Diaphorina citri psyllid: psy16649

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80---

SGENLCTLQIFRGCFQHNFHINYRDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEENASANVEKMLLGN

ccccEEEEEEEcccccEEEEEEEEEcccccHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEcc

****LCTLQIFRGCFQHNFHINYRDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEENASANVEKMLLGN

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SGENLCTLQIFRGCFQHNFHINYRDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEENASANVEKMLLGN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ras-related protein Rab-8A	May be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization.	very confident	P61007
Ras-related protein Rab-8A	May be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization.	very confident	P61006
Ras-related protein Rab-8A	May be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization.	very confident	Q5R4A3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006904 [BP]	vesicle docking involved in exocytosis	confident	GO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0022406, GO:0048278, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0043025 [CC]	neuronal cell body	confident	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005778 [CC]	peroxisomal membrane	confident	GO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0031513 [CC]	nonmotile primary cilium	confident	GO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0019003 [MF]	GDP binding	confident	GO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0031346 [BP]	positive regulation of cell projection organization	confident	GO:0051130, GO:0051128, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0031344, GO:0048522
GO:0045046 [BP]	protein import into peroxisome membrane	confident	GO:0033036, GO:0008104, GO:0015919, GO:0072663, GO:0072662, GO:0006612, GO:0051641, GO:0044699, GO:0071806, GO:0070727, GO:0006886, GO:0016043, GO:0051179, GO:0065002, GO:0071840, GO:0006810, GO:0072594, GO:0043574, GO:0034613, GO:0006625, GO:0017038, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0055085, GO:0044743, GO:0016482, GO:0006996, GO:0007031, GO:0071702, GO:0046907, GO:0015031, GO:0044763, GO:0009987
GO:0048471 [CC]	perinuclear region of cytoplasm	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0034332 [BP]	adherens junction organization	confident	GO:0034330, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0045216, GO:0008150, GO:0044699
GO:0014069 [CC]	postsynaptic density	confident	GO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0005525 [MF]	GTP binding	confident	GO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005932 [CC]	microtubule basal body	confident	GO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0005622, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0042995, GO:0043226, GO:0044422
GO:0005739 [CC]	mitochondrion	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]	Golgi apparatus	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051286 [CC]	cell tip	confident	GO:0005575, GO:0044464, GO:0005623, GO:0060187
GO:0051461 [BP]	positive regulation of corticotropin secretion	confident	GO:0090087, GO:0051046, GO:0051047, GO:0051049, GO:0051459, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0044057, GO:0065007, GO:0048518, GO:0051050, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0051239, GO:0046887, GO:0032879, GO:0044060, GO:0002791, GO:0002793, GO:0090277, GO:0048522
GO:0042384 [BP]	cilium assembly	confident	GO:0022607, GO:0030030, GO:0030031, GO:0010927, GO:0009653, GO:0044699, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0060271, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0032990, GO:0006996, GO:0048858, GO:0048856, GO:0044085, GO:0008150, GO:0044782
GO:0055037 [CC]	recycling endosome	confident	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0045335 [CC]	phagocytic vesicle	confident	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0048210 [BP]	Golgi vesicle fusion to target membrane	confident	GO:0006906, GO:0061025, GO:0061024, GO:0006944, GO:0044699, GO:0016044, GO:0016043, GO:0071840, GO:0009987, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0006996, GO:0016192, GO:0046907, GO:0016050, GO:0048284, GO:0044763
GO:0005886 [CC]	plasma membrane	confident	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0030911 [MF]	TPR domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0003924 [MF]	GTPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005789 [CC]	endoplasmic reticulum membrane	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0005741 [CC]	mitochondrial outer membrane	probable	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0030670 [CC]	phagocytic vesicle membrane	probable	GO:0030139, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0030666, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030659, GO:0045335, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0008021 [CC]	synaptic vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0007409 [BP]	axonogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0000139 [CC]	Golgi membrane	probable	GO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000131 [CC]	incipient cellular bud site	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0031045 [CC]	dense core granule	probable	GO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005923 [CC]	tight junction	probable	GO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0000331 [CC]	contractile vacuole	probable	GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0043229, GO:0005623, GO:0031988, GO:0005575, GO:0005773, GO:0044444, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0032402 [BP]	melanosome transport	probable	GO:0051875, GO:0051656, GO:0051234, GO:0043473, GO:0009987, GO:0006810, GO:0033059, GO:0051179, GO:0051905, GO:0051904, GO:0044765, GO:0008150, GO:0051640, GO:0051648, GO:0051649, GO:0044763, GO:0032401, GO:0032400, GO:0051650, GO:0044699, GO:0051641
GO:0032588 [CC]	trans-Golgi network membrane	probable	GO:0005802, GO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005102 [MF]	receptor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007264 [BP]	small GTPase mediated signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0019901 [MF]	protein kinase binding	probable	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0048169 [BP]	regulation of long-term neuronal synaptic plasticity	probable	GO:0010646, GO:0044057, GO:0031644, GO:0050804, GO:0050789, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0065008, GO:0048168, GO:0050794
GO:0000145 [CC]	exocyst	probable	GO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0017157 [BP]	regulation of exocytosis	probable	GO:0051046, GO:0060341, GO:0051049, GO:0050794, GO:0060627, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0032593 [CC]	insulin-responsive compartment	probable	GO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0071782 [CC]	endoplasmic reticulum tubular network	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009504 [CC]	cell plate	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0006184 [BP]	GTP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005797 [CC]	Golgi medial cisterna	probable	GO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0031489 [MF]	myosin V binding	probable	GO:0005488, GO:0003674, GO:0005515, GO:0017022, GO:0008092
GO:0017137 [MF]	Rab GTPase binding	probable	GO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0010975 [BP]	regulation of neuron projection development	probable	GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0008150
GO:0071786 [BP]	endoplasmic reticulum tubular network organization	probable	GO:0006996, GO:0007029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0030859 [BP]	polarized epithelial cell differentiation	probable	GO:0032502, GO:0002009, GO:0030154, GO:0048869, GO:0060429, GO:0009888, GO:0044767, GO:0001738, GO:0008150, GO:0048729, GO:0030855, GO:0044763, GO:0009987, GO:0009653, GO:0044699, GO:0048856
GO:0046331 [BP]	lateral inhibition	probable	GO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0009605 [BP]	response to external stimulus	probable	GO:0050896, GO:0008150
GO:0032794 [MF]	GTPase activating protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0055038 [CC]	recycling endosome membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0055037, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0006888 [BP]	ER to Golgi vesicle-mediated transport	probable	GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0009306 [BP]	protein secretion	probable	GO:0033036, GO:0046903, GO:0006810, GO:0071702, GO:0044765, GO:0045184, GO:0032940, GO:0008104, GO:0044763, GO:0051649, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0000407 [CC]	pre-autophagosomal structure	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0061467 [BP]	basolateral protein localization	probable	GO:0033036, GO:0008105, GO:0008104, GO:0008150, GO:0051179
GO:0033298 [BP]	contractile vacuole organization	probable	GO:0006996, GO:0007033, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0016050, GO:0008150, GO:0044699
GO:0035690 [BP]	cellular response to drug	probable	GO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0009826 [BP]	unidimensional cell growth	probable	GO:0032502, GO:0060560, GO:0016049, GO:0000902, GO:0048589, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699, GO:0040007
GO:0040018 [BP]	positive regulation of multicellular organism growth	probable	GO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0030538 [BP]	embryonic genitalia morphogenesis	probable	GO:0032502, GO:0048562, GO:0061458, GO:0048568, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0000003, GO:0048513, GO:0048806, GO:0048598, GO:0009887, GO:0032501, GO:0048608, GO:0044767, GO:0022414, GO:0008150, GO:0035112, GO:0007548, GO:0044707, GO:0003006, GO:0048856, GO:0048731
GO:0005764 [CC]	lysosome	probable	GO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032456 [BP]	endocytic recycling	probable	GO:0016197, GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006412 [BP]	translation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0070382 [CC]	exocytic vesicle	probable	GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0030133, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0071688 [BP]	striated muscle myosin thick filament assembly	probable	GO:0031034, GO:0031033, GO:0031032, GO:0070271, GO:0043933, GO:0051146, GO:0048468, GO:0030036, GO:0010927, GO:0022607, GO:0034622, GO:0061061, GO:0009653, GO:0044699, GO:0071822, GO:0048869, GO:0016043, GO:0032989, GO:0065003, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030154, GO:0030029, GO:0030239, GO:0006461, GO:0044767, GO:0008150, GO:0070925, GO:0043623, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0044763, GO:0009987, GO:0042692
GO:0051117 [MF]	ATPase binding	probable	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0070732 [CC]	spindle envelope	probable	GO:0005575, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0005623, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0030140 [CC]	trans-Golgi network transport vesicle	probable	GO:0030135, GO:0043229, GO:0030133, GO:0043227, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0031982, GO:0016023, GO:0031410, GO:0031988, GO:0044431, GO:0005794, GO:0005798, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0090404 [CC]	pollen tube tip	probable	GO:0035838, GO:0060187, GO:0051286, GO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0042995, GO:0090406
GO:0060473 [CC]	cortical granule	probable	GO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0019897 [CC]	extrinsic to plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0048786 [CC]	presynaptic active zone	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0010769 [BP]	regulation of cell morphogenesis involved in differentiation	probable	GO:0022604, GO:0022603, GO:0050793, GO:0060284, GO:0051128, GO:0045595, GO:0065007, GO:0008150, GO:0050794, GO:0050789
GO:0043954 [BP]	cellular component maintenance	probable	GO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0016339 [BP]	calcium-dependent cell-cell adhesion	probable	GO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0045200 [BP]	establishment of neuroblast polarity	probable	GO:0055059, GO:0030154, GO:0055057, GO:0045196, GO:0048103, GO:0007163, GO:0030010, GO:0007405, GO:0051301, GO:0048869, GO:0007275, GO:0044699, GO:0061351, GO:0032502, GO:0032501, GO:0008283, GO:0009987, GO:0044763, GO:0048731, GO:0022008, GO:0017145, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0072089
GO:0007269 [BP]	neurotransmitter secretion	probable	GO:0019226, GO:0035637, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0044699, GO:0065007, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0044707, GO:0008150, GO:0006836
GO:0097051 [BP]	establishment of protein localization to endoplasmic reticulum membrane	probable	GO:0033036, GO:0008104, GO:0070727, GO:0090150, GO:0071840, GO:0034613, GO:0016043, GO:0045184, GO:0061024, GO:0044763, GO:0072657, GO:0016044, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0043652 [BP]	engulfment of apoptotic cell	probable	GO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0006911, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0043277, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0031901 [CC]	early endosome membrane	probable	GO:0005737, GO:0005575, GO:0043226, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0005769, GO:0044422, GO:0010008
GO:0072659 [BP]	protein localization to plasma membrane	probable	GO:0008104, GO:0070727, GO:0016044, GO:0071840, GO:0034613, GO:0016043, GO:0061024, GO:0007009, GO:0044763, GO:0072657, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0044703 [BP]	multi-organism reproductive process	probable	GO:0022414, GO:0008150, GO:0000003
GO:0033554 [BP]	cellular response to stress	probable	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0031157 [BP]	regulation of aggregate size involved in sorocarp development	probable	GO:0032107, GO:0032104, GO:0032101, GO:0050793, GO:0080134, GO:2000241, GO:0048583, GO:2000026, GO:0060176, GO:0031155, GO:0031156, GO:0065007, GO:0075260, GO:0051239, GO:0008150, GO:0065008, GO:0050789
GO:0005934 [CC]	cellular bud tip	probable	GO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0005635 [CC]	nuclear envelope	probable	GO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043001 [BP]	Golgi to plasma membrane protein transport	probable	GO:0008104, GO:0016482, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0033036, GO:0034613, GO:0048193, GO:0006810, GO:0045184, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0006893, GO:0006892, GO:0016192, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0001558 [BP]	regulation of cell growth	probable	GO:0040008, GO:0050794, GO:0008150, GO:0065007, GO:0051128, GO:0050789
GO:0048610 [BP]	cellular process involved in reproduction	probable	GO:0009987, GO:0008150, GO:0000003
GO:0032869 [BP]	cellular response to insulin stimulus	probable	GO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0001525 [BP]	angiogenesis	probable	GO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0032154 [CC]	cleavage furrow	probable	GO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0006913 [BP]	nucleocytoplasmic transport	probable	GO:0051169, GO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0001881 [BP]	receptor recycling	probable	GO:0044260, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0065007, GO:0008152, GO:0023051, GO:0008150, GO:0043112, GO:0050789
GO:0031521 [CC]	spitzenkorper	probable	GO:0043234, GO:0032991, GO:0030427, GO:0001411, GO:0044464, GO:0005623, GO:0005575
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0006898 [BP]	receptor-mediated endocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0032585 [CC]	multivesicular body membrane	probable	GO:0005737, GO:0005575, GO:0016020, GO:0043226, GO:0031090, GO:0043227, GO:0005771, GO:0005770, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0031902, GO:0044422, GO:0010008
GO:0048638 [BP]	regulation of developmental growth	probable	GO:0050793, GO:0008150, GO:0040008, GO:0065007, GO:0050789
GO:0051704 [BP]	multi-organism process	probable	GO:0008150
GO:0005793 [CC]	endoplasmic reticulum-Golgi intermediate compartment	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032781 [BP]	positive regulation of ATPase activity	probable	GO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0050789, GO:0043085, GO:0043462, GO:0031329, GO:0051345, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0033121, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0040039 [BP]	inductive cell migration	probable	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0016477, GO:0051179, GO:0044699
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0000910 [BP]	cytokinesis	probable	GO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0009873 [BP]	ethylene mediated signaling pathway	probable	GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0009755, GO:0051716, GO:0000160, GO:0071310, GO:0065007, GO:0071495, GO:0009719, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0042221, GO:0010033, GO:0044700, GO:0009725, GO:0050896, GO:0071369, GO:0009723, GO:0008150
GO:0018125 [BP]	peptidyl-cysteine methylation	probable	GO:0006479, GO:0044267, GO:0018198, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0018193, GO:0043170, GO:0008213, GO:0071704, GO:0043412, GO:0036211, GO:0043414, GO:0006464, GO:0008152, GO:0008150, GO:0032259
GO:0050708 [BP]	regulation of protein secretion	probable	GO:0070201, GO:0051223, GO:0051046, GO:0060341, GO:0051049, GO:0050794, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0032880
GO:0031226 [CC]	intrinsic to plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0048477 [BP]	oogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0045177 [CC]	apical part of cell	probable	GO:0005575, GO:0044464, GO:0005623
GO:0034498 [BP]	early endosome to Golgi transport	probable	GO:0016197, GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0042147, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0009628 [BP]	response to abiotic stimulus	probable	GO:0050896, GO:0008150
GO:0001669 [CC]	acrosomal vesicle	probable	GO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0043195 [CC]	terminal bouton	probable	GO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0045169 [CC]	fusome	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0040002 [BP]	collagen and cuticulin-based cuticle development	probable	GO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0001671 [MF]	ATPase activator activity	probable	GO:0003674, GO:0030234, GO:0060589, GO:0008047, GO:0060590
GO:0071236 [BP]	cellular response to antibiotic	probable	GO:0051716, GO:0097237, GO:0009987, GO:0009636, GO:0008150, GO:0044763, GO:0046677, GO:0070887, GO:0042221, GO:0050896, GO:0044699
GO:0042470 [CC]	melanosome	probable	GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0048770, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0044464, GO:0005622, GO:0043227, GO:0043226, GO:0031982

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FU5, chain C
Confidence level:very confident
Coverage over the Query: 17-83
View the alignment between query and template
View the model in PyMOL