Diaphorina citri psyllid: psy1667


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MFKERKAAERRRVIEQRCGTHKDWTNADEATVNKILKELWDRAFKLESEKYDLEIIFRVKEAEITELNAQVNDLRGKFIKPTLKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPEWTKVGGDKGKEEES
cHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
**********RRVIEQRCGTHKDWTNADEATVNKILKELWDRAFKLESEKYDLEIIFRVKEAEITELNAQVNDLRGKFIKPTLKKVSKYENKFAKLQKKAAEFNFRNQLKVV*******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKERKAAERRRVIEQRCGTHKDWTNADEATVNKILKELWDRAFKLESEKYDLEIIxxxxxxxxxxxxxxxxxxxxxFIKPTLKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPEWTKVGGDKGKEEES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Troponin I 4 Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to muscle actomyosin ATPase activity.confidentO44572

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0006937 [BP]regulation of muscle contractionprobableGO:0044057, GO:0008150, GO:0090257, GO:0051239, GO:0065007, GO:0050789
GO:0005865 [CC]striated muscle thin filamentprobableGO:0036379, GO:0044446, GO:0043228, GO:0015629, GO:0043232, GO:0005856, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0030016, GO:0030017, GO:0043229, GO:0044430, GO:0043292, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044422, GO:0044449
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J1E, chain C
Confidence level:very confident
Coverage over the Query: 14-74,85-98
View the alignment between query and template
View the model in PyMOL