Query         psy16683
Match_columns 139
No_of_seqs    187 out of 1138
Neff          7.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:19:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16683.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16683hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd07166 NR_DBD_REV_ERB DNA-bin 100.0 8.4E-32 1.8E-36  181.3   3.2   86    1-86      2-87  (89)
  2 cd06964 NR_DBD_RAR DNA-binding 100.0   6E-31 1.3E-35  175.8   3.4   82    1-83      3-84  (85)
  3 cd07163 NR_DBD_TLX DNA-binding 100.0 1.2E-30 2.6E-35  176.7   3.8   82    1-83      5-88  (92)
  4 cd06967 NR_DBD_TR2_like DNA-bi 100.0 2.5E-30 5.4E-35  173.5   3.4   81    2-83      3-83  (87)
  5 cd06957 NR_DBD_PNR_like_2 DNA- 100.0 3.2E-30 6.9E-35  171.2   3.8   78    5-83      1-79  (82)
  6 cd06965 NR_DBD_Ppar DNA-bindin 100.0 2.7E-30 5.9E-35  172.3   3.3   81    4-86      1-81  (84)
  7 cd06961 NR_DBD_TR DNA-binding  100.0 1.7E-30 3.6E-35  173.6   1.8   79    4-83      1-79  (85)
  8 cd06970 NR_DBD_PNR DNA-binding 100.0 3.1E-30 6.8E-35  174.5   3.1   80    3-83      7-87  (92)
  9 cd07168 NR_DBD_DHR4_like DNA-b 100.0 3.8E-30 8.2E-35  173.6   2.3   81    2-83      6-86  (90)
 10 cd07170 NR_DBD_ERR DNA-binding 100.0 3.8E-30 8.3E-35  175.6   2.3   80    3-83      5-84  (97)
 11 cd06956 NR_DBD_RXR DNA-binding 100.0 1.8E-30 3.9E-35  170.6   0.6   76    4-80      2-77  (77)
 12 cd06960 NR_DBD_HNF4A DNA-bindi 100.0 5.2E-30 1.1E-34  168.0   2.8   76    5-81      1-76  (76)
 13 cd07157 2DBD_NR_DBD1 The first 100.0 9.7E-30 2.1E-34  170.3   3.9   81    3-83      1-82  (86)
 14 cd07164 NR_DBD_PNR_like_1 DNA- 100.0 4.5E-30 9.7E-35  169.0   2.2   77    5-82      1-77  (78)
 15 cd07171 NR_DBD_ER DNA-binding  100.0 2.7E-30 5.9E-35  171.5   1.0   79    2-81      3-81  (82)
 16 cd07155 NR_DBD_ER_like DNA-bin 100.0 3.2E-30 6.8E-35  168.6   1.0   75    5-80      1-75  (75)
 17 cd07165 NR_DBD_DmE78_like DNA- 100.0 4.8E-30   1E-34  170.0   1.7   78    5-83      1-78  (81)
 18 cd06968 NR_DBD_ROR DNA-binding 100.0 1.2E-29 2.6E-34  172.7   3.4   84    2-86      5-88  (95)
 19 cd07160 NR_DBD_LXR DNA-binding 100.0 7.2E-30 1.6E-34  175.4   1.7   81    2-83     18-98  (101)
 20 cd07169 NR_DBD_GCNF_like DNA-b 100.0 1.1E-29 2.4E-34  171.3   2.1   81    2-83      6-86  (90)
 21 cd07161 NR_DBD_EcR DNA-binding 100.0 7.7E-30 1.7E-34  172.4   1.2   80    3-83      2-81  (91)
 22 cd06966 NR_DBD_CAR DNA-binding 100.0 1.7E-29 3.6E-34  171.7   2.7   80    3-83      1-80  (94)
 23 KOG4215|consensus              100.0 3.5E-30 7.6E-35  207.7  -1.2   82    2-84     19-100 (432)
 24 cd06969 NR_DBD_NGFI-B DNA-bind 100.0 2.6E-29 5.6E-34  164.3   3.0   75    3-78      1-75  (75)
 25 cd06962 NR_DBD_FXR DNA-binding 100.0   2E-29 4.4E-34  168.0   2.4   79    3-82      2-80  (84)
 26 KOG4216|consensus               99.9 2.3E-29   5E-34  204.2   1.3   84    3-87     47-130 (479)
 27 cd07179 2DBD_NR_DBD2 The secon  99.9   2E-29 4.3E-34  164.5   0.8   74    5-79      1-74  (74)
 28 cd07167 NR_DBD_Lrh-1_like The   99.9 2.8E-29   6E-34  170.2   1.5   78    5-83      1-78  (93)
 29 cd07154 NR_DBD_PNR_like The DN  99.9 9.3E-29   2E-33  160.9   2.9   72    5-77      1-73  (73)
 30 cd06916 NR_DBD_like DNA-bindin  99.9 1.1E-28 2.4E-33  160.1   3.0   72    5-77      1-72  (72)
 31 cd07158 NR_DBD_Ppar_like The D  99.9 7.3E-29 1.6E-33  161.4   1.8   73    5-77      1-73  (73)
 32 cd06955 NR_DBD_VDR DNA-binding  99.9 1.3E-28 2.9E-33  170.6   3.1   79    2-81      6-84  (107)
 33 cd06958 NR_DBD_COUP_TF DNA-bin  99.9 9.1E-29   2E-33  160.9   1.7   72    5-77      1-72  (73)
 34 cd07156 NR_DBD_VDR_like The DN  99.9 1.2E-28 2.6E-33  160.0   1.8   71    5-76      1-71  (72)
 35 KOG4846|consensus               99.9 2.2E-29 4.8E-34  205.7  -2.2   83    3-85    133-215 (538)
 36 cd06959 NR_DBD_EcR_like The DN  99.9 1.9E-28 4.1E-33  159.4   1.4   73    4-77      1-73  (73)
 37 cd07172 NR_DBD_GR_PR DNA-bindi  99.9 3.7E-28   8E-33  159.9   2.1   74    3-77      3-76  (78)
 38 cd07162 NR_DBD_PXR DNA-binding  99.9 1.7E-28 3.7E-33  164.6   0.5   78    4-82      1-78  (87)
 39 cd07173 NR_DBD_AR DNA-binding   99.9 3.2E-28   7E-33  161.5   1.2   74    2-76      3-76  (82)
 40 cd06963 NR_DBD_GR_like The DNA  99.9 3.8E-28 8.2E-33  158.0   1.5   72    5-77      1-72  (73)
 41 smart00399 ZnF_C4 c4 zinc fing  99.9 4.3E-27 9.4E-32  151.8   2.8   70    4-74      1-70  (70)
 42 PF00105 zf-C4:  Zinc finger, C  99.9 2.4E-26 5.3E-31  148.1  -1.4   69    3-72      1-69  (70)
 43 KOG4217|consensus               99.9 4.1E-24 8.9E-29  177.1  -1.3   76    3-79    270-345 (605)
 44 KOG4218|consensus               99.9 7.6E-24 1.7E-28  170.3  -1.2   80    2-82     15-94  (475)
 45 PF01412 ArfGap:  Putative GTPa  72.7    0.65 1.4E-05   32.2  -1.3   30    2-31     13-45  (116)
 46 PF03107 C1_2:  C1 domain;  Int  64.3     3.7   8E-05   21.6   0.9   21    4-26      2-22  (30)
 47 smart00105 ArfGap Putative GTP  63.7     2.4 5.1E-05   29.2   0.1   30    2-31      3-35  (112)
 48 PRK00420 hypothetical protein;  48.1      12 0.00025   26.2   1.4   27    2-28     23-49  (112)
 49 PF15446 zf-PHD-like:  PHD/FYVE  47.8      17 0.00037   27.3   2.3   29    4-32      1-30  (175)
 50 KOG3277|consensus               43.0     9.9 0.00021   28.1   0.5   26    4-29     81-114 (165)
 51 COG1997 RPL43A Ribosomal prote  43.0      14 0.00029   24.8   1.1   27    3-29     36-63  (89)
 52 PF00628 PHD:  PHD-finger;  Int  42.4      11 0.00024   21.6   0.6   24    4-29      1-24  (51)
 53 PF03002 Somatostatin:  Somatos  39.8      13 0.00029   17.5   0.5   10   24-33      6-15  (18)
 54 PRK08359 transcription factor;  39.5     9.8 0.00021   28.6   0.0   30    2-31      6-42  (176)
 55 PF10080 DUF2318:  Predicted me  38.7      17 0.00038   24.8   1.1   25    5-29     38-62  (102)
 56 PF07649 C1_3:  C1-like domain;  37.7      16 0.00035   18.9   0.7   15    4-18      2-17  (30)
 57 PF10764 Gin:  Inhibitor of sig  36.3      18  0.0004   21.1   0.8   24    4-27      1-26  (46)
 58 COG5347 GTPase-activating prot  36.0      16 0.00034   30.0   0.7   30    2-31     20-52  (319)
 59 KOG0703|consensus               35.9      20 0.00043   29.1   1.2   31    2-32     25-58  (287)
 60 PRK06424 transcription factor;  35.7      13 0.00029   26.9   0.2   25    5-30      3-34  (144)
 61 PF09289 FOLN:  Follistatin/Ost  35.6      13 0.00029   18.4   0.1   19   40-58      4-22  (22)
 62 TIGR03655 anti_R_Lar restricti  35.2      31 0.00067   20.3   1.7   15    3-17      2-16  (53)
 63 PF08273 Prim_Zn_Ribbon:  Zinc-  34.9      24 0.00053   20.0   1.2   23    3-25      4-32  (40)
 64 PHA03124 dUTPase; Provisional   31.6      10 0.00022   32.0  -1.0   17   18-34    189-205 (418)
 65 smart00778 Prim_Zn_Ribbon Zinc  31.0      31 0.00066   19.2   1.1    9    3-11      4-12  (37)
 66 cd00729 rubredoxin_SM Rubredox  27.0      28  0.0006   18.8   0.5    7    5-11      5-11  (34)
 67 PF01286 XPA_N:  XPA protein N-  26.9      15 0.00033   20.1  -0.6   24    3-26      4-31  (34)
 68 PLN03114 ADP-ribosylation fact  26.4      31 0.00067   29.0   0.9   31    2-32     22-55  (395)
 69 TIGR00270 conserved hypothetic  26.3      24 0.00051   25.8   0.2   25    4-28      2-33  (154)
 70 PF01780 Ribosomal_L37ae:  Ribo  26.1      24 0.00052   23.7   0.2   25    4-28     37-62  (90)
 71 TIGR00009 L28 ribosomal protei  23.9      40 0.00086   20.4   0.8   12    1-12      1-12  (56)
 72 PF01753 zf-MYND:  MYND finger;  23.7      48   0.001   17.8   1.1   18    5-28      1-18  (37)
 73 PTZ00255 60S ribosomal protein  23.2      54  0.0012   22.0   1.4   24    4-27     38-62  (90)
 74 CHL00112 rpl28 ribosomal prote  23.1      43 0.00093   20.9   0.9   15    1-15      1-16  (63)
 75 PF04216 FdhE:  Protein involve  23.0      35 0.00076   27.2   0.6   13   15-27    207-219 (290)
 76 smart00401 ZnF_GATA zinc finge  22.6      37 0.00081   20.1   0.5   31    2-32      3-38  (52)
 77 PLN03119 putative ADP-ribosyla  22.5      44 0.00095   29.9   1.1   31    2-32     23-56  (648)
 78 smart00249 PHD PHD zinc finger  22.2      46 0.00099   17.8   0.8   24    4-29      1-24  (47)
 79 smart00154 ZnF_AN1 AN1-like Zi  21.8      52  0.0011   18.3   1.0   22    5-29      1-22  (39)
 80 PLN03131 hypothetical protein;  21.8      44 0.00095   30.1   1.0   31    2-32     23-56  (705)
 81 PLN02189 cellulose synthase     21.1      45 0.00097   31.7   0.9   22    3-26     35-60  (1040)
 82 PF03884 DUF329:  Domain of unk  20.8      15 0.00034   22.5  -1.4   26    1-26      1-29  (57)
 83 PF04438 zf-HIT:  HIT zinc fing  20.8      35 0.00077   17.9   0.1   19    2-26      2-20  (30)
 84 cd02249 ZZ Zinc finger, ZZ typ  20.6      69  0.0015   18.1   1.4   13    5-17      3-15  (46)
 85 COG4393 Predicted membrane pro  20.4      40 0.00087   28.2   0.4   23    5-27    337-359 (405)
 86 PF06147 DUF968:  Protein of un  20.2      50  0.0011   25.1   0.9   16    2-17    127-143 (200)

No 1  
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers. DNA-binding domain of REV-ERB receptor- like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. REV-ERB receptors are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. REV-ERB receptors bind as a monomer to a (A/G)GGTCA half-site with a 5' AT-rich extension or as a homodimer to a direct repeat 2 element (AGGTCA sequence with a 2-bp spacer), indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target genes. The porphyr
Probab=99.97  E-value=8.4e-32  Score=181.32  Aligned_cols=86  Identities=47%  Similarity=0.972  Sum_probs=78.5

Q ss_pred             CCCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCC
Q psy16683          1 MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGR   80 (139)
Q Consensus         1 ~~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R   80 (139)
                      |..+|.|||++++|+||||++|+||++||||++..+..+..|..+++|.++...+..|++|||+||+++||++++||++|
T Consensus         2 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~~~r   81 (89)
T cd07166           2 MVVLCKVCGDKASGFHYGVHACEGCKGFFRRSIQQKIQYRKCTKNETCSIMRINRNRCQYCRFKKCLAVGMSRDAVRFGR   81 (89)
T ss_pred             CCCCCcccCccCcceEEChhhhhhHhhEecceeEcCCcchhhccCCcccccccccccccchhhhhcccccCCHHHhcCCC
Confidence            57789999999999999999999999999999987655436998999999999999999999999999999999999999


Q ss_pred             CCchhh
Q psy16683         81 RSNWFK   86 (139)
Q Consensus        81 ~~~~~k   86 (139)
                      ++..+|
T Consensus        82 ~~~~~~   87 (89)
T cd07166          82 IPKREK   87 (89)
T ss_pred             CCCccc
Confidence            997543


No 2  
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. RARs mediate the biological effect of retinoids, including both natural dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RAR function as a heterodimer with retinoic X receptor by binding to specific RAR response elements (RAREs), which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair and found in the promoter reg
Probab=99.96  E-value=6e-31  Score=175.77  Aligned_cols=82  Identities=43%  Similarity=0.948  Sum_probs=75.6

Q ss_pred             CCCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCC
Q psy16683          1 MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGR   80 (139)
Q Consensus         1 ~~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R   80 (139)
                      +..+|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||++|
T Consensus         3 ~~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~R   81 (85)
T cd06964           3 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKN-MVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDR   81 (85)
T ss_pred             cCCCCcccCCcCcccEECcceeeeeeeEEeeeecCC-CCeECCCCCccccCCcccccCccchhhhhhhhCCCHHHhhccc
Confidence            356899999999999999999999999999999864 4568998999999999999999999999999999999999999


Q ss_pred             CCc
Q psy16683         81 RSN   83 (139)
Q Consensus        81 ~~~   83 (139)
                      +++
T Consensus        82 ~~~   84 (85)
T cd06964          82 NKK   84 (85)
T ss_pred             cCC
Confidence            974


No 3  
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=99.96  E-value=1.2e-30  Score=176.67  Aligned_cols=82  Identities=38%  Similarity=0.920  Sum_probs=75.0

Q ss_pred             CCCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccC--CccccccccCcccccccccccceeecccccCccc
Q psy16683          1 MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKN--NNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRY   78 (139)
Q Consensus         1 ~~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~--~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~   78 (139)
                      ++.+|.|||++++|+||||++|+||++||||++..+. .+.|..  ++.|.++...+..|++|||+||+++||++++||+
T Consensus         5 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~-~~~C~~~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~Vq~   83 (92)
T cd07163           5 LDIPCKVCGDRSSGKHYGIYACDGCSGFFKRSIRRNR-QYVCKSKGQGGCPVDKTHRNQCRACRLKKCFEVGMNKDAVQH   83 (92)
T ss_pred             cCCCCcccCCcCcccEECceeeeeeeeEEeeeecCCC-CcCCCCCCCCCCccCCCccccCccchhhhhhhhcCCHHHhhc
Confidence            3678999999999999999999999999999998654 468986  4699999999999999999999999999999999


Q ss_pred             CCCCc
Q psy16683         79 GRRSN   83 (139)
Q Consensus        79 ~R~~~   83 (139)
                      +|++.
T Consensus        84 ~r~p~   88 (92)
T cd07163          84 ERGPR   88 (92)
T ss_pred             ccCcC
Confidence            99985


No 4  
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or
Probab=99.96  E-value=2.5e-30  Score=173.48  Aligned_cols=81  Identities=42%  Similarity=0.929  Sum_probs=75.2

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      ..+|.|||++++|+||||++|+||++||||++..+ ..+.|..++.|.++...+..|++|||+||+++||++++||++||
T Consensus         3 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~Vq~~R~   81 (87)
T cd06967           3 VELCVVCGDKASGRHYGAVSCEGCKGFFKRSIRKN-LGYSCRGSKDCVINKHHRNRCQYCRLQKCLAMGMKSDSVQCERK   81 (87)
T ss_pred             CCCCeecCCcCCcCEeCcceEeeeeeEeeeeeeCC-CCcccCCCCccccCccccccCccchhhhhhHcCCCHHHhccccC
Confidence            35799999999999999999999999999999864 45689999999999999999999999999999999999999999


Q ss_pred             Cc
Q psy16683         82 SN   83 (139)
Q Consensus        82 ~~   83 (139)
                      +.
T Consensus        82 ~~   83 (87)
T cd06967          82 PI   83 (87)
T ss_pred             CC
Confidence            84


No 5  
>cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members 
Probab=99.96  E-value=3.2e-30  Score=171.25  Aligned_cols=78  Identities=40%  Similarity=0.929  Sum_probs=72.5

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCccccc-CCccccccccCcccccccccccceeecccccCcccCCCCc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECK-NNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRSN   83 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~-~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~~   83 (139)
                      |.|||++++|+||||++|+||++||||++..+ ..+.|. .++.|.++...+..|++|||+||+++||++++||++|++.
T Consensus         1 C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~-~~~~C~~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r~p~   79 (82)
T cd06957           1 CKVCGDKSYGKHYGVYCCDGCSCFFKRSVRKG-IIYTCIAGNGNCVVDKARRNWCPFCRLQKCFAVGMNRAAVQEERGPR   79 (82)
T ss_pred             CCccCccCcceEECcceEeeeeeEEEEeecCC-CceEccCccCCCccCCCccCcccCcchhhcccccCCHHHhccccCcC
Confidence            89999999999999999999999999999864 457898 5689999999999999999999999999999999999985


No 6  
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=99.96  E-value=2.7e-30  Score=172.25  Aligned_cols=81  Identities=46%  Similarity=0.972  Sum_probs=72.7

Q ss_pred             cCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCCc
Q psy16683          4 TCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRSN   83 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~~   83 (139)
                      +|.|||++++|+||||++|+||++||||++..+..+..|..  .|.++...+..|++|||+||+++||++++||++|++.
T Consensus         1 ~C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~~C~~--~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~~~r~~~   78 (84)
T cd06965           1 ECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLVYKPCDL--SCKIHKKSRNKCQYCRFQKCLNVGMSHNAIRFGRMPR   78 (84)
T ss_pred             CCcccCccCcceEEChhhhhhhhhheeeeeecCCCcccccc--CCCcCccccccccchhhhhhhhccCCHHHcccCCCCc
Confidence            59999999999999999999999999999987554335865  3999999999999999999999999999999999997


Q ss_pred             hhh
Q psy16683         84 WFK   86 (139)
Q Consensus        84 ~~k   86 (139)
                      .+|
T Consensus        79 ~~~   81 (84)
T cd06965          79 VEK   81 (84)
T ss_pred             hhh
Confidence            554


No 7  
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TR interacts with the thyroid response element, which is a DNA site with direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pairs, upstream of target genes and modulates the rate of transcriptional initiation. Thyroid hormone receptor (TR) mediates the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the he
Probab=99.96  E-value=1.7e-30  Score=173.65  Aligned_cols=79  Identities=41%  Similarity=0.920  Sum_probs=74.3

Q ss_pred             cCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCCc
Q psy16683          4 TCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRSN   83 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~~   83 (139)
                      +|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||++|++.
T Consensus         1 ~C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r~~~   79 (85)
T cd06961           1 PCVVCGDKATGYHYRCITCEGCKGFFRRTVQKK-LSYSCKGEGKCEIDKVTRNQCQECRFKKCIAVGMAKDLVLDDRKRG   79 (85)
T ss_pred             CCceeCCcCcceEEChhhhhhhhHhhHhhhccC-CccccCCCCccccCccccccCccchhhhhhhccCCHHHcccccCcc
Confidence            699999999999999999999999999999865 4568999999999999999999999999999999999999999985


No 8  
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hing
Probab=99.96  E-value=3.1e-30  Score=174.55  Aligned_cols=80  Identities=38%  Similarity=0.930  Sum_probs=74.1

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCC-ccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNN-NECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~-~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      .+|.|||++++|+||||.+|+||++||||++..+ ..+.|..+ ++|.++...+..|++|||+||+++||++++||.+||
T Consensus         7 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~-~~~~C~~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~~R~   85 (92)
T cd06970           7 LLCRVCGDTSSGKHYGIYACNGCSGFFKRSVRRK-LIYRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQ   85 (92)
T ss_pred             CCCeecCCcCcccEECccEEeeeeeEeeeeeecC-CCceeecCCCcCccCCCccccCccchhhHhhHhCCCHHHcccccC
Confidence            4699999999999999999999999999999864 45689875 899999989999999999999999999999999999


Q ss_pred             Cc
Q psy16683         82 SN   83 (139)
Q Consensus        82 ~~   83 (139)
                      +.
T Consensus        86 ~~   87 (92)
T cd06970          86 PR   87 (92)
T ss_pred             cc
Confidence            85


No 9  
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=99.96  E-value=3.8e-30  Score=173.58  Aligned_cols=81  Identities=38%  Similarity=0.877  Sum_probs=75.4

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      ..+|.|||++++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||++++||++|+
T Consensus         6 ~~~C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~-~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~~R~   84 (90)
T cd07168           6 PKLCSICEDKATGLHYGIITCEGCKGFFKRTVQNKR-VYTCVGDGRCEITKAQRNRCQYCRFRKCIRKGMMLAAVREDRM   84 (90)
T ss_pred             CCCCcccCCcCcceEECceehhhhhHhhhhhhcCCC-CccCCCCCCccccccccccccccchhhhhhcCCCHHHhhcccC
Confidence            467999999999999999999999999999998644 5689999999999999999999999999999999999999999


Q ss_pred             Cc
Q psy16683         82 SN   83 (139)
Q Consensus        82 ~~   83 (139)
                      +.
T Consensus        85 ~~   86 (90)
T cd07168          85 PG   86 (90)
T ss_pred             CC
Confidence            84


No 10 
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=99.96  E-value=3.8e-30  Score=175.60  Aligned_cols=80  Identities=45%  Similarity=0.945  Sum_probs=74.3

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCC
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRS   82 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~   82 (139)
                      .+|.|||++++|+||||++|+||++||||++..+ ..+.|..++.|.++...+..|++|||+||+++||++++||++|+.
T Consensus         5 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~vq~~r~~   83 (97)
T cd07170           5 RLCLVCGDIASGYHYGVASCEACKAFFKRTIQGN-IEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVR   83 (97)
T ss_pred             CCCeecCCcCcceEECceeehhhhHHHHHHhccC-CceeecCCCccccCcccCccCCccccchhhhcCCCHHHcccccCC
Confidence            5699999999999999999999999999999865 456899999999999999999999999999999999999999987


Q ss_pred             c
Q psy16683         83 N   83 (139)
Q Consensus        83 ~   83 (139)
                      .
T Consensus        84 ~   84 (97)
T cd07170          84 G   84 (97)
T ss_pred             C
Confidence            4


No 11 
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=99.96  E-value=1.8e-30  Score=170.56  Aligned_cols=76  Identities=39%  Similarity=1.017  Sum_probs=71.4

Q ss_pred             cCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCC
Q psy16683          4 TCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGR   80 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R   80 (139)
                      +|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||++|
T Consensus         2 ~C~VC~~~~~g~hygv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r   77 (77)
T cd06956           2 ICAICGDRASGKHYGVYSCEGCKGFFKRTVRKD-LTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEER   77 (77)
T ss_pred             CCcccCCcCcceEECceeehhHHHHHHHHhhCC-CccccCCCCccccCCCccccCccchhHHHhHhCCCHHHhccCC
Confidence            699999999999999999999999999999864 4568998999999999999999999999999999999999987


No 12 
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is
Probab=99.96  E-value=5.2e-30  Score=167.95  Aligned_cols=76  Identities=39%  Similarity=0.966  Sum_probs=71.6

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      |.|||++++|+||||++|+||++||||++..+. .+.|..++.|.++...+..|++|||+||+++||++++||.+||
T Consensus         1 C~vCg~~~~~~hygv~~C~aC~~FFrR~~~~~~-~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~~~r~   76 (76)
T cd06960           1 CAVCGDRATGKHYGVLSCNGCKGFFRRSVRKNR-TYTCRFGGNCVVDKDKRNACRYCRFKKCLEVGMDPEAVQNERD   76 (76)
T ss_pred             CCccCccCcccEECcceeeeehheeCccccCCC-ceeCCCCCcccccCcccccCccchhhhhhhcCCCHHHcccCCC
Confidence            899999999999999999999999999998655 5689988999999999999999999999999999999999997


No 13 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=99.96  E-value=9.7e-30  Score=170.29  Aligned_cols=81  Identities=68%  Similarity=1.296  Sum_probs=74.3

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCC-CcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLP-SISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~-~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      .+|.|||++++|+||||++|+||++||||++..+. ..+.|..+++|.++...+..|++|||+||+++||++++++++|+
T Consensus         1 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~~~~~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~~~~~~~   80 (86)
T cd07157           1 QTCQVCGEPAAGFHHGAYVCEACKKFFMRSSNAISFTISECPNGGKCIIDKKNRTKCQACRYRKCLNVGMSLGGPRYGRR   80 (86)
T ss_pred             CCCcccCCcCcccEECcceeeEeeeEEecceecCCCccccCCCCCccccCccccccCccchhhHHhHcCCCccccccccc
Confidence            37999999999999999999999999999987543 36789999999999989999999999999999999999999999


Q ss_pred             Cc
Q psy16683         82 SN   83 (139)
Q Consensus        82 ~~   83 (139)
                      ..
T Consensus        81 ~~   82 (86)
T cd07157          81 SD   82 (86)
T ss_pred             cc
Confidence            74


No 14 
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-t
Probab=99.96  E-value=4.5e-30  Score=169.05  Aligned_cols=77  Identities=38%  Similarity=0.935  Sum_probs=72.7

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCC
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRS   82 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~   82 (139)
                      |.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||++||+
T Consensus         1 C~VCg~~~~g~hyG~~~C~~C~~FFRR~~~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r~~   77 (78)
T cd07164           1 CRVCGDRASGKHYGVPSCDGCRGFFKRSIRRN-LAYVCKENGSCVVDVARRNQCQACRFKKCLQVNMNRDAVQHERAP   77 (78)
T ss_pred             CcccCccCcceEECcchhhhhhhhhhhhccCC-CCccCCCCCcccccCcccccCccchhhhhhHhcCCHHHhccCCCC
Confidence            88999999999999999999999999999865 456899999999999999999999999999999999999999997


No 15 
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=99.96  E-value=2.7e-30  Score=171.50  Aligned_cols=79  Identities=48%  Similarity=1.018  Sum_probs=73.5

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      +.+|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||++|.
T Consensus         3 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~~~   81 (82)
T cd07171           3 THFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH-NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRRERR   81 (82)
T ss_pred             CCCCeecCCcCcceEECceeehhhHHhHHHHeeCC-CceeCCCCCccccCCcccccCccchhHHHhHhcCCHHHHHHhhc
Confidence            46899999999999999999999999999999874 45689999999999999999999999999999999999999875


No 16 
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=99.96  E-value=3.2e-30  Score=168.61  Aligned_cols=75  Identities=48%  Similarity=1.026  Sum_probs=70.6

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCC
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGR   80 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R   80 (139)
                      |.|||++++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||++++||++|
T Consensus         1 C~VC~~~~~g~hygv~sC~aCk~FFRR~~~~~~-~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r   75 (75)
T cd07155           1 CLVCGDIASGYHYGVASCEACKAFFKRTIQGNL-GYSCPSTSECEVDKKRRKSCQACRLQKCLKVGMLKEGVRLDR   75 (75)
T ss_pred             CcccCccCcceEEChhhhhhhHHHHHHHhhCCC-ceeCCcCCCcccCCcccccCccchhhhhhHhCCCHHHcccCC
Confidence            899999999999999999999999999998654 568999999999999999999999999999999999999987


No 17 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=99.95  E-value=4.8e-30  Score=170.03  Aligned_cols=78  Identities=49%  Similarity=1.047  Sum_probs=73.4

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCCc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRSN   83 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~~   83 (139)
                      |.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||++|++.
T Consensus         1 C~VCg~~~~g~hyG~~sC~aC~~FFRR~~~~~-~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~V~~~r~~~   78 (81)
T cd07165           1 CKVCGDKASGYHYGVTSCEGCKGFFRRSIQKQ-IEYRCLRDGKCEIIRLNRNRCQYCRFKKCLAAGMSKDSVRYGRIPN   78 (81)
T ss_pred             CCccCccCcceEECchhhhhHHHHHHhHhccC-CceeCCCCCCccccccccccccchhhhhcccccCCHHHcccCCCCc
Confidence            89999999999999999999999999999864 4568999999999999999999999999999999999999999985


No 18 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=99.95  E-value=1.2e-29  Score=172.65  Aligned_cols=84  Identities=43%  Similarity=0.991  Sum_probs=77.4

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      +.+|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||++|.
T Consensus         5 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~V~~~r~   83 (95)
T cd06968           5 VIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNN-VSYSCPRQKNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRM   83 (95)
T ss_pred             ccCCcccCCcCcceEECceeehhhHHhhHHheeCC-CceecCCCcccccccCCceeccccchhhcccccCChhhcccCcC
Confidence            46899999999999999999999999999999864 45689999999999999999999999999999999999999999


Q ss_pred             Cchhh
Q psy16683         82 SNWFK   86 (139)
Q Consensus        82 ~~~~k   86 (139)
                      ++..|
T Consensus        84 ~~~~~   88 (95)
T cd06968          84 SKKQR   88 (95)
T ss_pred             Chhhh
Confidence            97554


No 19 
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=99.95  E-value=7.2e-30  Score=175.37  Aligned_cols=81  Identities=40%  Similarity=0.841  Sum_probs=74.9

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      +.+|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||.+|+
T Consensus        18 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~~~~   96 (101)
T cd07160          18 NEVCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKG-AQYVCKNGGKCQMDMYMRRKCQECRLRKCREAGMREQCVLSEEQ   96 (101)
T ss_pred             CCCCeecCCcCcceEECcceehhhhhhhhhccccc-CccccCCCCccccCCcccccCccchhHHHHHhCCCHHHhcChhh
Confidence            35799999999999999999999999999999864 45789999999999999999999999999999999999999998


Q ss_pred             Cc
Q psy16683         82 SN   83 (139)
Q Consensus        82 ~~   83 (139)
                      ..
T Consensus        97 ~~   98 (101)
T cd07160          97 IR   98 (101)
T ss_pred             hh
Confidence            74


No 20 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=99.95  E-value=1.1e-29  Score=171.26  Aligned_cols=81  Identities=40%  Similarity=0.954  Sum_probs=74.8

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      ..+|.|||++++|+||||++|+||++||||++..+. .+.|..++.|.++...+..|++|||+||+++||++++||.+|+
T Consensus         6 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~-~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r~   84 (90)
T cd07169           6 QRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKR-VYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGM   84 (90)
T ss_pred             CCCCeecCCcCcceEECcceehhhHHHHHHHhcCCC-ceecCCCCcccccccccccccccchhhhccccCCHHHhccccC
Confidence            467999999999999999999999999999998644 4689988999999999999999999999999999999999998


Q ss_pred             Cc
Q psy16683         82 SN   83 (139)
Q Consensus        82 ~~   83 (139)
                      +.
T Consensus        85 ~~   86 (90)
T cd07169          85 PG   86 (90)
T ss_pred             CC
Confidence            74


No 21 
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers. DNA-binding domain of Ecdysone receptor (EcR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with highly degenerate pseudo-palindromic response elements, resembling inverted repeats of 5'-AGGTCA-3' separated by 1 bp, upstream of the target gene and modulates the rate of transcriptional initiation. EcR is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. EcR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of EcR are ecdysteroids, the endogenous steroidal hormones found in invertebrates. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcRs h
Probab=99.95  E-value=7.7e-30  Score=172.36  Aligned_cols=80  Identities=40%  Similarity=0.874  Sum_probs=74.6

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCC
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRS   82 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~   82 (139)
                      .+|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||.+++.
T Consensus         2 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~~~~~~   80 (91)
T cd07161           2 ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKS-AVYHCKYGRACEMDMYMRRKCQECRLKKCLSVGMRPECVVPESQC   80 (91)
T ss_pred             CCCeeCCCcCcceEECceeehhhHHHHHHHhccC-CceecCCCCccccCccccccCccchhhHHhHcCCCHHHcCchhhh
Confidence            5799999999999999999999999999999864 456899889999999999999999999999999999999999987


Q ss_pred             c
Q psy16683         83 N   83 (139)
Q Consensus        83 ~   83 (139)
                      .
T Consensus        81 ~   81 (91)
T cd07161          81 A   81 (91)
T ss_pred             h
Confidence            5


No 22 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=99.95  E-value=1.7e-29  Score=171.66  Aligned_cols=80  Identities=39%  Similarity=0.772  Sum_probs=74.3

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCC
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRS   82 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~   82 (139)
                      .+|.|||++++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||++++||++||.
T Consensus         1 ~~C~VCg~~a~g~hyGv~sC~aC~~FFRR~v~~~~-~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~~r~~   79 (94)
T cd06966           1 KICGVCGDKALGYNFNAITCESCKAFFRRNALKNK-EFKCPFNESCEINVVTRRFCQKCRLDKCFAIGMKKEWIMSEEDK   79 (94)
T ss_pred             CCCeeCCCcCcceEECcceeeeehheehhcccCCC-ccccCCCCccccCccccccCccchhhhCcccCCCHHHccchhhh
Confidence            36999999999999999999999999999998644 56899999999999999999999999999999999999999997


Q ss_pred             c
Q psy16683         83 N   83 (139)
Q Consensus        83 ~   83 (139)
                      .
T Consensus        80 ~   80 (94)
T cd06966          80 S   80 (94)
T ss_pred             h
Confidence            5


No 23 
>KOG4215|consensus
Probab=99.95  E-value=3.5e-30  Score=207.67  Aligned_cols=82  Identities=35%  Similarity=0.884  Sum_probs=77.5

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      +..|.||||+|.|.||||.+|.|||+||||+|++ +..|+|+.+.+|.++++.|+.|++|||+||+.+||++++||+.||
T Consensus        19 ~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk-~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnERD   97 (432)
T KOG4215|consen   19 AEFCAICGDKATGKHYGAISCDGCKGFFRRSVRK-NHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNERD   97 (432)
T ss_pred             cchhheeCCcccccccceeecCcchHHHHHHHHh-cceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhcccc
Confidence            4579999999999999999999999999999996 566899999999999999999999999999999999999999999


Q ss_pred             Cch
Q psy16683         82 SNW   84 (139)
Q Consensus        82 ~~~   84 (139)
                      .+.
T Consensus        98 rIg  100 (432)
T KOG4215|consen   98 RIG  100 (432)
T ss_pred             ccc
Confidence            863


No 24 
>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B. DNA-binding domain (DBD) of the orphan nuclear receptor, nerve growth factor-induced-B (NGFI-B) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NGFI-B interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. NGFI-B is a member of the nuclear-steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcrip
Probab=99.95  E-value=2.6e-29  Score=164.30  Aligned_cols=75  Identities=44%  Similarity=0.895  Sum_probs=69.2

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCccc
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRY   78 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~   78 (139)
                      .+|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||.
T Consensus         1 ~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~   75 (75)
T cd06969           1 GLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKN-AKYVCLANKNCPVDKRRRNRCQYCRFQKCLQVGMVKEVVRT   75 (75)
T ss_pred             CCCeecCCcCcceEECcceeeeeeeeeeeeeecC-CcccCCcCCccccCCcccccCcccHhHHHHHhCCCHHHccC
Confidence            4799999999999999999999999999999864 45689989999999999999999999999999999998873


No 25 
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. FXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  FXR is a member of the nuclear receptor family of ligand activated transcription factors. Bile acids are endogenous ligands for FXRs. Upon binding of a ligand, FXR binds to FXR response element (FXRE), which is an inverted repeat of TGACCT spaced by one nucleotide, either as a monomer or as a heterodimer with retinoid X receptor (RXR), to regulate the expression of various genes involved in bile acid, lipid, and glucose metabolism. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, FXR has a central well conserved 
Probab=99.95  E-value=2e-29  Score=168.01  Aligned_cols=79  Identities=41%  Similarity=0.873  Sum_probs=72.8

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCC
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRS   82 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~   82 (139)
                      .+|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++|+.++..
T Consensus         2 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~~~~~~   80 (84)
T cd06962           2 ELCVVCGDKASGYHYNALTCEGCKGFFRRSITKN-AVYKCKNGGNCEMDMYMRRKCQECRLRKCKEMGMLAECLLTEIQC   80 (84)
T ss_pred             CCCeecCCcCcceEECcceeecceeeeeeeeccC-CceecCCCCcCccCccccccCccchhhHHHHhCCChHHccCHHHH
Confidence            5799999999999999999999999999999854 567899899999999999999999999999999999999887664


No 26 
>KOG4216|consensus
Probab=99.95  E-value=2.3e-29  Score=204.20  Aligned_cols=84  Identities=42%  Similarity=0.986  Sum_probs=78.1

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCC
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRS   82 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~   82 (139)
                      .||+||||+++|.||||++|+|||+||||+-.+ ...|.|.+..+|.|++.+|+.|++|||+||+++||+.++|.|||++
T Consensus        47 IPCKiCGDKSSGiHYGVITCEGCKGFFRRSQ~s-~a~YsCpRqknC~iDRtnRNRCQ~CRLqKClaLGMSRDAVKFGRMS  125 (479)
T KOG4216|consen   47 IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQS-NANYSCPRQKNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMS  125 (479)
T ss_pred             EeeeeccCCCCcceeeeEeeccchHhhhhhhhc-cccccCCcccCCcccccccchhhHHHHHHHHHhccchhhHHhcccc
Confidence            479999999999999999999999999999886 4557999999999999999999999999999999999999999999


Q ss_pred             chhhh
Q psy16683         83 NWFKI   87 (139)
Q Consensus        83 ~~~k~   87 (139)
                      ++.+.
T Consensus       126 KKQRd  130 (479)
T KOG4216|consen  126 KKQRD  130 (479)
T ss_pred             HhhHH
Confidence            86543


No 27 
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers. The second DNA-binding domain (DBD) of the 2DBD nuclear receptor (NR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. The proteins contain two DBDs in tandem, probably resulting from an ancient recombination event.  The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=99.95  E-value=2e-29  Score=164.46  Aligned_cols=74  Identities=54%  Similarity=1.131  Sum_probs=69.1

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccC
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYG   79 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~   79 (139)
                      |.|||++++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||++++|+++
T Consensus         1 C~VCg~~~~g~hygv~sC~aC~~FFRR~~~~~~-~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~~~   74 (74)
T cd07179           1 CRVCGGKSSGFHFGALTCEGCKGFFRRTELSSN-SYVCPGGQNCAITPATRNACKSCRFRRCLAVGMSKTGSRIG   74 (74)
T ss_pred             CcccCccCcceEECceeehhHHHHHHHHhhCCC-cccCCCCCccccCCcccccCccchhHHHHHhCCCHhHeeCc
Confidence            899999999999999999999999999998644 56899889999999999999999999999999999999875


No 28 
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This nuclear receptor family includes at least three subgroups of receptors that function in embryo development and differentiation, and other processes. FTZ-F1 interacts with the cis-acting DNA motif of ftz gene, which is required at several stages of development. Particularly, FTZ-F1 regulated genes are strongly linked to steroid biosynthesis and sex-determination; LRH-1 is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development; SF-1 is an essential regu
Probab=99.95  E-value=2.8e-29  Score=170.16  Aligned_cols=78  Identities=42%  Similarity=0.932  Sum_probs=72.7

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCCc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRSN   83 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~~   83 (139)
                      |.|||++++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||++++||++|+..
T Consensus         1 C~VCg~~a~g~hyGv~sC~aCk~FFRRsv~~~~-~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~Vq~~r~~~   78 (93)
T cd07167           1 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKK-RYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRG   78 (93)
T ss_pred             CcccCccCcceEECchhhhhHHHHHHHHeeCCC-ccccCCCCccccCccccCcCCCcccchhhhccCCHHHhhhcccCC
Confidence            899999999999999999999999999998654 468999999999999999999999999999999999999999753


No 29 
>cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear
Probab=99.95  E-value=9.3e-29  Score=160.87  Aligned_cols=72  Identities=43%  Similarity=1.065  Sum_probs=66.6

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCccccc-CCccccccccCcccccccccccceeecccccCcc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECK-NNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSR   77 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~-~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq   77 (139)
                      |.|||++++|+||||++|+||++||||++..+. .+.|. .+++|.++...+..|++|||+||+++||++++||
T Consensus         1 C~vCg~~~~~~hyGv~sC~aC~~FFRR~v~~~~-~~~C~~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~vq   73 (73)
T cd07154           1 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNL-LYTCKAGNGSCVVDKARRNQCQACRLKKCLEVSMNKDAVQ   73 (73)
T ss_pred             CcccCccCcceEECcceeeeeeeEeeeeecCCC-CcccCCCCCCCccCCcccccCccchhhHhhHhCCChHHCC
Confidence            899999999999999999999999999998754 46898 6789999999999999999999999999999886


No 30 
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with a specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. Nuclear receptors form a superfamily of ligand-activated transcription regulators, which regulate various physiological functions, from development, reproduction, to homeostasis and metabolism in animals (metazoans). The family contains not only receptors for known ligands but also orphan receptors for which ligands do not exist or have not been identified. NRs share a common structural organization with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).  Most nuclear receptors bind as homodimers or hetero
Probab=99.95  E-value=1.1e-28  Score=160.13  Aligned_cols=72  Identities=50%  Similarity=1.123  Sum_probs=67.2

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSR   77 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq   77 (139)
                      |.|||++++|+||||++|+||++||||++..+. .+.|..++.|.++...+..|++|||+||+++||++++||
T Consensus         1 C~vC~~~~~~~hygv~sC~aC~~FFRR~~~~~~-~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~   72 (72)
T cd06916           1 CAVCGDKASGYHYGVLTCEGCKGFFRRSVRRNL-EYTCPAGGNCVIDKRNRNRCQACRLKKCLAVGMRKEAVR   72 (72)
T ss_pred             CCccCccCcccEECcceeeeeeeeEeEeecCCC-CccCCCCCccccCCcccccCccchhhHhhHhCCChHHcC
Confidence            899999999999999999999999999998654 468999999999999999999999999999999998876


No 31 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=99.95  E-value=7.3e-29  Score=161.36  Aligned_cols=73  Identities=49%  Similarity=1.141  Sum_probs=67.4

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSR   77 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq   77 (139)
                      |.|||++++|+||||++|+||++||||++..+..+..|..+++|.++...+..|++|||+||+++||++++||
T Consensus         1 C~VCg~~~~g~hyGv~~C~aC~~FFRR~v~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~   73 (73)
T cd07158           1 CKVCGDKASGFHYGVHSCEGCKGFFRRTIQHNLTYRRCLNGGKCVIQRKNRNRCQYCRFKKCLSVGMSRNAVR   73 (73)
T ss_pred             CcccCccCcceEECcchhhHHHHHHhhhhcCCCCcccCCCCCCcCCCccccccCccchhhhhhHccCChHHcC
Confidence            8899999999999999999999999999987555448999999999999999999999999999999998875


No 32 
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=99.95  E-value=1.3e-28  Score=170.63  Aligned_cols=79  Identities=44%  Similarity=0.935  Sum_probs=71.6

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      +.+|.|||+.++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||++++|+.+.+
T Consensus         6 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~-~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~~~~~   84 (107)
T cd06955           6 PRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKA-LFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEE   84 (107)
T ss_pred             CCCCeecCCcCcccEECcceeeeecceecceeccCC-ccccCCCCccccccCCccccccchhHHHHHcCCCchhccCHHH
Confidence            467999999999999999999999999999998654 4689989999999999999999999999999999988877643


No 33 
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. COUP-TFs homodimerize or heterodimerize with retinoid X receptor (RXR) and a few other nuclear receptors and bind to a variety of response elements that are composed of imperfect AGGTCA direct or inverted repeats with various spacings. COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone recept
Probab=99.94  E-value=9.1e-29  Score=160.92  Aligned_cols=72  Identities=47%  Similarity=1.057  Sum_probs=67.5

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSR   77 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq   77 (139)
                      |.|||++++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||++++||
T Consensus         1 C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~-~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~   72 (73)
T cd06958           1 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNL-TYTCRGNRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQ   72 (73)
T ss_pred             CCccCccCcceEEChhhhhhhhhhhhhhhcCCC-ceeCCCCCcCccCCcccccCccchhhHhhHhCCCHHHcc
Confidence            899999999999999999999999999998754 468999999999999999999999999999999999887


No 34 
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=99.94  E-value=1.2e-28  Score=159.99  Aligned_cols=71  Identities=51%  Similarity=1.052  Sum_probs=66.2

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGS   76 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~v   76 (139)
                      |.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++|
T Consensus         1 C~VC~~~~~g~hygv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v   71 (72)
T cd07156           1 CGVCGDRATGYHFNAMTCEGCKGFFRRSMKRK-ARFTCPFNGDCEITKDNRRHCQACRLKKCLDIGMKKEMI   71 (72)
T ss_pred             CCccCccCcccEECcceehhhhhhhchhccCc-CccccCCCCccccCCcccccCccchhHHHHHhCCCHHHc
Confidence            89999999999999999999999999999864 456899899999999999999999999999999999876


No 35 
>KOG4846|consensus
Probab=99.94  E-value=2.2e-29  Score=205.66  Aligned_cols=83  Identities=43%  Similarity=0.942  Sum_probs=78.4

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCC
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRS   82 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~   82 (139)
                      ..|+||||.|+|+||||.+|+|||+||||+|+.+-.|..|.+...|.|.+..|+.|+.|||+||+++||+.++|+||+++
T Consensus       133 ~lCkVCgDkASGfHYGV~aCEGCKGFFRRSIQqkI~YrrClk~e~C~I~R~nRNRCQ~CRfKKCL~vGMSrDaVRFG~m~  212 (538)
T KOG4846|consen  133 SLCKVCGDKASGFHYGVTACEGCKGFFRRSIQQKIDYRRCLKQEVCEIKRENRNRCQYCRFKKCLDVGMSRDAVRFGQMK  212 (538)
T ss_pred             EeehhhccccccceeceeecccchHHHHHHHHHhhhHHHHhhhhceehhhhccchhhhhhHHHHHhcccchhhhhhcccc
Confidence            46999999999999999999999999999999877777899999999999999999999999999999999999999998


Q ss_pred             chh
Q psy16683         83 NWF   85 (139)
Q Consensus        83 ~~~   85 (139)
                      .+.
T Consensus       213 ~rn  215 (538)
T KOG4846|consen  213 FRN  215 (538)
T ss_pred             ccc
Confidence            755


No 36 
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: Ecdysone receptor (EcR), Liver X receptor (LXR) and Farnesoid X receptor (FXR). The DNA binding activity is regulated by their corresponding ligands. The ligands for EcR are ecdysteroids; LXR is regulated by oxidized cholesterol derivatives or oxysterols; and bile acids control FXR's activities. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcR-like receptors have  a central well conserved DNA binding domai
Probab=99.94  E-value=1.9e-28  Score=159.42  Aligned_cols=73  Identities=44%  Similarity=0.962  Sum_probs=67.2

Q ss_pred             cCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcc
Q psy16683          4 TCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSR   77 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq   77 (139)
                      .|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||+++.|+
T Consensus         1 ~C~vCg~~~~~~hygv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~   73 (73)
T cd06959           1 NCVVCGDKASGFHYGVLSCEGCKGFFRRSVTKG-AVYACKFGNKCEMDMYMRRKCQECRLRKCKAAGMRPDCLL   73 (73)
T ss_pred             CCceeCCcCcceEECceeehhhHHHHHHhhcCC-CCccCCCCCcCCcCCcccccCccchhHHHHHhCCChhhcC
Confidence            599999999999999999999999999999864 4568998999999999999999999999999999988763


No 37 
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=99.94  E-value=3.7e-28  Score=159.90  Aligned_cols=74  Identities=42%  Similarity=0.935  Sum_probs=68.0

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcc
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSR   77 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq   77 (139)
                      .+|.|||++++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||+..++.
T Consensus         3 ~~C~VCg~~a~g~hyGv~sC~aC~~FFRR~v~~~~-~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~~~   76 (78)
T cd07172           3 KICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQH-NYLCAGRNDCIIDKIRRKNCPACRLRKCLQAGMNLGARK   76 (78)
T ss_pred             CCCeecCCcCcceEECceeehhhHHhHHHHeeCCC-ceeCCCCCccccCCcccccCccchhHHHHHhCCCccccc
Confidence            57999999999999999999999999999998754 468998999999999999999999999999999987654


No 38 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=99.94  E-value=1.7e-28  Score=164.63  Aligned_cols=78  Identities=45%  Similarity=0.943  Sum_probs=71.7

Q ss_pred             cCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCCC
Q psy16683          4 TCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRRS   82 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~~   82 (139)
                      +|.|||++++|+||||++|+||++||||++..+ ..+.|..+++|.++...+..|++|||+||+++||++++||.+++.
T Consensus         1 ~C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~-~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~~~~~   78 (87)
T cd07162           1 ICRVCGDRATGYHFNAMTCEGCKGFFRRAMKRN-ARLCCPFQKGCVITKSNRRQCQACRLRKCLSIGMKKELIMSDEAV   78 (87)
T ss_pred             CCcccCCcCcceEECcceehhhHHHHHhhhccC-ceeEcCCCCceecCCcccccCccchhhHHhHhCCCHHHccCHHHH
Confidence            599999999999999999999999999999864 456899889999999999999999999999999999999988554


No 39 
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=99.94  E-value=3.2e-28  Score=161.54  Aligned_cols=74  Identities=43%  Similarity=0.947  Sum_probs=67.0

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCc
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGS   76 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~v   76 (139)
                      ..+|.|||++++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||+++..
T Consensus         3 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~-~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~~   76 (82)
T cd07173           3 QKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQ-KYLCASRNDCTIDKFRRKNCPSCRLRKCFEAGMTLGAR   76 (82)
T ss_pred             CCCCeecCCcCcceEECcchhhhHHHHHHHHhcCCC-ceecCCCCccccCCCccCcCcchhhhhhhhcCCCcChH
Confidence            356999999999999999999999999999998654 46899999999999999999999999999999987643


No 40 
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and sha
Probab=99.94  E-value=3.8e-28  Score=158.01  Aligned_cols=72  Identities=42%  Similarity=0.964  Sum_probs=66.4

Q ss_pred             CcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSR   77 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq   77 (139)
                      |.|||++++|+||||++|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||+++++.
T Consensus         1 C~VCg~~a~~~hygv~sC~aCk~FFRR~~~~~~-~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~a~~   72 (73)
T cd06963           1 CLICGDEASGCHYGVLTCGSCKVFFKRAAEGQH-NYLCAGRNDCIIDKIRRKNCPACRLRKCYQAGMTLGARK   72 (73)
T ss_pred             CcccCccCcceEECceeehhhhHhHHHhhcCCC-ceeCCCCCccccCCcccccCccchhhHHHHcCCChhhcc
Confidence            899999999999999999999999999998754 468999999999999999999999999999999988753


No 41 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=99.93  E-value=4.3e-27  Score=151.81  Aligned_cols=70  Identities=49%  Similarity=1.036  Sum_probs=64.6

Q ss_pred             cCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeeccccc
Q psy16683          4 TCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKS   74 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~   74 (139)
                      +|.|||++++|+||||.+|+||++||||++..+. .+.|..+++|.++...+..|++|||+||+++||+++
T Consensus         1 ~C~vC~~~~~~~hygv~~C~aC~~FFRR~v~~~~-~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~   70 (70)
T smart00399        1 LCCVCGDHASGFHFGVCSCRACKAFFRRTVNLRY-KYRCDRKNNCSINKRYRCRCRACRLKKCLGVGMDPE   70 (70)
T ss_pred             CCeEeCCcCcccEeCCcEechhhhhhhhheeCCC-CeecCCCcccccCCCccccCccCcChhHhhccCcCC
Confidence            5999999999999999999999999999998654 468998899999999999999999999999999863


No 42 
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=99.91  E-value=2.4e-26  Score=148.12  Aligned_cols=69  Identities=51%  Similarity=1.165  Sum_probs=59.8

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeeccc
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMS   72 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~   72 (139)
                      ..|.|||++++|+||||.+|++|++||||++... ..+.|..+++|.++...+..|++|||+||+++||+
T Consensus         1 ~~C~VCg~~~~~~~ygv~sC~~C~~FFrR~~~~~-~~~~C~~~~~C~i~~~~~~~C~~CRf~KCl~~GM~   69 (70)
T PF00105_consen    1 KKCKVCGDPASGYHYGVLSCNACKMFFRRSVKKK-KPYKCKKNGNCKIDKDNRRKCRSCRFQKCLEVGMK   69 (70)
T ss_dssp             -BSTTTSSBESEEETTEEEEHHHHHHHHHHHHTT-CG-STSSSST---STTTTTTSHHHHHHHHHHTTBS
T ss_pred             CCCeECCCccCcccccccccccceeeeeeccccc-ccccccccccccccccCCCEeCcchHHHHHHHCCc
Confidence            4799999999999999999999999999999864 44799999999999888899999999999999996


No 43 
>KOG4217|consensus
Probab=99.87  E-value=4.1e-24  Score=177.06  Aligned_cols=76  Identities=43%  Similarity=0.895  Sum_probs=71.3

Q ss_pred             CcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccC
Q psy16683          3 QTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYG   79 (139)
Q Consensus         3 ~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~   79 (139)
                      ..|.||||.|..-||||-+|+|||+||+|+|++ +..|.|..+.+|.+++..|+.|++||||||++|||-.+-|+.|
T Consensus       270 ~~CAVCgDnAaCqHYGvRTCEGCKGFFKRTVQK-naKYvClanKnCPVDKRrRnRCQyCRfQKCL~VGMVKEVVRtd  345 (605)
T KOG4217|consen  270 GLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQK-NAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTD  345 (605)
T ss_pred             ceeeecCChHHhhhcCccccccchHHHHHHHhc-CCeeEeecCCCCCcchhhhhhchhhhHhHHHHhhhhhhheecc
Confidence            579999999999999999999999999999996 5678999999999999999999999999999999999988653


No 44 
>KOG4218|consensus
Probab=99.87  E-value=7.6e-24  Score=170.30  Aligned_cols=80  Identities=41%  Similarity=0.925  Sum_probs=74.4

Q ss_pred             CCcCcccCCCCceeeeccccccccccceeeeeecCCCcccccCCccccccccCcccccccccccceeecccccCcccCCC
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLPSISECKNNNECIINKKNRTSCKSCRLRKCLMVGMSKSGSRYGRR   81 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~FFrR~~~~~~~~~~C~~~~~C~i~~~~~~~Ck~CRl~KCl~~GM~~~~vq~~R~   81 (139)
                      .+.|.||||+-+|||||.++|++|++||+|+|+++. .|.|..+.+|.|++..|..|.+||||||+.+||..++|+-+|+
T Consensus        15 ~ElCPVCGDkVSGYHYGLLTCESCKGFFKRTVQNnK-~YtC~e~qnC~iDkTqRKRCP~CRFQKCLtvGMklEAVRADRM   93 (475)
T KOG4218|consen   15 GELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNK-QYTCSEEQNCHIDKTQRKRCPSCRFQKCLTVGMKLEAVRADRM   93 (475)
T ss_pred             ccccccccCccccceeeeeehhhhhhHHHHHhhcCc-ceecccccccccchHhhccCCchhHHHHhhhhhhHHHHHHhhh
Confidence            357999999999999999999999999999999754 5799999999999999999999999999999999999988876


Q ss_pred             C
Q psy16683         82 S   82 (139)
Q Consensus        82 ~   82 (139)
                      .
T Consensus        94 R   94 (475)
T KOG4218|consen   94 R   94 (475)
T ss_pred             c
Confidence            4


No 45 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=72.68  E-value=0.65  Score=32.24  Aligned_cols=30  Identities=30%  Similarity=0.872  Sum_probs=21.1

Q ss_pred             CCcCcccCCCCc---eeeeccccccccccceee
Q psy16683          2 NQTCKVCGEPAA---GFHFGAFTCEGCKSFFGR   31 (139)
Q Consensus         2 ~~~C~vC~~~a~---g~hyGv~sC~~C~~FFrR   31 (139)
                      |..|.-||.+..   ...||++.|..|++..|-
T Consensus        13 N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~   45 (116)
T PF01412_consen   13 NKVCADCGAPNPTWASLNYGIFLCLECAGIHRS   45 (116)
T ss_dssp             CTB-TTT-SBS--EEETTTTEEE-HHHHHHHHH
T ss_pred             cCcCCCCCCCCCCEEEeecChhhhHHHHHHHHH
Confidence            667999997653   468999999999998644


No 46 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=64.26  E-value=3.7  Score=21.57  Aligned_cols=21  Identities=33%  Similarity=0.866  Sum_probs=16.6

Q ss_pred             cCcccCCCCceeeeccccccccc
Q psy16683          4 TCKVCGEPAAGFHFGAFTCEGCK   26 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv~sC~~C~   26 (139)
                      .|.||+....|..  +..|..|-
T Consensus         2 ~C~~C~~~~~~~~--~Y~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGFY--FYHCSECC   22 (30)
T ss_pred             CCCCCCCCcCCCE--eEEeCCCC
Confidence            4889998888885  56787776


No 47 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=63.66  E-value=2.4  Score=29.21  Aligned_cols=30  Identities=30%  Similarity=0.802  Sum_probs=24.5

Q ss_pred             CCcCcccCCCCc---eeeeccccccccccceee
Q psy16683          2 NQTCKVCGEPAA---GFHFGAFTCEGCKSFFGR   31 (139)
Q Consensus         2 ~~~C~vC~~~a~---g~hyGv~sC~~C~~FFrR   31 (139)
                      |..|.-||.+..   ...||++.|..|++.-|.
T Consensus         3 N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~   35 (112)
T smart00105        3 NKKCFDCGAPNPTWASVNLGVFLCIECSGIHRS   35 (112)
T ss_pred             CCcccCCCCCCCCcEEeccceeEhHHhHHHHHh
Confidence            678999997643   579999999999998654


No 48 
>PRK00420 hypothetical protein; Validated
Probab=48.13  E-value=12  Score=26.19  Aligned_cols=27  Identities=26%  Similarity=0.560  Sum_probs=19.3

Q ss_pred             CCcCcccCCCCceeeeccccccccccc
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCKSF   28 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~~F   28 (139)
                      ...|.+||.+-...+=|-.-|-.|..+
T Consensus        23 ~~~CP~Cg~pLf~lk~g~~~Cp~Cg~~   49 (112)
T PRK00420         23 SKHCPVCGLPLFELKDGEVVCPVHGKV   49 (112)
T ss_pred             cCCCCCCCCcceecCCCceECCCCCCe
Confidence            456888887776666677777777754


No 49 
>PF15446 zf-PHD-like:  PHD/FYVE-zinc-finger like domain
Probab=47.79  E-value=17  Score=27.30  Aligned_cols=29  Identities=31%  Similarity=0.823  Sum_probs=20.9

Q ss_pred             cCcccCCCCceeeecccc-ccccccceeee
Q psy16683          4 TCKVCGEPAAGFHFGAFT-CEGCKSFFGRS   32 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv~s-C~~C~~FFrR~   32 (139)
                      .|.+|+..+.+..=|.+. |-+|..-|-..
T Consensus         1 ~C~~C~~~g~~~~kG~Lv~CQGCs~sYHk~   30 (175)
T PF15446_consen    1 TCDTCGYEGDDRNKGPLVYCQGCSSSYHKA   30 (175)
T ss_pred             CcccccCCCCCccCCCeEEcCccChHHHhh
Confidence            488998776666667654 99998776444


No 50 
>KOG3277|consensus
Probab=42.99  E-value=9.9  Score=28.14  Aligned_cols=26  Identities=38%  Similarity=0.970  Sum_probs=18.8

Q ss_pred             cCcccCCCCc------eeeeccc--cccccccce
Q psy16683          4 TCKVCGEPAA------GFHFGAF--TCEGCKSFF   29 (139)
Q Consensus         4 ~C~vC~~~a~------g~hyGv~--sC~~C~~FF   29 (139)
                      .|.||+.++.      .||=|++  +|.+|+.+-
T Consensus        81 TCkvCntRs~ktisk~AY~~GvVivqC~gC~~~H  114 (165)
T KOG3277|consen   81 TCKVCNTRSTKTISKQAYEKGVVIVQCPGCKNHH  114 (165)
T ss_pred             EeeccCCccccccChhhhhCceEEEECCCCccce
Confidence            5999987654      3777774  688888753


No 51 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=42.98  E-value=14  Score=24.80  Aligned_cols=27  Identities=26%  Similarity=0.790  Sum_probs=19.2

Q ss_pred             CcCcccCCCCc-eeeeccccccccccce
Q psy16683          3 QTCKVCGEPAA-GFHFGAFTCEGCKSFF   29 (139)
Q Consensus         3 ~~C~vC~~~a~-g~hyGv~sC~~C~~FF   29 (139)
                      ..|..|+..+. -.-.|.+.|+-|..-|
T Consensus        36 ~~Cp~C~~~~VkR~a~GIW~C~kCg~~f   63 (89)
T COG1997          36 HVCPFCGRTTVKRIATGIWKCRKCGAKF   63 (89)
T ss_pred             CcCCCCCCcceeeeccCeEEcCCCCCee
Confidence            35888887764 3577888888887655


No 52 
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=42.40  E-value=11  Score=21.58  Aligned_cols=24  Identities=25%  Similarity=0.832  Sum_probs=16.8

Q ss_pred             cCcccCCCCceeeeccccccccccce
Q psy16683          4 TCKVCGEPAAGFHFGAFTCEGCKSFF   29 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv~sC~~C~~FF   29 (139)
                      .|.||+.  .+..-..+.|..|..+|
T Consensus         1 ~C~vC~~--~~~~~~~i~C~~C~~~~   24 (51)
T PF00628_consen    1 YCPVCGQ--SDDDGDMIQCDSCNRWY   24 (51)
T ss_dssp             EBTTTTS--SCTTSSEEEBSTTSCEE
T ss_pred             eCcCCCC--cCCCCCeEEcCCCChhh
Confidence            3788988  33344567899998765


No 53 
>PF03002 Somatostatin:  Somatostatin/Cortistatin family;  InterPro: IPR018142 Somatostatin inhibits the release of the pituitary growth hormone, somatotropin and inhibits the release of glucagon and insulin from the pancreas of fasted animals. Cortistatin is a cortical neuropeptide with neuronal depressant and sleep-modulating properties [].; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=39.82  E-value=13  Score=17.45  Aligned_cols=10  Identities=50%  Similarity=1.381  Sum_probs=7.5

Q ss_pred             ccccceeeee
Q psy16683         24 GCKSFFGRSY   33 (139)
Q Consensus        24 ~C~~FFrR~~   33 (139)
                      +|+.||..+.
T Consensus         6 ~CknffWK~~   15 (18)
T PF03002_consen    6 GCKNFFWKTF   15 (18)
T ss_pred             cccceeeccc
Confidence            6899997653


No 54 
>PRK08359 transcription factor; Validated
Probab=39.48  E-value=9.8  Score=28.60  Aligned_cols=30  Identities=27%  Similarity=0.757  Sum_probs=21.4

Q ss_pred             CCcCcccCCCCceeeecc-------ccccccccceee
Q psy16683          2 NQTCKVCGEPAAGFHFGA-------FTCEGCKSFFGR   31 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv-------~sC~~C~~FFrR   31 (139)
                      +..|.+||.+..|.-|-|       ..|..|+.=|-.
T Consensus         6 ~~~CEiCG~~i~g~~~~v~ieGael~VC~~Ca~k~G~   42 (176)
T PRK08359          6 PRYCEICGAEIRGPGHRIRIEGAELLVCDRCYEKYGR   42 (176)
T ss_pred             cceeecCCCccCCCCeEEEEcCeEEehHHHHHHHhCC
Confidence            345999999988874444       579999944433


No 55 
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=38.71  E-value=17  Score=24.82  Aligned_cols=25  Identities=24%  Similarity=0.639  Sum_probs=15.1

Q ss_pred             CcccCCCCceeeeccccccccccce
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFF   29 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FF   29 (139)
                      |.||++.+-...=+.+.|.+|..=|
T Consensus        38 CeiC~~~GY~q~g~~lvC~~C~~~~   62 (102)
T PF10080_consen   38 CEICGPKGYYQEGDQLVCKNCGVRF   62 (102)
T ss_pred             ccccCCCceEEECCEEEEecCCCEE
Confidence            6777655555555566677776533


No 56 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=37.70  E-value=16  Score=18.91  Aligned_cols=15  Identities=33%  Similarity=1.152  Sum_probs=5.8

Q ss_pred             cCcccCCCCce-eeec
Q psy16683          4 TCKVCGEPAAG-FHFG   18 (139)
Q Consensus         4 ~C~vC~~~a~g-~hyG   18 (139)
                      .|.+|+.+..+ ..|.
T Consensus         2 ~C~~C~~~~~~~~~Y~   17 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYR   17 (30)
T ss_dssp             --TTTS----S--EEE
T ss_pred             cCCcCCCcCCCCceEE
Confidence            58888888777 5554


No 57 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=36.28  E-value=18  Score=21.08  Aligned_cols=24  Identities=33%  Similarity=1.092  Sum_probs=18.6

Q ss_pred             cCcccCCCC-cee-eecccccccccc
Q psy16683          4 TCKVCGEPA-AGF-HFGAFTCEGCKS   27 (139)
Q Consensus         4 ~C~vC~~~a-~g~-hyGv~sC~~C~~   27 (139)
                      .|.||+++. .|. -||.+.|..|-.
T Consensus         1 ~CiiC~~~~~~GI~I~~~fIC~~CE~   26 (46)
T PF10764_consen    1 KCIICGKEKEEGIHIYGKFICSDCEK   26 (46)
T ss_pred             CeEeCCCcCCCCEEEECeEehHHHHH
Confidence            489999764 475 488899999973


No 58 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=35.99  E-value=16  Score=30.05  Aligned_cols=30  Identities=33%  Similarity=0.852  Sum_probs=25.0

Q ss_pred             CCcCcccCCCC---ceeeeccccccccccceee
Q psy16683          2 NQTCKVCGEPA---AGFHFGAFTCEGCKSFFGR   31 (139)
Q Consensus         2 ~~~C~vC~~~a---~g~hyGv~sC~~C~~FFrR   31 (139)
                      |..|.-||.+.   ....|||+.|--|++-.|-
T Consensus        20 Nk~CaDCga~~P~W~S~nlGvfiCi~CagvHRs   52 (319)
T COG5347          20 NKKCADCGAPNPTWASVNLGVFLCIDCAGVHRS   52 (319)
T ss_pred             cCccccCCCCCCceEecccCeEEEeecchhhhc
Confidence            56799999876   3589999999999997654


No 59 
>KOG0703|consensus
Probab=35.93  E-value=20  Score=29.08  Aligned_cols=31  Identities=29%  Similarity=0.763  Sum_probs=25.1

Q ss_pred             CCcCcccCCCC---ceeeeccccccccccceeee
Q psy16683          2 NQTCKVCGEPA---AGFHFGAFTCEGCKSFFGRS   32 (139)
Q Consensus         2 ~~~C~vC~~~a---~g~hyGv~sC~~C~~FFrR~   32 (139)
                      |..|.-||...   ....+||+.|--|++.-|..
T Consensus        25 N~~CADC~a~~P~WaSwnlGvFiC~~C~giHR~l   58 (287)
T KOG0703|consen   25 NKVCADCGAKGPRWASWNLGVFICLRCAGIHRSL   58 (287)
T ss_pred             cCcccccCCCCCCeEEeecCeEEEeecccccccc
Confidence            56799998763   35899999999999987654


No 60 
>PRK06424 transcription factor; Provisional
Probab=35.74  E-value=13  Score=26.91  Aligned_cols=25  Identities=24%  Similarity=0.693  Sum_probs=18.8

Q ss_pred             CcccCCCCceeeecc-------cccccccccee
Q psy16683          5 CKVCGEPAAGFHFGA-------FTCEGCKSFFG   30 (139)
Q Consensus         5 C~vC~~~a~g~hyGv-------~sC~~C~~FFr   30 (139)
                      |.+||....+.| -|       ..|..|+-|=.
T Consensus         3 CE~CG~~~~~~~-~v~ieg~~l~vC~~Ca~~G~   34 (144)
T PRK06424          3 CEMCGKKVPQTT-KVMIDGAILNVCDDCAKFGT   34 (144)
T ss_pred             ccccCcccCCce-EEEEcCeeeehhHHHHHcCC
Confidence            999999888763 33       35999998743


No 61 
>PF09289 FOLN:  Follistatin/Osteonectin-like EGF domain;  InterPro: IPR015369 This domain is predominantly found in osteonectin and follistatin. They adopt an EGF-like structure [, ]. Follistatin is involved in diverse activities from embryonic development to cell secretion. ; GO: 0005515 protein binding; PDB: 1LR7_A 1LR8_A 1LR9_A 2ARP_F 3B4V_H 2KCX_A 3SEK_C 2P6A_D 3HH2_C 2B0U_D ....
Probab=35.56  E-value=13  Score=18.41  Aligned_cols=19  Identities=21%  Similarity=0.768  Sum_probs=12.5

Q ss_pred             ccccCCccccccccCcccc
Q psy16683         40 SECKNNNECIINKKNRTSC   58 (139)
Q Consensus        40 ~~C~~~~~C~i~~~~~~~C   58 (139)
                      +.|..+..|.++..++..|
T Consensus         4 ~~Ck~GKvC~~d~~~~P~C   22 (22)
T PF09289_consen    4 FHCKRGKVCKVDEQGKPHC   22 (22)
T ss_dssp             ---BTTEEEEEETTTCEEE
T ss_pred             cccCCCCEeeeCCCCCcCC
Confidence            3688888999887776654


No 62 
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=35.20  E-value=31  Score=20.35  Aligned_cols=15  Identities=20%  Similarity=0.565  Sum_probs=11.0

Q ss_pred             CcCcccCCCCceeee
Q psy16683          3 QTCKVCGEPAAGFHF   17 (139)
Q Consensus         3 ~~C~vC~~~a~g~hy   17 (139)
                      .+|.-||..+..+++
T Consensus         2 kPCPfCGg~~~~~~~   16 (53)
T TIGR03655         2 KPCPFCGGADVYLRR   16 (53)
T ss_pred             CCCCCCCCcceeeEe
Confidence            579999987765553


No 63 
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=34.93  E-value=24  Score=19.97  Aligned_cols=23  Identities=30%  Similarity=0.839  Sum_probs=10.1

Q ss_pred             CcCcccCCCCceeee------cccccccc
Q psy16683          3 QTCKVCGEPAAGFHF------GAFTCEGC   25 (139)
Q Consensus         3 ~~C~vC~~~a~g~hy------Gv~sC~~C   25 (139)
                      .+|.+||....=..|      |.+.|+.|
T Consensus         4 ~pCP~CGG~DrFri~~d~~~~G~~~C~~C   32 (40)
T PF08273_consen    4 GPCPICGGKDRFRIFDDKDGRGTWICRQC   32 (40)
T ss_dssp             E--TTTT-TTTEEEETT----S-EEETTT
T ss_pred             CCCCCCcCccccccCcCcccCCCEECCCC
Confidence            478888754322212      55566666


No 64 
>PHA03124 dUTPase; Provisional
Probab=31.60  E-value=10  Score=31.96  Aligned_cols=17  Identities=47%  Similarity=1.249  Sum_probs=13.5

Q ss_pred             ccccccccccceeeeee
Q psy16683         18 GAFTCEGCKSFFGRSYN   34 (139)
Q Consensus        18 Gv~sC~~C~~FFrR~~~   34 (139)
                      |-+-|-+|++||||...
T Consensus       189 ~~~~~~~~~~~~~~~~~  205 (418)
T PHA03124        189 GNFGCMGCKAFYRRLFE  205 (418)
T ss_pred             ccccccchHHHHHHHHH
Confidence            33459999999999864


No 65 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=30.97  E-value=31  Score=19.23  Aligned_cols=9  Identities=33%  Similarity=0.944  Sum_probs=6.3

Q ss_pred             CcCcccCCC
Q psy16683          3 QTCKVCGEP   11 (139)
Q Consensus         3 ~~C~vC~~~   11 (139)
                      .+|.+||..
T Consensus         4 ~pCP~CGG~   12 (37)
T smart00778        4 GPCPNCGGS   12 (37)
T ss_pred             cCCCCCCCc
Confidence            578888753


No 66 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=27.03  E-value=28  Score=18.82  Aligned_cols=7  Identities=57%  Similarity=1.289  Sum_probs=3.3

Q ss_pred             CcccCCC
Q psy16683          5 CKVCGEP   11 (139)
Q Consensus         5 C~vC~~~   11 (139)
                      |.+||..
T Consensus         5 C~~CG~i   11 (34)
T cd00729           5 CPVCGYI   11 (34)
T ss_pred             CCCCCCE
Confidence            5555543


No 67 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=26.93  E-value=15  Score=20.14  Aligned_cols=24  Identities=29%  Similarity=0.785  Sum_probs=11.0

Q ss_pred             CcCcccCCCC----ceeeeccccccccc
Q psy16683          3 QTCKVCGEPA----AGFHFGAFTCEGCK   26 (139)
Q Consensus         3 ~~C~vC~~~a----~g~hyGv~sC~~C~   26 (139)
                      ..|.-||++-    --.||+...|..|+
T Consensus         4 ~~C~eC~~~f~dSyL~~~F~~~VCD~CR   31 (34)
T PF01286_consen    4 PKCDECGKPFMDSYLLNNFDLPVCDKCR   31 (34)
T ss_dssp             EE-TTT--EES-SSCCCCTS-S--TTT-
T ss_pred             chHhHhCCHHHHHHHHHhCCcccccccc
Confidence            3577787652    23688888888875


No 68 
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=26.41  E-value=31  Score=29.04  Aligned_cols=31  Identities=26%  Similarity=0.629  Sum_probs=25.1

Q ss_pred             CCcCcccCCCC---ceeeeccccccccccceeee
Q psy16683          2 NQTCKVCGEPA---AGFHFGAFTCEGCKSFFGRS   32 (139)
Q Consensus         2 ~~~C~vC~~~a---~g~hyGv~sC~~C~~FFrR~   32 (139)
                      |..|.-||.+.   ....||++.|-.|++.-|..
T Consensus        22 Nk~CaDCga~nPtWASvn~GIFLCl~CSGVHRsL   55 (395)
T PLN03114         22 NKICFDCNAKNPTWASVTYGIFLCIDCSAVHRSL   55 (395)
T ss_pred             CCcCccCCCCCCCceeeccceeehhhhhHhhccC
Confidence            56799998653   35899999999999987654


No 69 
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=26.28  E-value=24  Score=25.83  Aligned_cols=25  Identities=32%  Similarity=0.919  Sum_probs=18.7

Q ss_pred             cCcccCCCCceeeecc-------ccccccccc
Q psy16683          4 TCKVCGEPAAGFHFGA-------FTCEGCKSF   28 (139)
Q Consensus         4 ~C~vC~~~a~g~hyGv-------~sC~~C~~F   28 (139)
                      .|.+||.+..|.-|-|       ..|..|+-|
T Consensus         2 ~CEiCG~~i~~~~~~v~iega~l~vC~~C~k~   33 (154)
T TIGR00270         2 NCEICGRKIKGKGFKIVIEGSEMTVCGECRKF   33 (154)
T ss_pred             ccccCCCccCCCCeEEEEcCeEEehhhhHHhc
Confidence            3999999887764433       469999955


No 70 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=26.07  E-value=24  Score=23.68  Aligned_cols=25  Identities=28%  Similarity=0.780  Sum_probs=18.1

Q ss_pred             cCcccCCCCc-eeeeccccccccccc
Q psy16683          4 TCKVCGEPAA-GFHFGAFTCEGCKSF   28 (139)
Q Consensus         4 ~C~vC~~~a~-g~hyGv~sC~~C~~F   28 (139)
                      .|..||..+- -.-.|++.|..|.--
T Consensus        37 ~Cp~Cgk~~vkR~a~GIW~C~~C~~~   62 (90)
T PF01780_consen   37 TCPFCGKTSVKRVATGIWKCKKCGKK   62 (90)
T ss_dssp             EESSSSSSEEEEEETTEEEETTTTEE
T ss_pred             cCCCCCCceeEEeeeEEeecCCCCCE
Confidence            5888887764 356788888888743


No 71 
>TIGR00009 L28 ribosomal protein L28. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture and are not included.
Probab=23.89  E-value=40  Score=20.40  Aligned_cols=12  Identities=25%  Similarity=0.767  Sum_probs=9.6

Q ss_pred             CCCcCcccCCCC
Q psy16683          1 MNQTCKVCGEPA   12 (139)
Q Consensus         1 ~~~~C~vC~~~a   12 (139)
                      |...|.|||...
T Consensus         1 Ms~~C~i~GK~~   12 (56)
T TIGR00009         1 MSRKCQLTGKGP   12 (56)
T ss_pred             CCCEeeeCCCcC
Confidence            677899999754


No 72 
>PF01753 zf-MYND:  MYND finger;  InterPro: IPR002893 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MYND-type zinc finger domains. The MYND domain (myeloid, Nervy, and DEAF-1) is present in a large group of proteins that includes RP-8 (PDCD2), Nervy, and predicted proteins from Drosophila, mammals, Caenorhabditis elegans, yeast, and plants [, , ]. The MYND domain consists of a cluster of cysteine and histidine residues, arranged with an invariant spacing to form a potential zinc-binding motif []. Mutating conserved cysteine residues in the DEAF-1 MYND domain does not abolish DNA binding, which suggests that the MYND domain might be involved in protein-protein interactions []. Indeed, the MYND domain of ETO/MTG8 interacts directly with the N-CoR and SMRT co-repressors [, ]. Aberrant recruitment of co-repressor complexes and inappropriate transcriptional repression is believed to be a general mechanism of leukemogenesis caused by the t(8;21) translocations that fuse ETO with the acute myelogenous leukemia 1 (AML1) protein. ETO has been shown to be a co-repressor recruited by the promyelocytic leukemia zinc finger (PLZF) protein []. A divergent MYND domain present in the adenovirus E1A binding protein BS69 was also shown to interact with N-CoR and mediate transcriptional repression []. The current evidence suggests that the MYND motif in mammalian proteins constitutes a protein-protein interaction domain that functions as a co-repressor-recruiting interface. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3QWW_A 3QWV_A 3TG5_A 3S7F_A 3RIB_B 3TG4_A 3S7J_A 3S7D_A 3S7B_A 3RU0_A ....
Probab=23.66  E-value=48  Score=17.78  Aligned_cols=18  Identities=56%  Similarity=1.235  Sum_probs=9.8

Q ss_pred             CcccCCCCceeeeccccccccccc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSF   28 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~F   28 (139)
                      |.+|+.++.      ..|..|...
T Consensus         1 C~~C~~~~~------~~C~~C~~~   18 (37)
T PF01753_consen    1 CAVCGKPAL------KRCSRCKSV   18 (37)
T ss_dssp             -TTTSSCSS------EEETTTSSS
T ss_pred             CcCCCCCcC------CcCCCCCCE
Confidence            566776332      267777644


No 73 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=23.17  E-value=54  Score=22.00  Aligned_cols=24  Identities=38%  Similarity=0.951  Sum_probs=14.6

Q ss_pred             cCcccCCCCc-eeeecccccccccc
Q psy16683          4 TCKVCGEPAA-GFHFGAFTCEGCKS   27 (139)
Q Consensus         4 ~C~vC~~~a~-g~hyGv~sC~~C~~   27 (139)
                      .|..||..+- -..-|.+.|+.|..
T Consensus        38 ~CpfCgk~~vkR~a~GIW~C~~C~~   62 (90)
T PTZ00255         38 FCPFCGKHAVKRQAVGIWRCKGCKK   62 (90)
T ss_pred             cCCCCCCCceeeeeeEEEEcCCCCC
Confidence            4777765553 24457777777763


No 74 
>CHL00112 rpl28 ribosomal protein L28; Provisional
Probab=23.14  E-value=43  Score=20.88  Aligned_cols=15  Identities=33%  Similarity=0.935  Sum_probs=10.9

Q ss_pred             CCCcCcccCCCC-cee
Q psy16683          1 MNQTCKVCGEPA-AGF   15 (139)
Q Consensus         1 ~~~~C~vC~~~a-~g~   15 (139)
                      |...|.|||... .|.
T Consensus         1 Msr~C~i~GK~~~~Gn   16 (63)
T CHL00112          1 MSKKCQLTGKKANNGY   16 (63)
T ss_pred             CCCeeccCCCcCccCc
Confidence            677899999654 453


No 75 
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=22.96  E-value=35  Score=27.18  Aligned_cols=13  Identities=23%  Similarity=0.685  Sum_probs=5.0

Q ss_pred             eeecccccccccc
Q psy16683         15 FHFGAFTCEGCKS   27 (139)
Q Consensus        15 ~hyGv~sC~~C~~   27 (139)
                      .||.-..|-.|..
T Consensus       207 W~~~R~~Cp~Cg~  219 (290)
T PF04216_consen  207 WRFVRIKCPYCGN  219 (290)
T ss_dssp             EE--TTS-TTT--
T ss_pred             eeecCCCCcCCCC
Confidence            4555566666663


No 76 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=22.61  E-value=37  Score=20.06  Aligned_cols=31  Identities=19%  Similarity=0.607  Sum_probs=20.5

Q ss_pred             CCcCcccCCCCce----eeecc-ccccccccceeee
Q psy16683          2 NQTCKVCGEPAAG----FHFGA-FTCEGCKSFFGRS   32 (139)
Q Consensus         2 ~~~C~vC~~~a~g----~hyGv-~sC~~C~~FFrR~   32 (139)
                      ...|..|+...+-    .-.|. .-|.+|..+|+..
T Consensus         3 ~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~   38 (52)
T smart00401        3 GRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKH   38 (52)
T ss_pred             CCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHc
Confidence            4568888865432    23444 6799999888764


No 77 
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=22.47  E-value=44  Score=29.86  Aligned_cols=31  Identities=23%  Similarity=0.522  Sum_probs=25.1

Q ss_pred             CCcCcccCCCCc---eeeeccccccccccceeee
Q psy16683          2 NQTCKVCGEPAA---GFHFGAFTCEGCKSFFGRS   32 (139)
Q Consensus         2 ~~~C~vC~~~a~---g~hyGv~sC~~C~~FFrR~   32 (139)
                      |..|.-||...-   ...||++.|-.|++.-|..
T Consensus        23 Nk~CADCgs~~P~WASiNlGIFICi~CSGIHRsL   56 (648)
T PLN03119         23 NRRCINCNSLGPQYVCTTFWTFVCMACSGIHREF   56 (648)
T ss_pred             CCccccCCCCCCCceeeccceEEeccchhhhccC
Confidence            567999987543   5799999999999987654


No 78 
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=21.82  E-value=52  Score=18.29  Aligned_cols=22  Identities=27%  Similarity=0.843  Sum_probs=11.6

Q ss_pred             CcccCCCCceeeeccccccccccce
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKSFF   29 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~FF   29 (139)
                      |.+|+....-.   ...|+.|..-|
T Consensus         1 C~~C~~~~~l~---~f~C~~C~~~F   22 (39)
T smart00154        1 CHFCRKKVGLT---GFKCRHCGNLF   22 (39)
T ss_pred             CcccCCccccc---CeECCccCCcc
Confidence            45555544332   34677776544


No 80 
>PLN03131 hypothetical protein; Provisional
Probab=21.82  E-value=44  Score=30.15  Aligned_cols=31  Identities=23%  Similarity=0.515  Sum_probs=25.1

Q ss_pred             CCcCcccCCCCc---eeeeccccccccccceeee
Q psy16683          2 NQTCKVCGEPAA---GFHFGAFTCEGCKSFFGRS   32 (139)
Q Consensus         2 ~~~C~vC~~~a~---g~hyGv~sC~~C~~FFrR~   32 (139)
                      |..|.-|+...-   ...||++.|-.|++.-|..
T Consensus        23 Nk~CADCga~~P~WASiNlGIFICi~CSGIHRsL   56 (705)
T PLN03131         23 NRRCINCNSLGPQFVCTNFWTFICMTCSGIHREF   56 (705)
T ss_pred             CCccccCCCCCCCeeEeccceEEchhchhhhccc
Confidence            567999987543   5899999999999987664


No 81 
>PLN02189 cellulose synthase
Probab=21.06  E-value=45  Score=31.72  Aligned_cols=22  Identities=36%  Similarity=1.037  Sum_probs=17.4

Q ss_pred             CcCcccCCC----Cceeeeccccccccc
Q psy16683          3 QTCKVCGEP----AAGFHFGAFTCEGCK   26 (139)
Q Consensus         3 ~~C~vC~~~----a~g~hyGv~sC~~C~   26 (139)
                      ..|.||||.    +.|--|  ++|..|+
T Consensus        35 ~~C~iCgd~vg~~~~g~~f--vaC~~C~   60 (1040)
T PLN02189         35 QVCEICGDEIGLTVDGDLF--VACNECG   60 (1040)
T ss_pred             ccccccccccCcCCCCCEE--EeeccCC
Confidence            369999987    678777  6788876


No 82 
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=20.81  E-value=15  Score=22.48  Aligned_cols=26  Identities=38%  Similarity=0.892  Sum_probs=11.0

Q ss_pred             CCCcCcccCCCCc---eeeeccccccccc
Q psy16683          1 MNQTCKVCGEPAA---GFHFGAFTCEGCK   26 (139)
Q Consensus         1 ~~~~C~vC~~~a~---g~hyGv~sC~~C~   26 (139)
                      |...|.+||++..   ..-|.-+....|+
T Consensus         1 m~v~CP~C~k~~~~~~~n~~rPFCS~RCk   29 (57)
T PF03884_consen    1 MTVKCPICGKPVEWSPENPFRPFCSERCK   29 (57)
T ss_dssp             -EEE-TTT--EEE-SSSSS--SSSSHHHH
T ss_pred             CcccCCCCCCeecccCCCCcCCcccHhhc
Confidence            5567888886542   2344444444444


No 83 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=20.78  E-value=35  Score=17.95  Aligned_cols=19  Identities=32%  Similarity=0.983  Sum_probs=9.3

Q ss_pred             CCcCcccCCCCceeeeccccccccc
Q psy16683          2 NQTCKVCGEPAAGFHFGAFTCEGCK   26 (139)
Q Consensus         2 ~~~C~vC~~~a~g~hyGv~sC~~C~   26 (139)
                      ...|.||+.      .+-.+|..|.
T Consensus         2 ~~~C~vC~~------~~kY~Cp~C~   20 (30)
T PF04438_consen    2 RKLCSVCGN------PAKYRCPRCG   20 (30)
T ss_dssp             -EEETSSSS------EESEE-TTT-
T ss_pred             cCCCccCcC------CCEEECCCcC
Confidence            456788875      2333566555


No 84 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=20.62  E-value=69  Score=18.13  Aligned_cols=13  Identities=31%  Similarity=0.930  Sum_probs=6.0

Q ss_pred             CcccCCCCceeee
Q psy16683          5 CKVCGEPAAGFHF   17 (139)
Q Consensus         5 C~vC~~~a~g~hy   17 (139)
                      |.+|+.+..|.+|
T Consensus         3 C~~C~~~i~g~r~   15 (46)
T cd02249           3 CDGCLKPIVGVRY   15 (46)
T ss_pred             CcCCCCCCcCCEE
Confidence            4455544444433


No 85 
>COG4393 Predicted membrane protein [Function unknown]
Probab=20.43  E-value=40  Score=28.18  Aligned_cols=23  Identities=22%  Similarity=0.674  Sum_probs=21.0

Q ss_pred             CcccCCCCceeeecccccccccc
Q psy16683          5 CKVCGEPAAGFHFGAFTCEGCKS   27 (139)
Q Consensus         5 C~vC~~~a~g~hyGv~sC~~C~~   27 (139)
                      |.+|||.+--+.=|-+.|-+|..
T Consensus       337 C~iCGd~GYv~e~dqvICv~C~V  359 (405)
T COG4393         337 CDICGDQGYVMEGDQVICVRCDV  359 (405)
T ss_pred             HHhccccceEeECCEEEEEEccE
Confidence            99999999888888999999985


No 86 
>PF06147 DUF968:  Protein of unknown function (DUF968);  InterPro: IPR010373 This is a family of uncharacterised prophage proteins that are also found in bacteria and humans.
Probab=20.23  E-value=50  Score=25.11  Aligned_cols=16  Identities=38%  Similarity=0.974  Sum_probs=11.8

Q ss_pred             CCcCcccCCC-Cceeee
Q psy16683          2 NQTCKVCGEP-AAGFHF   17 (139)
Q Consensus         2 ~~~C~vC~~~-a~g~hy   17 (139)
                      ..+|.|||.+ +.-.|+
T Consensus       127 ~~~C~iCGk~~~d~hH~  143 (200)
T PF06147_consen  127 SRPCVICGKPPADIHHI  143 (200)
T ss_pred             cCccccCCCCcccccee
Confidence            5789999975 555665


Done!