

Q ss_pred             CCceeeecCCC
Q psy16648          9 VRDRYWGSYRP   19 (56)
Q Consensus         9 n~sl~WGtYRp   19 (56)
                      -||++|||+||
T Consensus       106 GDSlf~gt~~p  116 (263)
T PRK09855        106 GDAIFWFTLLP  116 (263)
T ss_pred             hhHHHHHHHHH
Confidence            47888888887


Done!