Query         psy16685
Match_columns 99
No_of_seqs    124 out of 1052
Neff          10.7
Searched_HMMs 46136
Date          Fri Aug 16 19:21:53 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16685.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16685hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 8.4E-26 1.8E-30  134.7   1.3   89    1-91    177-265 (279)
  2 KOG2462|consensus               99.8 1.3E-20 2.9E-25  112.7   2.4   95    1-97    146-243 (279)
  3 KOG3576|consensus               99.6 1.2E-16 2.6E-21   92.5  -0.1   87   11-97    115-201 (267)
  4 KOG3623|consensus               99.6 3.3E-16 7.2E-21  104.1   1.8   81   10-90    891-971 (1007)
  5 KOG3576|consensus               99.5 5.8E-16 1.3E-20   89.7  -0.5   92    1-92    133-235 (267)
  6 KOG3623|consensus               99.5   1E-14 2.2E-19   97.2   1.3   62    1-62    910-971 (1007)
  7 PHA02768 hypothetical protein;  99.2 5.5E-12 1.2E-16   59.1   2.1   44   13-58      5-48  (55)
  8 KOG1074|consensus               99.2 1.2E-12 2.7E-17   88.4  -0.4   65    1-65    621-692 (958)
  9 KOG3608|consensus               99.2 5.6E-12 1.2E-16   78.6   1.0   93    1-93    195-316 (467)
 10 PHA00733 hypothetical protein   99.2 4.3E-11 9.2E-16   66.0   3.5   81   11-93     38-123 (128)
 11 KOG1074|consensus               99.1 2.5E-11 5.4E-16   82.3   2.2   61   13-73    879-939 (958)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.1 2.6E-11 5.6E-16   49.1  -0.0   24    1-24      2-25  (26)
 13 PHA00733 hypothetical protein   99.0 8.7E-11 1.9E-15   64.8   0.1   61    3-66     64-124 (128)
 14 KOG3608|consensus               98.9 6.1E-10 1.3E-14   69.7   2.2   94    1-95    279-378 (467)
 15 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.5E-09 3.2E-14   43.8   2.2   26   28-53      1-26  (26)
 16 PHA02768 hypothetical protein;  98.9 1.3E-09 2.9E-14   51.1   2.0   42   41-84      5-46  (55)
 17 PLN03086 PRLI-interacting fact  98.8 4.7E-09   1E-13   69.8   3.7   63   12-77    477-549 (567)
 18 PHA00616 hypothetical protein   98.7 5.4E-09 1.2E-13   46.8   1.0   33   13-45      1-33  (44)
 19 PHA00616 hypothetical protein   98.7 4.9E-09 1.1E-13   47.0   0.8   34   41-74      1-34  (44)
 20 PHA00732 hypothetical protein   98.6 3.6E-08 7.8E-13   50.0   3.0   46   13-64      1-47  (79)
 21 PLN03086 PRLI-interacting fact  98.5 1.3E-07 2.8E-12   63.2   4.5   68    8-80    448-515 (567)
 22 KOG3993|consensus               98.3 2.7E-07 5.8E-12   59.3   1.9   53   13-65    295-380 (500)
 23 PF00096 zf-C2H2:  Zinc finger,  98.2 5.7E-07 1.2E-11   35.0   1.3   22   42-63      1-22  (23)
 24 PF05605 zf-Di19:  Drought indu  98.1 8.8E-06 1.9E-10   38.4   4.0   50   13-65      2-53  (54)
 25 PF00096 zf-C2H2:  Zinc finger,  98.1 2.1E-06 4.6E-11   33.3   1.4   23   14-36      1-23  (23)
 26 PF13894 zf-C2H2_4:  C2H2-type   98.0 5.8E-06 1.2E-10   32.1   1.6   23   42-64      1-23  (24)
 27 PF13912 zf-C2H2_6:  C2H2-type   97.9 4.6E-06   1E-10   33.6   1.1   24   41-64      1-24  (27)
 28 PF09237 GAGA:  GAGA factor;  I  97.9 1.1E-05 2.4E-10   37.1   2.0   34   37-70     20-53  (54)
 29 COG5189 SFP1 Putative transcri  97.9 6.3E-06 1.4E-10   51.5   1.4   52   11-62    347-419 (423)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.4E-05 3.1E-10   32.1   1.5   25   13-37      1-25  (27)
 31 PHA00732 hypothetical protein   97.7   2E-05 4.4E-10   40.0   1.8   37   41-80      1-38  (79)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.7 3.5E-05 7.5E-10   29.8   1.9   23   14-36      1-23  (24)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.6 4.8E-05   1E-09   39.8   2.0   51   15-65      1-74  (100)
 34 PF09237 GAGA:  GAGA factor;  I  97.6 8.7E-05 1.9E-09   34.2   2.3   34    8-41     19-52  (54)
 35 PRK04860 hypothetical protein;  97.4  0.0001 2.2E-09   42.3   2.2   35   41-79    119-153 (160)
 36 smart00355 ZnF_C2H2 zinc finge  97.4  0.0001 2.2E-09   28.8   1.5   21   43-63      2-22  (26)
 37 smart00355 ZnF_C2H2 zinc finge  97.2 0.00034 7.4E-09   27.2   2.0   24   14-37      1-24  (26)
 38 KOG3993|consensus               97.0 0.00012 2.7E-09   47.5  -0.8   53   13-65    267-319 (500)
 39 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00056 1.2E-08   26.6   1.2   23   42-65      1-23  (24)
 40 PF12874 zf-met:  Zinc-finger o  96.7 0.00095 2.1E-08   26.1   1.2   20   15-34      2-21  (25)
 41 PF12874 zf-met:  Zinc-finger o  96.7 0.00081 1.8E-08   26.3   0.8   22   42-63      1-22  (25)
 42 PRK04860 hypothetical protein;  96.6  0.0016 3.4E-08   37.5   1.9   39   12-54    118-156 (160)
 43 PF12171 zf-C2H2_jaz:  Zinc-fin  96.4  0.0018 3.8E-08   25.9   1.0   22   14-35      2-23  (27)
 44 COG5189 SFP1 Putative transcri  95.9  0.0064 1.4E-07   38.6   2.0   48   39-86    347-415 (423)
 45 PF05605 zf-Di19:  Drought indu  95.8  0.0078 1.7E-07   28.2   1.8   47   41-90      2-50  (54)
 46 PF13913 zf-C2HC_2:  zinc-finge  95.8  0.0061 1.3E-07   24.0   1.2   18   43-61      4-21  (25)
 47 cd00350 rubredoxin_like Rubred  95.2   0.012 2.5E-07   24.8   1.1   24   14-49      2-25  (33)
 48 COG5048 FOG: Zn-finger [Genera  95.0  0.0089 1.9E-07   38.6   0.7   65   12-76    288-358 (467)
 49 smart00451 ZnF_U1 U1-like zinc  95.0   0.032 6.9E-07   23.4   2.2   22   13-34      3-24  (35)
 50 KOG2893|consensus               93.8   0.024 5.2E-07   34.7   0.6   41   16-60     13-53  (341)
 51 PF09986 DUF2225:  Uncharacteri  93.2   0.022 4.9E-07   34.3  -0.2   44   11-54      3-61  (214)
 52 KOG1146|consensus               93.0   0.075 1.6E-06   39.7   2.1   55    8-62    460-539 (1406)
 53 PF12756 zf-C2H2_2:  C2H2 type   92.9    0.11 2.3E-06   26.9   2.2   25   13-37     50-74  (100)
 54 PF09538 FYDLN_acid:  Protein o  92.5   0.094   2E-06   28.3   1.6   30   14-54     10-39  (108)
 55 smart00659 RPOLCX RNA polymera  92.1    0.15 3.2E-06   23.0   1.7   29   13-52      2-30  (44)
 56 COG2888 Predicted Zn-ribbon RN  91.6    0.14   3E-06   24.5   1.4    9   40-48     49-57  (61)
 57 PF13719 zinc_ribbon_5:  zinc-r  91.2    0.23   5E-06   21.3   1.8   34   14-52      3-36  (37)
 58 COG1592 Rubrerythrin [Energy p  90.6     0.2 4.3E-06   29.1   1.7   23   13-48    134-156 (166)
 59 KOG2186|consensus               90.6     0.3 6.6E-06   30.2   2.5   46   14-62      4-49  (276)
 60 cd00729 rubredoxin_SM Rubredox  90.5    0.16 3.5E-06   21.5   1.0   25   13-49      2-26  (34)
 61 PRK00464 nrdR transcriptional   90.0   0.083 1.8E-06   30.3  -0.2   17   41-57     28-44  (154)
 62 COG1997 RPL43A Ribosomal prote  89.9     0.2 4.3E-06   25.9   1.2   30   13-52     35-64  (89)
 63 PF10571 UPF0547:  Uncharacteri  89.6    0.21 4.5E-06   19.8   0.9   10   43-52     16-25  (26)
 64 PF13717 zinc_ribbon_4:  zinc-r  89.5    0.48   1E-05   20.2   2.1   33   14-51      3-35  (36)
 65 PF03604 DNA_RNApol_7kD:  DNA d  89.0    0.18   4E-06   21.0   0.6   28   14-52      1-28  (32)
 66 COG4049 Uncharacterized protei  89.0    0.15 3.3E-06   24.0   0.3   26   37-62     13-38  (65)
 67 PHA00626 hypothetical protein   89.0    0.14 3.1E-06   24.1   0.2   35   15-54      2-36  (59)
 68 TIGR02098 MJ0042_CXXC MJ0042 f  89.0    0.41 8.9E-06   20.4   1.7   34   14-52      3-36  (38)
 69 TIGR02300 FYDLN_acid conserved  88.3    0.37 8.1E-06   26.7   1.6   33   14-57     10-42  (129)
 70 PRK00398 rpoP DNA-directed RNA  87.7    0.36 7.8E-06   21.7   1.2   30   13-52      3-32  (46)
 71 TIGR00373 conserved hypothetic  87.6    0.34 7.3E-06   27.9   1.2   15   14-28    110-124 (158)
 72 smart00834 CxxC_CXXC_SSSS Puta  87.5    0.12 2.6E-06   22.4  -0.5   29   14-49      6-34  (41)
 73 COG5048 FOG: Zn-finger [Genera  87.2    0.28 6.1E-06   31.7   0.8   45    1-45    305-355 (467)
 74 TIGR02605 CxxC_CxxC_SSSS putat  87.1    0.14 3.1E-06   23.6  -0.4   29   14-49      6-34  (52)
 75 COG1996 RPC10 DNA-directed RNA  86.8     0.5 1.1E-05   21.8   1.3   30   12-51      5-34  (49)
 76 PRK06266 transcription initiat  86.5    0.36 7.7E-06   28.4   1.0   29   13-50    117-145 (178)
 77 KOG2893|consensus               86.2    0.38 8.2E-06   29.7   1.0   48   39-91      9-56  (341)
 78 PRK14890 putative Zn-ribbon RN  85.7    0.93   2E-05   21.7   2.0    9   40-48     47-55  (59)
 79 smart00531 TFIIE Transcription  85.4    0.76 1.7E-05   26.1   1.9   35   13-51     99-133 (147)
 80 PF04959 ARS2:  Arsenite-resist  84.5    0.61 1.3E-05   28.3   1.3   30    9-38     73-102 (214)
 81 PF14353 CpXC:  CpXC protein     83.9    0.12 2.6E-06   28.5  -1.8   21   40-60     37-57  (128)
 82 PRK09678 DNA-binding transcrip  81.9    0.48   1E-05   23.7   0.2   42   14-57      2-45  (72)
 83 KOG4173|consensus               80.4    0.46 9.9E-06   28.7  -0.3   49   15-63    108-168 (253)
 84 PTZ00255 60S ribosomal protein  79.9    0.86 1.9E-05   23.8   0.7   30   13-52     36-65  (90)
 85 PF12013 DUF3505:  Protein of u  79.6     1.4 3.1E-05   23.5   1.5   25   42-66     81-109 (109)
 86 TIGR00280 L37a ribosomal prote  77.3    0.93   2E-05   23.7   0.3   30   13-52     35-64  (91)
 87 COG3357 Predicted transcriptio  77.1     1.1 2.5E-05   23.3   0.6   11   13-23     58-68  (97)
 88 COG3364 Zn-ribbon containing p  76.5       2 4.2E-05   23.0   1.4   15   13-27      2-16  (112)
 89 PF01780 Ribosomal_L37ae:  Ribo  75.7    0.75 1.6E-05   24.0  -0.3   30   13-52     35-64  (90)
 90 smart00734 ZnF_Rad18 Rad18-lik  75.4     2.1 4.6E-05   16.8   1.1   18   43-61      3-20  (26)
 91 smart00614 ZnF_BED BED zinc fi  75.4     2.9 6.2E-05   19.0   1.7   21   42-62     19-44  (50)
 92 PF13451 zf-trcl:  Probable zin  74.6     2.3   5E-05   19.6   1.2   37   12-48      3-40  (49)
 93 PF05443 ROS_MUCR:  ROS/MUCR tr  74.1     2.3 5.1E-05   23.8   1.4   26   41-69     72-97  (132)
 94 PF02892 zf-BED:  BED zinc fing  73.8     3.4 7.4E-05   18.1   1.7   14   12-25     15-28  (45)
 95 KOG2231|consensus               73.1     2.3 4.9E-05   30.2   1.4   30   42-75    183-212 (669)
 96 PF04959 ARS2:  Arsenite-resist  73.1     1.3 2.9E-05   26.9   0.3   27   39-65     75-101 (214)
 97 PRK03976 rpl37ae 50S ribosomal  73.0     1.3 2.7E-05   23.2   0.2   30   13-52     36-65  (90)
 98 PF08274 PhnA_Zn_Ribbon:  PhnA   72.1     1.8 3.9E-05   17.8   0.5   24   15-49      4-27  (30)
 99 PRK03824 hypA hydrogenase nick  71.4     1.7 3.6E-05   24.4   0.4   14   13-26     70-83  (135)
100 PF07754 DUF1610:  Domain of un  71.4     2.1 4.5E-05   16.6   0.6   10   40-49     15-24  (24)
101 KOG2482|consensus               71.0     3.4 7.3E-05   27.1   1.7   29   42-70    196-226 (423)
102 COG1571 Predicted DNA-binding   70.2     3.3 7.2E-05   27.8   1.7   32   14-56    351-382 (421)
103 PF05191 ADK_lid:  Adenylate ki  69.5     1.8 3.9E-05   18.5   0.2    9   15-23      3-11  (36)
104 KOG4167|consensus               69.4       1 2.3E-05   32.2  -0.8   25   41-65    792-816 (907)
105 PF15269 zf-C2H2_7:  Zinc-finge  69.4     3.1 6.7E-05   18.8   1.0   22   42-63     21-42  (54)
106 COG4530 Uncharacterized protei  68.8     2.1 4.5E-05   23.2   0.4   28   15-53     11-38  (129)
107 KOG2785|consensus               67.5     9.9 0.00022   25.3   3.3   53   12-64    165-243 (390)
108 COG3091 SprT Zn-dependent meta  67.3     4.1 8.8E-05   23.5   1.4   34   40-78    116-149 (156)
109 smart00661 RPOL9 RNA polymeras  67.2     5.8 0.00013   17.9   1.8   32   15-54      2-33  (52)
110 KOG3507|consensus               66.9     4.3 9.3E-05   19.4   1.2   29   13-52     20-48  (62)
111 smart00440 ZnF_C2C2 C2C2 Zinc   66.6    0.89 1.9E-05   19.9  -1.0   11   41-51     28-38  (40)
112 PF07282 OrfB_Zn_ribbon:  Putat  66.3     5.4 0.00012   19.3   1.6   14   39-52     44-57  (69)
113 PRK00432 30S ribosomal protein  66.0     3.8 8.2E-05   18.9   1.0   12   40-51     36-47  (50)
114 PF13453 zf-TFIIB:  Transcripti  65.9     3.7 7.9E-05   17.8   0.9   21   39-59     17-37  (41)
115 KOG2593|consensus               65.8       7 0.00015   26.4   2.4   42   39-83    126-167 (436)
116 TIGR00100 hypA hydrogenase nic  65.5     2.9 6.4E-05   22.8   0.6   11   14-24     71-81  (115)
117 TIGR01206 lysW lysine biosynth  65.3     2.6 5.7E-05   19.8   0.3   31   14-52      3-33  (54)
118 PLN02294 cytochrome c oxidase   65.2     3.6 7.8E-05   24.1   1.0   15   11-25    139-153 (174)
119 PF09723 Zn-ribbon_8:  Zinc rib  64.4     3.2   7E-05   18.2   0.5   29   42-77      6-34  (42)
120 KOG3408|consensus               64.4     4.7  0.0001   22.3   1.3   23   12-34     56-78  (129)
121 PF10013 DUF2256:  Uncharacteri  63.9     4.8  0.0001   17.9   1.0   12   15-26     10-21  (42)
122 COG4888 Uncharacterized Zn rib  63.7     2.3 4.9E-05   22.7  -0.0   40   11-54     20-59  (104)
123 PF13878 zf-C2H2_3:  zinc-finge  63.7     5.7 0.00012   17.4   1.3   23   42-64     14-38  (41)
124 COG4957 Predicted transcriptio  63.6       4 8.8E-05   23.0   0.9   25   14-41     77-101 (148)
125 COG3677 Transposase and inacti  62.0     2.6 5.7E-05   23.5   0.0   35   15-54     32-66  (129)
126 KOG2593|consensus               60.3     6.5 0.00014   26.5   1.6   40    8-50    123-162 (436)
127 PF13240 zinc_ribbon_2:  zinc-r  60.2     4.4 9.5E-05   15.4   0.5    6   44-49     16-21  (23)
128 PRK12380 hydrogenase nickel in  59.9     4.5 9.9E-05   22.0   0.7   10   14-23     71-80  (113)
129 PF09845 DUF2072:  Zn-ribbon co  59.8     5.3 0.00011   22.4   1.0   15   13-27      1-15  (131)
130 PF02176 zf-TRAF:  TRAF-type zi  59.7     6.6 0.00014   18.3   1.2   39   12-51      8-52  (60)
131 PF04810 zf-Sec23_Sec24:  Sec23  59.4     7.3 0.00016   16.9   1.2   32   13-50      2-33  (40)
132 KOG1146|consensus               59.0     3.8 8.2E-05   31.5   0.4   52   11-63   1282-1350(1406)
133 KOG2907|consensus               58.1     8.6 0.00019   21.0   1.5   12   42-53    103-114 (116)
134 KOG0978|consensus               57.2     4.5 9.7E-05   29.0   0.5   22   39-60    676-697 (698)
135 TIGR00622 ssl1 transcription f  57.1      11 0.00025   20.5   1.9   19   13-31     15-33  (112)
136 COG0068 HypF Hydrogenase matur  57.0     2.8 6.1E-05   30.0  -0.5   57   16-79    126-183 (750)
137 COG1327 Predicted transcriptio  56.7     3.1 6.8E-05   23.9  -0.2   15   41-55     28-42  (156)
138 PRK00564 hypA hydrogenase nick  56.5     5.6 0.00012   21.7   0.7   11   14-24     72-82  (117)
139 PF03811 Zn_Tnp_IS1:  InsA N-te  55.9     3.6 7.7E-05   17.6  -0.1   30   14-47      6-35  (36)
140 PF11672 DUF3268:  Protein of u  55.3     7.3 0.00016   20.9   1.0   37   12-49      1-39  (102)
141 KOG4167|consensus               54.5       2 4.3E-05   30.9  -1.5   26   12-37    791-816 (907)
142 COG1326 Uncharacterized archae  54.4      18  0.0004   21.8   2.6   35   13-51      6-40  (201)
143 smart00154 ZnF_AN1 AN1-like Zi  53.6     6.5 0.00014   17.0   0.6   15   13-27     12-26  (39)
144 COG2331 Uncharacterized protei  53.5     3.5 7.5E-05   20.9  -0.4   31   13-50     12-42  (82)
145 PF01428 zf-AN1:  AN1-like Zinc  53.2     5.5 0.00012   17.5   0.3   15   40-54     12-26  (43)
146 TIGR00686 phnA alkylphosphonat  51.3      10 0.00022   20.6   1.1   29   15-54      4-32  (109)
147 PRK03681 hypA hydrogenase nick  51.2     8.5 0.00018   20.9   0.9   10   14-23     71-80  (114)
148 COG1655 Uncharacterized protei  50.4     4.5 9.8E-05   25.0  -0.3   40   11-50     17-71  (267)
149 KOG2807|consensus               50.4      26 0.00057   23.0   3.0   18   13-30    290-307 (378)
150 smart00731 SprT SprT homologue  50.3      13 0.00028   21.0   1.6   11   41-51    112-122 (146)
151 PF10263 SprT-like:  SprT-like   50.1     6.8 0.00015   22.1   0.4   10   42-51    124-133 (157)
152 KOG2071|consensus               49.8     9.7 0.00021   26.8   1.2   28   39-66    416-443 (579)
153 PRK10220 hypothetical protein;  49.4      14  0.0003   20.1   1.5   29   15-54      5-33  (111)
154 PF14446 Prok-RING_1:  Prokaryo  49.2      17 0.00037   17.1   1.6   26   14-51      6-31  (54)
155 PF10276 zf-CHCC:  Zinc-finger   48.2       9  0.0002   16.8   0.6   12   40-51     28-39  (40)
156 PF01155 HypA:  Hydrogenase exp  48.1     6.1 0.00013   21.4   0.0   11   14-24     71-81  (113)
157 PF04423 Rad50_zn_hook:  Rad50   46.6     6.9 0.00015   18.1   0.1   13   15-27     22-34  (54)
158 PHA02998 RNA polymerase subuni  46.4     4.8  0.0001   23.9  -0.6   38   13-54    143-184 (195)
159 PF08790 zf-LYAR:  LYAR-type C2  46.3     3.5 7.5E-05   16.6  -0.8    8   16-23      3-10  (28)
160 KOG1842|consensus               46.2     8.4 0.00018   26.2   0.4   26   40-65     14-39  (505)
161 PF12760 Zn_Tnp_IS1595:  Transp  45.6     6.2 0.00014   17.6  -0.1    9   40-48     36-44  (46)
162 KOG2636|consensus               45.2      18 0.00039   24.7   1.8   26    8-33    396-422 (497)
163 PF14311 DUF4379:  Domain of un  45.0      19 0.00041   16.6   1.5   13   42-54     29-41  (55)
164 PTZ00043 cytochrome c oxidase   44.9      11 0.00023   23.4   0.7   16   10-25    178-193 (268)
165 COG1198 PriA Primosomal protei  44.6      15 0.00032   26.8   1.4   11   40-50    474-484 (730)
166 COG1773 Rubredoxin [Energy pro  44.4      10 0.00022   17.9   0.5   15   13-27      3-17  (55)
167 PRK05452 anaerobic nitric oxid  43.7     7.4 0.00016   26.6  -0.1   16   11-26    423-438 (479)
168 PF04780 DUF629:  Protein of un  43.6      17 0.00037   25.0   1.6   27   40-66     56-83  (466)
169 PF07295 DUF1451:  Protein of u  43.6      10 0.00022   21.7   0.5   29   12-50    111-139 (146)
170 TIGR00627 tfb4 transcription f  43.3      21 0.00046   22.8   1.9   11   42-52    256-266 (279)
171 TIGR00416 sms DNA repair prote  43.1      19  0.0004   24.6   1.7   23   13-49      7-29  (454)
172 PF01096 TFIIS_C:  Transcriptio  42.5    0.76 1.6E-05   20.0  -3.3   10   42-51     29-38  (39)
173 PF14803 Nudix_N_2:  Nudix N-te  42.0     6.1 0.00013   16.6  -0.4   11   40-50     21-31  (34)
174 PRK11823 DNA repair protein Ra  41.7      19 0.00042   24.4   1.6   24   12-49      6-29  (446)
175 PRK04351 hypothetical protein;  41.6      17 0.00038   20.8   1.2   31   41-79    112-142 (149)
176 PF08209 Sgf11:  Sgf11 (transcr  41.5      31 0.00068   14.4   1.7   22   41-63      4-25  (33)
177 PRK12496 hypothetical protein;  41.1      15 0.00033   21.3   1.0   11   42-52    128-138 (164)
178 COG0675 Transposase and inacti  40.8      18 0.00039   22.9   1.3   16   39-54    320-335 (364)
179 PRK14892 putative transcriptio  40.7      13 0.00027   19.9   0.5   35   12-53     20-54  (99)
180 KOG0717|consensus               40.5      16 0.00036   25.1   1.1   22   42-63    293-314 (508)
181 PF01215 COX5B:  Cytochrome c o  40.3     9.1  0.0002   21.7  -0.1   14   12-25    111-124 (136)
182 PF07975 C1_4:  TFIIH C1-like d  40.2      10 0.00022   17.6   0.1   23   12-34     20-42  (51)
183 COG4391 Uncharacterized protei  38.9      10 0.00022   18.3   0.0   45    4-52     15-59  (62)
184 PF01927 Mut7-C:  Mut7-C RNAse   38.7      29 0.00062   19.7   1.8   46   14-59     92-142 (147)
185 PRK00762 hypA hydrogenase nick  38.6      15 0.00033   20.3   0.7   10   14-24     71-80  (124)
186 TIGR00595 priA primosomal prot  38.4      21 0.00046   24.7   1.4   10   40-49    252-261 (505)
187 PF01363 FYVE:  FYVE zinc finge  38.2      22 0.00048   17.0   1.2   28   14-53     10-37  (69)
188 COG1998 RPS31 Ribosomal protei  37.0      24 0.00052   16.3   1.1   10   41-50     37-46  (51)
189 PRK06260 threonine synthase; V  36.4      24 0.00053   23.5   1.5   27   14-52      4-30  (397)
190 PRK14873 primosome assembly pr  36.1      24 0.00051   25.5   1.4   10   40-49    421-430 (665)
191 PF06397 Desulfoferrod_N:  Desu  35.4      18 0.00039   15.5   0.5   12   12-23      5-16  (36)
192 PRK05978 hypothetical protein;  34.7      23 0.00049   20.4   1.0   10   43-52     54-63  (148)
193 KOG1280|consensus               34.7      44 0.00096   22.2   2.3   37   12-48     78-116 (381)
194 smart00064 FYVE Protein presen  34.6      30 0.00064   16.5   1.3   28   14-53     11-38  (68)
195 KOG1088|consensus               33.7      22 0.00049   19.6   0.8   20    8-27     93-112 (124)
196 cd00730 rubredoxin Rubredoxin;  33.3      17 0.00037   16.7   0.3   13   42-54      2-14  (50)
197 PF04606 Ogr_Delta:  Ogr/Delta-  33.0     8.9 0.00019   17.2  -0.7   38   15-54      1-40  (47)
198 PF05180 zf-DNL:  DNL zinc fing  32.9     2.9 6.3E-05   20.5  -2.4   42   13-57      4-45  (66)
199 COG1579 Zn-ribbon protein, pos  32.5      33 0.00071   21.5   1.5   32   15-50    199-230 (239)
200 PF00130 C1_1:  Phorbol esters/  32.1      44 0.00094   15.0   1.6   30   11-51      9-38  (53)
201 COG1675 TFA1 Transcription ini  32.0      29 0.00063   20.6   1.2    8   42-49    133-140 (176)
202 PF00301 Rubredoxin:  Rubredoxi  32.0      19 0.00041   16.4   0.3   36   14-50      2-43  (47)
203 PF07800 DUF1644:  Protein of u  31.9      55  0.0012   19.2   2.2   56   13-70     80-138 (162)
204 PLN03238 probable histone acet  31.8      49  0.0011   21.3   2.2   27   39-65     46-72  (290)
205 cd00924 Cyt_c_Oxidase_Vb Cytoc  31.7      24 0.00052   18.7   0.7   20   33-53     72-91  (97)
206 PF10537 WAC_Acf1_DNA_bd:  ATP-  31.5      90   0.002   16.7   3.0   38   12-50      2-39  (102)
207 cd01121 Sms Sms (bacterial rad  30.9      32 0.00068   22.9   1.3    9   14-22      1-9   (372)
208 PTZ00448 hypothetical protein;  30.7      31 0.00067   23.0   1.2   23   41-63    314-336 (373)
209 KOG2857|consensus               30.2      24 0.00052   20.2   0.6   23   40-62     16-38  (157)
210 PF08792 A2L_zn_ribbon:  A2L zi  30.1      27 0.00058   14.5   0.6   12   13-24     21-32  (33)
211 COG5109 Uncharacterized conser  30.1      37 0.00081   22.3   1.4   42    9-53    347-388 (396)
212 COG1779 C4-type Zn-finger prot  30.0      13 0.00029   22.4  -0.4   40   13-54     14-56  (201)
213 PHA02942 putative transposase;  29.9      36 0.00079   22.7   1.5   14   39-52    340-353 (383)
214 KOG0696|consensus               29.9      26 0.00056   24.2   0.8   58   11-77     71-129 (683)
215 PF12773 DZR:  Double zinc ribb  29.7      39 0.00085   15.0   1.2   11   40-50     28-38  (50)
216 COG5236 Uncharacterized conser  29.6      30 0.00065   23.0   1.0   33   43-76    222-254 (493)
217 PF11789 zf-Nse:  Zinc-finger o  29.6      36 0.00077   16.0   1.0   16   40-55     23-38  (57)
218 COG5112 UFD2 U1-like Zn-finger  29.5      22 0.00048   19.3   0.4   23   12-34     54-76  (126)
219 KOG3362|consensus               28.5      14 0.00031   21.1  -0.5   22   41-62    129-150 (156)
220 COG1594 RPB9 DNA-directed RNA   28.0      16 0.00035   19.9  -0.3   11   42-52    101-111 (113)
221 KOG1813|consensus               28.0      40 0.00086   21.9   1.3   15   40-54    240-254 (313)
222 PF05207 zf-CSL:  CSL zinc fing  27.2      28  0.0006   16.3   0.4   31   13-49     18-48  (55)
223 KOG2231|consensus               26.9      73  0.0016   23.2   2.5   47   15-65    184-236 (669)
224 COG5152 Uncharacterized conser  26.5      32  0.0007   20.9   0.7   15   40-54    195-209 (259)
225 COG5188 PRP9 Splicing factor 3  26.5      51  0.0011   22.1   1.6   26    8-33    369-395 (470)
226 PF14369 zf-RING_3:  zinc-finge  26.2      32  0.0007   14.4   0.5   10   15-24     23-32  (35)
227 PF09963 DUF2197:  Uncharacteri  26.0      44 0.00095   15.9   1.0   37   14-51      3-41  (56)
228 PRK04023 DNA polymerase II lar  25.9      74  0.0016   24.5   2.4    9   14-22    627-635 (1121)
229 PF12907 zf-met2:  Zinc-binding  25.9      25 0.00055   15.4   0.2   20   43-62      3-25  (40)
230 KOG3352|consensus               25.9      30 0.00066   20.0   0.5   13   12-24    132-144 (153)
231 COG4896 Uncharacterized protei  25.6      62  0.0013   15.7   1.4   40   14-53      3-43  (68)
232 TIGR00515 accD acetyl-CoA carb  25.6      45 0.00097   21.4   1.3   31   14-53     27-57  (285)
233 PRK06450 threonine synthase; V  25.5      54  0.0012   21.4   1.7   26   14-52      4-29  (338)
234 PF13824 zf-Mss51:  Zinc-finger  25.5      48   0.001   15.7   1.1   13   11-23     12-24  (55)
235 PLN02748 tRNA dimethylallyltra  25.4      63  0.0014   22.4   2.0   24   12-35    417-441 (468)
236 PF10071 DUF2310:  Zn-ribbon-co  25.4      35 0.00076   21.6   0.7   27   15-48    222-248 (258)
237 PRK07591 threonine synthase; V  25.2      48   0.001   22.4   1.4   28   13-53     18-45  (421)
238 PRK08222 hydrogenase 4 subunit  24.6      62  0.0013   19.1   1.6   19   12-30    113-131 (181)
239 PF02891 zf-MIZ:  MIZ/SP-RING z  24.3      29 0.00064   15.8   0.2   10   40-49     40-49  (50)
240 COG1379 PHP family phosphoeste  24.2      30 0.00064   22.9   0.3   12   41-52    265-276 (403)
241 PF01286 XPA_N:  XPA protein N-  24.2      33 0.00072   14.4   0.4   13   14-26      4-16  (34)
242 KOG0402|consensus               24.2      23  0.0005   18.3  -0.2   12   40-51     53-64  (92)
243 PRK05580 primosome assembly pr  24.1      52  0.0011   23.8   1.5   11   40-50    420-430 (679)
244 CHL00174 accD acetyl-CoA carbo  24.1      25 0.00054   22.7  -0.0   32   14-54     39-70  (296)
245 COG1066 Sms Predicted ATP-depe  24.1      47   0.001   22.8   1.2   13   12-24      6-18  (456)
246 PF12230 PRP21_like_P:  Pre-mRN  24.0      26 0.00056   21.4   0.0   31   40-71    167-197 (229)
247 KOG4727|consensus               24.0      49  0.0011   19.7   1.1   22   13-34     75-96  (193)
248 TIGR00244 transcriptional regu  23.7      38 0.00082   19.5   0.6   17   13-29     28-44  (147)
249 TIGR00319 desulf_FeS4 desulfof  23.7      40 0.00086   13.8   0.6   12   12-23      6-17  (34)
250 PLN00104 MYST -like histone ac  23.7      59  0.0013   22.4   1.6   25   40-64    197-221 (450)
251 PRK12722 transcriptional activ  23.5      54  0.0012   19.7   1.2   32   40-79    133-164 (187)
252 PRK00420 hypothetical protein;  23.3      61  0.0013   17.8   1.3   13   41-53     40-52  (112)
253 PF14205 Cys_rich_KTR:  Cystein  23.3      36 0.00078   16.1   0.4   10   13-22      4-13  (55)
254 PRK12860 transcriptional activ  23.0      54  0.0012   19.8   1.2   49   23-80    117-165 (189)
255 KOG1994|consensus               23.0      66  0.0014   20.1   1.5   21   40-60    238-258 (268)
256 PF05741 zf-nanos:  Nanos RNA b  22.9      30 0.00064   16.4   0.1   11   12-22     32-42  (55)
257 COG4338 Uncharacterized protei  22.8      25 0.00054   16.1  -0.2   11   43-53     14-24  (54)
258 cd00974 DSRD Desulforedoxin (D  22.7      42 0.00092   13.7   0.5   11   13-23      4-14  (34)
259 PF14690 zf-ISL3:  zinc-finger   22.6      50  0.0011   14.3   0.8   10   13-22      2-11  (47)
260 TIGR03831 YgiT_finger YgiT-typ  22.5      40 0.00087   14.4   0.5   14   40-53     31-44  (46)
261 TIGR01384 TFS_arch transcripti  22.5      15 0.00032   19.4  -1.1    8   42-49     63-70  (104)
262 PF02318 FYVE_2:  FYVE-type zin  22.5      49  0.0011   18.0   0.9   12   13-24     54-65  (118)
263 PF14255 Cys_rich_CPXG:  Cystei  22.1      36 0.00077   15.9   0.3   10   43-52      2-11  (52)
264 TIGR01385 TFSII transcription   22.0      24 0.00053   22.7  -0.4   10   42-51    287-296 (299)
265 smart00647 IBR In Between Ring  22.0      55  0.0012   15.0   0.9   17   38-54     37-53  (64)
266 COG5151 SSL1 RNA polymerase II  21.9      38 0.00083   22.2   0.5   24   41-64    388-411 (421)
267 COG0846 SIR2 NAD-dependent pro  21.7      62  0.0013   20.4   1.3   38    8-49    117-154 (250)
268 PF06524 NOA36:  NOA36 protein;  21.7      21 0.00046   22.7  -0.7   18   40-57    208-225 (314)
269 PF14787 zf-CCHC_5:  GAG-polypr  21.7      54  0.0012   14.0   0.8   11   15-25      4-14  (36)
270 PTZ00064 histone acetyltransfe  21.7      75  0.0016   22.4   1.8   25   40-64    279-303 (552)
271 cd01410 SIRT7 SIRT7: Eukaryoti  21.6 1.2E+02  0.0026   18.3   2.5   39    8-49     90-128 (206)
272 PF11023 DUF2614:  Protein of u  21.2      74  0.0016   17.5   1.4   10   13-22     69-78  (114)
273 PF08271 TF_Zn_Ribbon:  TFIIB z  20.9      57  0.0012   14.1   0.8   29   14-51      1-29  (43)
274 PF06170 DUF983:  Protein of un  20.8      47   0.001   17.2   0.6   12   43-54     10-21  (86)
275 PF06220 zf-U1:  U1 zinc finger  20.7      94   0.002   13.2   1.5   12   13-24      3-14  (38)
276 PF09297 zf-NADH-PPase:  NADH p  20.6      42 0.00091   13.5   0.3   11   39-49     19-29  (32)
277 COG2051 RPS27A Ribosomal prote  20.2      46 0.00099   16.4   0.4   14   40-53     37-50  (67)
278 PRK05654 acetyl-CoA carboxylas  20.1      32  0.0007   22.1  -0.1   31   14-53     28-58  (292)
279 PRK00415 rps27e 30S ribosomal   20.1      66  0.0014   15.5   1.0   15   40-54     29-43  (59)

No 1  
>KOG2462|consensus
Probab=99.91  E-value=8.4e-26  Score=134.73  Aligned_cols=89  Identities=33%  Similarity=0.456  Sum_probs=83.5

Q ss_pred             CeehhhhhcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccCCCcchhhhcccccc
Q psy16685          1 MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPV   80 (99)
Q Consensus         1 l~~h~~~h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~   80 (99)
                      |.+|+|+|+  -|+.|.+||+.|..+..|+.|+++|+|+|||.|+.|+++|...++|+.|+++|.++|+|.|..|+..+.
T Consensus       177 LkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFs  254 (279)
T KOG2462|consen  177 LKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFA  254 (279)
T ss_pred             HhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHH
Confidence            578999988  488999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCcchhhhhh
Q psy16685         81 SGSNDEKNLNK   91 (99)
Q Consensus        81 ~~~~~~~~~~~   91 (99)
                      .-+.+++|...
T Consensus       255 l~SyLnKH~ES  265 (279)
T KOG2462|consen  255 LKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHhhhh
Confidence            88888888754


No 2  
>KOG2462|consensus
Probab=99.80  E-value=1.3e-20  Score=112.66  Aligned_cols=95  Identities=24%  Similarity=0.291  Sum_probs=85.9

Q ss_pred             CeehhhhhcC---CCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccCCCcchhhhccc
Q psy16685          1 MIYILRVLIS---EKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNL   77 (99)
Q Consensus         1 l~~h~~~h~~---~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~   77 (99)
                      |.+|+.+|-.   .+.+.|..|++.|.+-..|+.|+++|+  -+.+|..||+.|.++.-|+.|+|+|+|||||.|..|+.
T Consensus       146 LsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~k  223 (279)
T KOG2462|consen  146 LSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGK  223 (279)
T ss_pred             cchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccc
Confidence            5677777653   466889999999999999999999987  57999999999999999999999999999999999999


Q ss_pred             cccCCCcchhhhhhhhhhhc
Q psy16685         78 EPVSGSNDEKNLNKFNIVKA   97 (99)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~   97 (99)
                      .+.+.+++..||.+...++.
T Consensus       224 AFADRSNLRAHmQTHS~~K~  243 (279)
T KOG2462|consen  224 AFADRSNLRAHMQTHSDVKK  243 (279)
T ss_pred             hhcchHHHHHHHHhhcCCcc
Confidence            99999999999999887664


No 3  
>KOG3576|consensus
Probab=99.59  E-value=1.2e-16  Score=92.53  Aligned_cols=87  Identities=30%  Similarity=0.436  Sum_probs=67.6

Q ss_pred             CCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccCCCcchhhhccccccCCCcchhhhh
Q psy16685         11 EKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSNDEKNLN   90 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~   90 (99)
                      ...+.|.+|++.|...-.|.+|++.|...+.+.|..||+.|...-.|++|+++|+|.+||.|..|...+...-.++.|+.
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            34577888888887777777888888777778888888888877778888888888888888888888877777788877


Q ss_pred             hhhhhhc
Q psy16685         91 KFNIVKA   97 (99)
Q Consensus        91 ~~~~~~~   97 (99)
                      +++.+..
T Consensus       195 kvhgv~~  201 (267)
T KOG3576|consen  195 KVHGVQH  201 (267)
T ss_pred             HHcCchH
Confidence            7776543


No 4  
>KOG3623|consensus
Probab=99.59  E-value=3.3e-16  Score=104.12  Aligned_cols=81  Identities=26%  Similarity=0.404  Sum_probs=71.3

Q ss_pred             CCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccCCCcchhhhccccccCCCcchhhh
Q psy16685         10 SEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSNDEKNL   89 (99)
Q Consensus        10 ~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~   89 (99)
                      ...+|.|++|.++|...+.|.+|..-|+|.+||+|.+|.++|..+-.|..|+|+|.|||||.|.+|+..+.-...-..||
T Consensus       891 e~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  891 EDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             ccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            34589999999999999999999999999999999999999999999999999999999999999998876655555555


Q ss_pred             h
Q psy16685         90 N   90 (99)
Q Consensus        90 ~   90 (99)
                      +
T Consensus       971 N  971 (1007)
T KOG3623|consen  971 N  971 (1007)
T ss_pred             c
Confidence            4


No 5  
>KOG3576|consensus
Probab=99.54  E-value=5.8e-16  Score=89.72  Aligned_cols=92  Identities=25%  Similarity=0.378  Sum_probs=79.1

Q ss_pred             CeehhhhhcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhcc-----------CCCc
Q psy16685          1 MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHI-----------KVND   69 (99)
Q Consensus         1 l~~h~~~h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-----------~~~~   69 (99)
                      |.+|+..|...+.|.|..||+.|...-.|++|+++|+|.+||+|..|+++|.....|..|.+.-+           .++-
T Consensus       133 lnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl  212 (267)
T KOG3576|consen  133 LNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKL  212 (267)
T ss_pred             HHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhhe
Confidence            57899999999999999999999999999999999999999999999999999999999987433           3677


Q ss_pred             chhhhccccccCCCcchhhhhhh
Q psy16685         70 DFKEILNLEPVSGSNDEKNLNKF   92 (99)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~~   92 (99)
                      |.|+-|+...........|+...
T Consensus       213 ~vcedcg~t~~~~e~~~~h~~~~  235 (267)
T KOG3576|consen  213 YVCEDCGYTSERPEVYYLHLKLH  235 (267)
T ss_pred             eeecccCCCCCChhHHHHHHHhc
Confidence            88899988776666555555433


No 6  
>KOG3623|consensus
Probab=99.47  E-value=1e-14  Score=97.20  Aligned_cols=62  Identities=35%  Similarity=0.643  Sum_probs=59.6

Q ss_pred             CeehhhhhcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHH
Q psy16685          1 MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRM   62 (99)
Q Consensus         1 l~~h~~~h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~   62 (99)
                      |.||.=-|+|.+||.|.+|.+.|..+..|..|.+.|.|++||+|..|++.|.....+..||.
T Consensus       910 LaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  910 LARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             HHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            56888889999999999999999999999999999999999999999999999999999988


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.23  E-value=5.5e-12  Score=59.08  Aligned_cols=44  Identities=18%  Similarity=0.324  Sum_probs=38.3

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHH
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLY   58 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~   58 (99)
                      -|.|+.||+.|.....|..|+++|+  ++++|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4789999999999999999999988  6889999999998877664


No 8  
>KOG1074|consensus
Probab=99.22  E-value=1.2e-12  Score=88.38  Aligned_cols=65  Identities=28%  Similarity=0.641  Sum_probs=51.2

Q ss_pred             CeehhhhhcCCCCeecccCcCcCCChHHHHHHhhhcCCCC----ceecc---cccccccCcchHHHHHHhcc
Q psy16685          1 MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEK----PHQCQ---VCGKRFTASSNLYYHRMTHI   65 (99)
Q Consensus         1 l~~h~~~h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~----~~~C~---~C~~~f~~~~~l~~H~~~h~   65 (99)
                      |+.|.|+|+|++||+|.+||+.|.++.+|+.|+.+|....    .+.|+   +|.+.|...-.|..|.++|.
T Consensus       621 LqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~  692 (958)
T KOG1074|consen  621 LQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLPQHIRIHL  692 (958)
T ss_pred             hhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccccceEEeec
Confidence            5678888888888888888888888888888888776543    35677   78888888888888888876


No 9  
>KOG3608|consensus
Probab=99.18  E-value=5.6e-12  Score=78.60  Aligned_cols=93  Identities=22%  Similarity=0.256  Sum_probs=73.8

Q ss_pred             CeehhhhhcCCCCeecccCcCcCCChHHHHHHhhhcCC--CCc--------------------------eeccccccccc
Q psy16685          1 MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSG--EKP--------------------------HQCQVCGKRFT   52 (99)
Q Consensus         1 l~~h~~~h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~--~~~--------------------------~~C~~C~~~f~   52 (99)
                      |.+|.|.|++++...|+.||..|.+++.|..|.+..+.  ..+                          |+|+.|+.+..
T Consensus       195 LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~  274 (467)
T KOG3608|consen  195 LREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCS  274 (467)
T ss_pred             HHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCC
Confidence            56899999999999999999999999888888765433  123                          56777777777


Q ss_pred             CcchHHHHHHh-ccCCCcchhhhccccccCCCcchhhhhhhh
Q psy16685         53 ASSNLYYHRMT-HIKVNDDFKEILNLEPVSGSNDEKNLNKFN   93 (99)
Q Consensus        53 ~~~~l~~H~~~-h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   93 (99)
                      ..+.|..|++. |...+|+.|.-|.......+++.+|.+..+
T Consensus       275 ~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  275 SASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             ChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            77778888774 678899999999988888888888887554


No 10 
>PHA00733 hypothetical protein
Probab=99.15  E-value=4.3e-11  Score=66.04  Aligned_cols=81  Identities=15%  Similarity=0.128  Sum_probs=49.7

Q ss_pred             CCCeecccCcCcCCChHHHHHH--hh---hcCCCCceecccccccccCcchHHHHHHhccCCCcchhhhccccccCCCcc
Q psy16685         11 EKPHVCSVCSKGFSTSSSLNTH--RR---IHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSND   85 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~~~l~~h--~~---~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~   85 (99)
                      .+++.|.+|...|..+..+..+  +.   ...+.+||.|+.|++.|.....|..|++.+  +.++.|..|+..+.....+
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            3456677776666665544433  11   122356777777777777777777777655  3456777777777666666


Q ss_pred             hhhhhhhh
Q psy16685         86 EKNLNKFN   93 (99)
Q Consensus        86 ~~~~~~~~   93 (99)
                      ..|+.+.+
T Consensus       116 ~~H~~~~h  123 (128)
T PHA00733        116 LDHVCKKH  123 (128)
T ss_pred             HHHHHHhc
Confidence            66665544


No 11 
>KOG1074|consensus
Probab=99.12  E-value=2.5e-11  Score=82.27  Aligned_cols=61  Identities=43%  Similarity=0.762  Sum_probs=57.6

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccCCCcchhh
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKE   73 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~   73 (99)
                      ...|..|++.|.....|+.|+++|++.+||.|..|++.|....+|+.||.+|+|..+..-.
T Consensus       879 ~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~srr  939 (958)
T KOG1074|consen  879 AHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPSRR  939 (958)
T ss_pred             hhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCccC
Confidence            4679999999999999999999999999999999999999999999999999998887655


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.05  E-value=2.6e-11  Score=49.07  Aligned_cols=24  Identities=38%  Similarity=0.664  Sum_probs=16.6

Q ss_pred             CeehhhhhcCCCCeecccCcCcCC
Q psy16685          1 MIYILRVLISEKPHVCSVCSKGFS   24 (99)
Q Consensus         1 l~~h~~~h~~~~~~~C~~c~~~~~   24 (99)
                      |.+|+++|++++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            456777777777777777776664


No 13 
>PHA00733 hypothetical protein
Probab=98.98  E-value=8.7e-11  Score=64.81  Aligned_cols=61  Identities=33%  Similarity=0.567  Sum_probs=51.5

Q ss_pred             ehhhhhcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccC
Q psy16685          3 YILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIK   66 (99)
Q Consensus         3 ~h~~~h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~   66 (99)
                      +|+.+ .+.+||.|+.|++.|.....|..|++.+  ..++.|..|++.|.....|..|+...++
T Consensus        64 ~~~~~-~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         64 KLLTS-KAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             hhccc-CCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            34333 4588999999999999999999999876  3579999999999999999999886553


No 14 
>KOG3608|consensus
Probab=98.92  E-value=6.1e-10  Score=69.72  Aligned_cols=94  Identities=19%  Similarity=0.191  Sum_probs=71.1

Q ss_pred             Ceehhhh-hcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceeccc--ccccccCcchHHHHHHhcc-C--CCcchhhh
Q psy16685          1 MIYILRV-LISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQV--CGKRFTASSNLYYHRMTHI-K--VNDDFKEI   74 (99)
Q Consensus         1 l~~h~~~-h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-~--~~~~~~~~   74 (99)
                      |.+|++. |...+|++|+.|...+...+.|..|..+|. ...|.|..  |...|.....+.+|++-++ |  +-+|.|..
T Consensus       279 L~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~  357 (467)
T KOG3608|consen  279 LTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHC  357 (467)
T ss_pred             HHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeec
Confidence            3456665 667788888888888888888888877776 45678865  8888888888888877543 3  46788888


Q ss_pred             ccccccCCCcchhhhhhhhhh
Q psy16685         75 LNLEPVSGSNDEKNLNKFNIV   95 (99)
Q Consensus        75 ~~~~~~~~~~~~~~~~~~~~~   95 (99)
                      |...+.++.++..|+.+.+..
T Consensus       358 Cdr~ft~G~~L~~HL~kkH~f  378 (467)
T KOG3608|consen  358 CDRFFTSGKSLSAHLMKKHGF  378 (467)
T ss_pred             chhhhccchhHHHHHHHhhcc
Confidence            888888888888888877643


No 15 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.89  E-value=1.5e-09  Score=43.83  Aligned_cols=26  Identities=50%  Similarity=1.034  Sum_probs=22.1

Q ss_pred             HHHHHhhhcCCCCceecccccccccC
Q psy16685         28 SLNTHRRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus        28 ~l~~h~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      +|..|+++|++++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            46789999999999999999988853


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.87  E-value=1.3e-09  Score=51.08  Aligned_cols=42  Identities=12%  Similarity=0.216  Sum_probs=36.8

Q ss_pred             ceecccccccccCcchHHHHHHhccCCCcchhhhccccccCCCc
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSN   84 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~   84 (99)
                      .|+|+.||+.|...++|..|+++|+  +++.|..|+..+...+.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~   46 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGE   46 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccce
Confidence            4899999999999999999999999  68899999987765544


No 17 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.81  E-value=4.7e-09  Score=69.77  Aligned_cols=63  Identities=14%  Similarity=0.249  Sum_probs=29.7

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccC----------cchHHHHHHhccCCCcchhhhccc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTA----------SSNLYYHRMTHIKVNDDFKEILNL   77 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~----------~~~l~~H~~~h~~~~~~~~~~~~~   77 (99)
                      .|+.|+ ||..+ ....|..|+.++...+++.|..|+..|..          ...|..|.... +.++..|..|+.
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk  549 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGR  549 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCC
Confidence            345555 55332 33445555555555555555555554421          12445554442 455555555543


No 18 
>PHA00616 hypothetical protein
Probab=98.70  E-value=5.4e-09  Score=46.84  Aligned_cols=33  Identities=12%  Similarity=0.108  Sum_probs=20.9

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQ   45 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~   45 (99)
                      ||.|..||+.|.....+..|++.+++.+++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            456666666666666666666666666666554


No 19 
>PHA00616 hypothetical protein
Probab=98.70  E-value=4.9e-09  Score=46.99  Aligned_cols=34  Identities=26%  Similarity=0.305  Sum_probs=31.3

Q ss_pred             ceecccccccccCcchHHHHHHhccCCCcchhhh
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEI   74 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~   74 (99)
                      ||+|+.||+.|...+.+..|++.|++++++.+..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6899999999999999999999999999988653


No 20 
>PHA00732 hypothetical protein
Probab=98.63  E-value=3.6e-08  Score=50.04  Aligned_cols=46  Identities=28%  Similarity=0.535  Sum_probs=38.0

Q ss_pred             CeecccCcCcCCChHHHHHHhhh-cCCCCceecccccccccCcchHHHHHHhc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRI-HSGEKPHQCQVCGKRFTASSNLYYHRMTH   64 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~-~~~~~~~~C~~C~~~f~~~~~l~~H~~~h   64 (99)
                      ||.|..|++.|.....|..|++. |.   ++.|+.|++.|.   .+..|....
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            68899999999999999999884 54   358999999997   467776543


No 21 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.55  E-value=1.3e-07  Score=63.15  Aligned_cols=68  Identities=15%  Similarity=0.310  Sum_probs=57.3

Q ss_pred             hcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccCCCcchhhhcccccc
Q psy16685          8 LISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPV   80 (99)
Q Consensus         8 h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~   80 (99)
                      ...++.+.|..|+..|. ...+..|...++  +++.|+ |+..+ ....|..|+.+|...++..|..|+....
T Consensus       448 ~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~  515 (567)
T PLN03086        448 EEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQ  515 (567)
T ss_pred             cccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccc
Confidence            34456678999999996 577899999874  789999 99765 6689999999999999999999998764


No 22 
>KOG3993|consensus
Probab=98.33  E-value=2.7e-07  Score=59.26  Aligned_cols=53  Identities=36%  Similarity=0.679  Sum_probs=46.5

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCC--------C-------------------------CceecccccccccCcchHHH
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSG--------E-------------------------KPHQCQVCGKRFTASSNLYY   59 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~--------~-------------------------~~~~C~~C~~~f~~~~~l~~   59 (99)
                      -|.|++|+++|.-..+|..|.++|.-        .                         ..|.|..|++.|.+...|+.
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            58999999999999999999999832        1                         13889999999999999999


Q ss_pred             HHHhcc
Q psy16685         60 HRMTHI   65 (99)
Q Consensus        60 H~~~h~   65 (99)
                      |+.+|.
T Consensus       375 Hqlthq  380 (500)
T KOG3993|consen  375 HQLTHQ  380 (500)
T ss_pred             hHHhhh
Confidence            988876


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.25  E-value=5.7e-07  Score=34.98  Aligned_cols=22  Identities=41%  Similarity=0.803  Sum_probs=13.2

Q ss_pred             eecccccccccCcchHHHHHHh
Q psy16685         42 HQCQVCGKRFTASSNLYYHRMT   63 (99)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~   63 (99)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666554


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.10  E-value=8.8e-06  Score=38.37  Aligned_cols=50  Identities=32%  Similarity=0.489  Sum_probs=38.0

Q ss_pred             CeecccCcCcCCChHHHHHHhhh-cCC-CCceecccccccccCcchHHHHHHhcc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRI-HSG-EKPHQCQVCGKRFTASSNLYYHRMTHI   65 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~-~~~-~~~~~C~~C~~~f~~~~~l~~H~~~h~   65 (99)
                      .|.|+.|++ ..+...|..|... |.. .+.+.|+.|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            478999999 5557789999665 444 35789999998644  48999988754


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.08  E-value=2.1e-06  Score=33.28  Aligned_cols=23  Identities=43%  Similarity=0.836  Sum_probs=20.9

Q ss_pred             eecccCcCcCCChHHHHHHhhhc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIH   36 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~   36 (99)
                      |.|+.|++.|..+..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999998764


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.95  E-value=5.8e-06  Score=32.09  Aligned_cols=23  Identities=48%  Similarity=0.881  Sum_probs=12.1

Q ss_pred             eecccccccccCcchHHHHHHhc
Q psy16685         42 HQCQVCGKRFTASSNLYYHRMTH   64 (99)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~h   64 (99)
                      |.|+.|+..|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45556666666666666665543


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.93  E-value=4.6e-06  Score=33.61  Aligned_cols=24  Identities=42%  Similarity=0.891  Sum_probs=14.1

Q ss_pred             ceecccccccccCcchHHHHHHhc
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMTH   64 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~h   64 (99)
                      ||.|..|+..|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            355666666666666666665544


No 28 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.89  E-value=1.1e-05  Score=37.09  Aligned_cols=34  Identities=26%  Similarity=0.434  Sum_probs=23.4

Q ss_pred             CCCCceecccccccccCcchHHHHHHhccCCCcc
Q psy16685         37 SGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDD   70 (99)
Q Consensus        37 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~   70 (99)
                      .++.|-.|+.|+..+.+..+|++|+++.++.+|.
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS--
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccCC
Confidence            3467889999999999999999999988887764


No 29 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.86  E-value=6.3e-06  Score=51.51  Aligned_cols=52  Identities=37%  Similarity=0.738  Sum_probs=37.9

Q ss_pred             CCCeeccc--CcCcCCChHHHHHHhhhcC-------------------CCCceecccccccccCcchHHHHHH
Q psy16685         11 EKPHVCSV--CSKGFSTSSSLNTHRRIHS-------------------GEKPHQCQVCGKRFTASSNLYYHRM   62 (99)
Q Consensus        11 ~~~~~C~~--c~~~~~~~~~l~~h~~~~~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~   62 (99)
                      ++||.|++  |.+.++....|+-|+.--+                   ..+||.|+.|++.+..-..|+.|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            48888866  8888888877777754211                   1368888888888888888877754


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.80  E-value=1.4e-05  Score=32.11  Aligned_cols=25  Identities=44%  Similarity=0.846  Sum_probs=22.9

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcC
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHS   37 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~   37 (99)
                      ||.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6899999999999999999998764


No 31 
>PHA00732 hypothetical protein
Probab=97.73  E-value=2e-05  Score=40.00  Aligned_cols=37  Identities=19%  Similarity=0.182  Sum_probs=31.6

Q ss_pred             ceecccccccccCcchHHHHHHh-ccCCCcchhhhcccccc
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMT-HIKVNDDFKEILNLEPV   80 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~~~~~~~~~~   80 (99)
                      ||.|..|++.|.+...|..|++. |.+   +.|..|+..+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~   38 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR   38 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC
Confidence            68899999999999999999985 553   57888888776


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.71  E-value=3.5e-05  Score=29.76  Aligned_cols=23  Identities=39%  Similarity=0.846  Sum_probs=19.2

Q ss_pred             eecccCcCcCCChHHHHHHhhhc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIH   36 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~   36 (99)
                      |.|+.|+..|.+...+..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999998875


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.59  E-value=4.8e-05  Score=39.82  Aligned_cols=51  Identities=25%  Similarity=0.551  Sum_probs=21.3

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCC-----------------------CCceecccccccccCcchHHHHHHhcc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSG-----------------------EKPHQCQVCGKRFTASSNLYYHRMTHI   65 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~-----------------------~~~~~C~~C~~~f~~~~~l~~H~~~h~   65 (99)
                      +|..|+..|.....+..|+....+                       ...+.|..|+..|.+...|..|++.+.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             ------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            367777777777777777654322                       124889999999999999999999643


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.55  E-value=8.7e-05  Score=34.18  Aligned_cols=34  Identities=32%  Similarity=0.555  Sum_probs=24.1

Q ss_pred             hcCCCCeecccCcCcCCChHHHHHHhhhcCCCCc
Q psy16685          8 LISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKP   41 (99)
Q Consensus         8 h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~   41 (99)
                      +..+.|..|++|+..+.+..+|.+|+...++.+|
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3456799999999999999999999988777665


No 35 
>PRK04860 hypothetical protein; Provisional
Probab=97.45  E-value=0.0001  Score=42.31  Aligned_cols=35  Identities=11%  Similarity=0.045  Sum_probs=22.5

Q ss_pred             ceecccccccccCcchHHHHHHhccCCCcchhhhccccc
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEP   79 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~   79 (99)
                      +|.|. |+.   ....+.+|.+++.+++++.|..|+...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCcee
Confidence            56665 665   455566777777777777777666543


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.41  E-value=0.0001  Score=28.79  Aligned_cols=21  Identities=43%  Similarity=0.710  Sum_probs=10.6

Q ss_pred             ecccccccccCcchHHHHHHh
Q psy16685         43 QCQVCGKRFTASSNLYYHRMT   63 (99)
Q Consensus        43 ~C~~C~~~f~~~~~l~~H~~~   63 (99)
                      .|..|++.|.....|..|++.
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHH
Confidence            344555555555555555443


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.22  E-value=0.00034  Score=27.20  Aligned_cols=24  Identities=38%  Similarity=0.685  Sum_probs=21.1

Q ss_pred             eecccCcCcCCChHHHHHHhhhcC
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHS   37 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~   37 (99)
                      |.|..|++.|.....+..|+..|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999988654


No 38 
>KOG3993|consensus
Probab=96.96  E-value=0.00012  Score=47.45  Aligned_cols=53  Identities=26%  Similarity=0.495  Sum_probs=42.9

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhcc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHI   65 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   65 (99)
                      -|.|..|-..|...-.|.+|.=.-.-..-|+|+.|++.|.-..+|..|+|.|.
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHK  319 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHK  319 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccC
Confidence            36799999889888888887433322345999999999999999999999874


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.92  E-value=0.00056  Score=26.56  Aligned_cols=23  Identities=30%  Similarity=0.431  Sum_probs=13.4

Q ss_pred             eecccccccccCcchHHHHHHhcc
Q psy16685         42 HQCQVCGKRFTASSNLYYHRMTHI   65 (99)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~h~   65 (99)
                      |+|+.|+.... +..|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            46677776665 666777766543


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.74  E-value=0.00095  Score=26.07  Aligned_cols=20  Identities=45%  Similarity=0.946  Sum_probs=9.6

Q ss_pred             ecccCcCcCCChHHHHHHhh
Q psy16685         15 VCSVCSKGFSTSSSLNTHRR   34 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~   34 (99)
                      .|..|+..|.+...+..|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            34455555555544444443


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.68  E-value=0.00081  Score=26.27  Aligned_cols=22  Identities=27%  Similarity=0.671  Sum_probs=19.9

Q ss_pred             eecccccccccCcchHHHHHHh
Q psy16685         42 HQCQVCGKRFTASSNLYYHRMT   63 (99)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~   63 (99)
                      |.|..|+..|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            6799999999999999999874


No 42 
>PRK04860 hypothetical protein; Provisional
Probab=96.59  E-value=0.0016  Score=37.49  Aligned_cols=39  Identities=26%  Similarity=0.640  Sum_probs=33.0

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   54 (99)
                      -+|.|. |+.   ....+..|.+++++.++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            369998 987   566778999999999999999999887654


No 43 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.40  E-value=0.0018  Score=25.91  Aligned_cols=22  Identities=32%  Similarity=0.668  Sum_probs=14.5

Q ss_pred             eecccCcCcCCChHHHHHHhhh
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRI   35 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~   35 (99)
                      |.|..|++.|.+...+..|+.+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4577777777777766666543


No 44 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=95.86  E-value=0.0064  Score=38.57  Aligned_cols=48  Identities=21%  Similarity=0.292  Sum_probs=37.4

Q ss_pred             CCceecc--cccccccCcchHHHHHHhcc-------------------CCCcchhhhccccccCCCcch
Q psy16685         39 EKPHQCQ--VCGKRFTASSNLYYHRMTHI-------------------KVNDDFKEILNLEPVSGSNDE   86 (99)
Q Consensus        39 ~~~~~C~--~C~~~f~~~~~l~~H~~~h~-------------------~~~~~~~~~~~~~~~~~~~~~   86 (99)
                      ++||+|+  .|.+.+.....|+.|+.-.+                   ..|||.|++|+........+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLK  415 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLK  415 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccce
Confidence            5899996  59999999999999987422                   359999999987765544443


No 45 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=95.82  E-value=0.0078  Score=28.20  Aligned_cols=47  Identities=26%  Similarity=0.282  Sum_probs=31.9

Q ss_pred             ceecccccccccCcchHHHHHHh-ccC-CCcchhhhccccccCCCcchhhhh
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMT-HIK-VNDDFKEILNLEPVSGSNDEKNLN   90 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~-h~~-~~~~~~~~~~~~~~~~~~~~~~~~   90 (99)
                      .|.|+.|++ ..+...|..|... |.. .+...|-+|.....  .++..|+.
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~   50 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLN   50 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHH
Confidence            478999999 5567889999776 444 35677888876322  24444444


No 46 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.80  E-value=0.0061  Score=23.99  Aligned_cols=18  Identities=33%  Similarity=0.947  Sum_probs=8.7

Q ss_pred             ecccccccccCcchHHHHH
Q psy16685         43 QCQVCGKRFTASSNLYYHR   61 (99)
Q Consensus        43 ~C~~C~~~f~~~~~l~~H~   61 (99)
                      .|+.||+.| ..+.|..|+
T Consensus         4 ~C~~CgR~F-~~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHE   21 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHH
Confidence            455555555 333444444


No 47 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.21  E-value=0.012  Score=24.76  Aligned_cols=24  Identities=38%  Similarity=0.888  Sum_probs=16.8

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      |.|..||..+....            .++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            67888887654322            6788888875


No 48 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.03  E-value=0.0089  Score=38.58  Aligned_cols=65  Identities=38%  Similarity=0.660  Sum_probs=55.7

Q ss_pred             CCeecccCcCcCCChHHHHHHhh--hcCCC--Cceecc--cccccccCcchHHHHHHhccCCCcchhhhcc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRR--IHSGE--KPHQCQ--VCGKRFTASSNLYYHRMTHIKVNDDFKEILN   76 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~   76 (99)
                      .++.|..|...|.....+..|.+  .|.++  +++.|+  .|+..|.....+..|..+|.+..+..+....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  358 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLN  358 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccccccc
Confidence            36789999999999999999999  79998  899999  7999999999999999999887766654444


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.00  E-value=0.032  Score=23.38  Aligned_cols=22  Identities=23%  Similarity=0.593  Sum_probs=16.0

Q ss_pred             CeecccCcCcCCChHHHHHHhh
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRR   34 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~   34 (99)
                      +|.|..|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5678888888877777766654


No 50 
>KOG2893|consensus
Probab=93.82  E-value=0.024  Score=34.72  Aligned_cols=41  Identities=27%  Similarity=0.680  Sum_probs=33.4

Q ss_pred             cccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHH
Q psy16685         16 CSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYH   60 (99)
Q Consensus        16 C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H   60 (99)
                      |..|.+.|....-|.+|++    .+.|+|-+|-+..-+-..|..|
T Consensus        13 cwycnrefddekiliqhqk----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhh----hccceeeeehhhhccCCCceee
Confidence            8899999999988888766    5789999998766666667666


No 51 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=93.21  E-value=0.022  Score=34.32  Aligned_cols=44  Identities=32%  Similarity=0.598  Sum_probs=28.7

Q ss_pred             CCCeecccCcCcCCChHHHHHHhhh---cC-------CCCc-----eecccccccccCc
Q psy16685         11 EKPHVCSVCSKGFSTSSSLNTHRRI---HS-------GEKP-----HQCQVCGKRFTAS   54 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~~~l~~h~~~---~~-------~~~~-----~~C~~C~~~f~~~   54 (99)
                      ++...|+.|+..|.++.-.....+.   .+       +..|     +.|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            3567899999999987544433332   11       1222     5899999887644


No 52 
>KOG1146|consensus
Probab=93.04  E-value=0.075  Score=39.68  Aligned_cols=55  Identities=25%  Similarity=0.393  Sum_probs=45.3

Q ss_pred             hcCCCCeecccCcCcCCChHHHHHHhhhcC-------------------------CCCceecccccccccCcchHHHHHH
Q psy16685          8 LISEKPHVCSVCSKGFSTSSSLNTHRRIHS-------------------------GEKPHQCQVCGKRFTASSNLYYHRM   62 (99)
Q Consensus         8 h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~-------------------------~~~~~~C~~C~~~f~~~~~l~~H~~   62 (99)
                      +.-.+.+.|+.|+..|+....|..|++..+                         +.++|.|..|...+....+|.+|+.
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            344578899999999999999999988711                         1247889999999999999999987


No 53 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=92.90  E-value=0.11  Score=26.89  Aligned_cols=25  Identities=28%  Similarity=0.603  Sum_probs=21.7

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcC
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHS   37 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~   37 (99)
                      .+.|..|+..|.+...|..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            6899999999999999999999753


No 54 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.52  E-value=0.094  Score=28.30  Aligned_cols=30  Identities=27%  Similarity=0.741  Sum_probs=23.6

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   54 (99)
                      ..|+.||..|.-           .+..|..|+.||..|...
T Consensus        10 R~Cp~CG~kFYD-----------Lnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD-----------LNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc-----------CCCCCccCCCCCCccCcc
Confidence            369999988854           234788999999988766


No 55 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=92.07  E-value=0.15  Score=22.95  Aligned_cols=29  Identities=21%  Similarity=0.575  Sum_probs=21.0

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      .|.|..||..|...           ...+..|+.||....
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~irC~~CG~rIl   30 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDVVRCRECGYRIL   30 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCceECCCCCceEE
Confidence            37899999877543           235789999986543


No 56 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.60  E-value=0.14  Score=24.50  Aligned_cols=9  Identities=44%  Similarity=1.309  Sum_probs=4.4

Q ss_pred             Cceeccccc
Q psy16685         40 KPHQCQVCG   48 (99)
Q Consensus        40 ~~~~C~~C~   48 (99)
                      .+|.|+.||
T Consensus        49 ~~Y~Cp~CG   57 (61)
T COG2888          49 NPYRCPKCG   57 (61)
T ss_pred             CceECCCcC
Confidence            345555554


No 57 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=91.22  E-value=0.23  Score=21.33  Aligned_cols=34  Identities=24%  Similarity=0.664  Sum_probs=23.6

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      ..|+.|+..|.....-     ...+....+|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~-----l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK-----LPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHH-----cccCCcEEECCCCCcEee
Confidence            4689999888766532     123445789999988774


No 58 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.64  E-value=0.2  Score=29.13  Aligned_cols=23  Identities=48%  Similarity=1.155  Sum_probs=13.6

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCG   48 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~   48 (99)
                      -|.|++||..             +.++.|..||.||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            4667777643             2345566777776


No 59 
>KOG2186|consensus
Probab=90.59  E-value=0.3  Score=30.23  Aligned_cols=46  Identities=22%  Similarity=0.472  Sum_probs=34.9

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHH
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRM   62 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~   62 (99)
                      |.|..||....-+ .+..|+..-.+ .-|.|.-|+..|.. ..+..|..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            6799999877644 46678777666 67999999999988 55666655


No 60 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.55  E-value=0.16  Score=21.45  Aligned_cols=25  Identities=36%  Similarity=0.872  Sum_probs=15.8

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      .|.|..||..+...            ..|..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCCCcCcCCCC
Confidence            36788888654321            24668888875


No 61 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=89.99  E-value=0.083  Score=30.33  Aligned_cols=17  Identities=41%  Similarity=0.921  Sum_probs=13.0

Q ss_pred             ceecccccccccCcchH
Q psy16685         41 PHQCQVCGKRFTASSNL   57 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l   57 (99)
                      .++|+.||.+|.....+
T Consensus        28 ~~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         28 RRECLACGKRFTTFERV   44 (154)
T ss_pred             eeeccccCCcceEeEec
Confidence            48899999998876443


No 62 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=89.91  E-value=0.2  Score=25.88  Aligned_cols=30  Identities=30%  Similarity=0.804  Sum_probs=19.2

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      +|.|+.|++.-        ..+  .+...|.|..|+..|.
T Consensus        35 ~~~Cp~C~~~~--------VkR--~a~GIW~C~kCg~~fA   64 (89)
T COG1997          35 KHVCPFCGRTT--------VKR--IATGIWKCRKCGAKFA   64 (89)
T ss_pred             CCcCCCCCCcc--------eee--eccCeEEcCCCCCeec
Confidence            57788887641        111  2345788888887765


No 63 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=89.58  E-value=0.21  Score=19.80  Aligned_cols=10  Identities=40%  Similarity=0.976  Sum_probs=7.8

Q ss_pred             eccccccccc
Q psy16685         43 QCQVCGKRFT   52 (99)
Q Consensus        43 ~C~~C~~~f~   52 (99)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            7888888774


No 64 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=89.53  E-value=0.48  Score=20.24  Aligned_cols=33  Identities=21%  Similarity=0.588  Sum_probs=23.0

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRF   51 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   51 (99)
                      ..|+.|+..|......     +.......+|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEe
Confidence            4688999888776643     22334568899998776


No 65 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=89.04  E-value=0.18  Score=21.03  Aligned_cols=28  Identities=25%  Similarity=0.693  Sum_probs=17.4

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      |.|..|+..+..+           ...+..|+.||....
T Consensus         1 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~RIl   28 (32)
T PF03604_consen    1 YICGECGAEVELK-----------PGDPIRCPECGHRIL   28 (32)
T ss_dssp             EBESSSSSSE-BS-----------TSSTSSBSSSS-SEE
T ss_pred             CCCCcCCCeeEcC-----------CCCcEECCcCCCeEE
Confidence            5788888766421           234678999986543


No 66 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=89.00  E-value=0.15  Score=24.04  Aligned_cols=26  Identities=27%  Similarity=0.505  Sum_probs=17.2

Q ss_pred             CCCCceecccccccccCcchHHHHHH
Q psy16685         37 SGEKPHQCQVCGKRFTASSNLYYHRM   62 (99)
Q Consensus        37 ~~~~~~~C~~C~~~f~~~~~l~~H~~   62 (99)
                      .|+.-+.|+-|+..|.....+.+|..
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhh
Confidence            44555677777777776666666655


No 67 
>PHA00626 hypothetical protein
Probab=88.99  E-value=0.14  Score=24.14  Aligned_cols=35  Identities=17%  Similarity=0.363  Sum_probs=20.3

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   54 (99)
                      .|+.||..-..+...     .......|.|..||..|...
T Consensus         2 ~CP~CGS~~Ivrcg~-----cr~~snrYkCkdCGY~ft~~   36 (59)
T PHA00626          2 SCPKCGSGNIAKEKT-----MRGWSDDYVCCDCGYNDSKD   36 (59)
T ss_pred             CCCCCCCceeeeece-----ecccCcceEcCCCCCeechh
Confidence            478888642222111     11224679999999888543


No 68 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=88.99  E-value=0.41  Score=20.45  Aligned_cols=34  Identities=21%  Similarity=0.455  Sum_probs=22.2

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      ..|+.|+..|.......     ......+.|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCCCCEEECCCCCCEEE
Confidence            57999998887655321     11223578999987764


No 69 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.32  E-value=0.37  Score=26.71  Aligned_cols=33  Identities=18%  Similarity=0.437  Sum_probs=24.5

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchH
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNL   57 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l   57 (99)
                      ..|+.||..|.-           .+..|..|+.||..|.....+
T Consensus        10 r~Cp~cg~kFYD-----------Lnk~p~vcP~cg~~~~~~~~~   42 (129)
T TIGR02300        10 RICPNTGSKFYD-----------LNRRPAVSPYTGEQFPPEEAL   42 (129)
T ss_pred             ccCCCcCccccc-----------cCCCCccCCCcCCccCcchhh
Confidence            479999988853           234789999999988665443


No 70 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=87.73  E-value=0.36  Score=21.69  Aligned_cols=30  Identities=20%  Similarity=0.507  Sum_probs=20.3

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      .|.|+.||..+.....          ...+.|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~~~~----------~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDEY----------GTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECCC----------CCceECCCCCCeEE
Confidence            5889999987654221          12689999986543


No 71 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=87.58  E-value=0.34  Score=27.94  Aligned_cols=15  Identities=13%  Similarity=0.394  Sum_probs=7.0

Q ss_pred             eecccCcCcCCChHH
Q psy16685         14 HVCSVCSKGFSTSSS   28 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~   28 (99)
                      |.|+.|+..|+....
T Consensus       110 Y~Cp~c~~r~tf~eA  124 (158)
T TIGR00373       110 FICPNMCVRFTFNEA  124 (158)
T ss_pred             EECCCCCcEeeHHHH
Confidence            445555544444433


No 72 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.50  E-value=0.12  Score=22.40  Aligned_cols=29  Identities=24%  Similarity=0.597  Sum_probs=18.8

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      |.|..||..|......       .......|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~-------~~~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKI-------SDDPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEec-------CCCCCCCCCCCCC
Confidence            6799999877643321       1134567888886


No 73 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=87.16  E-value=0.28  Score=31.72  Aligned_cols=45  Identities=31%  Similarity=0.530  Sum_probs=38.4

Q ss_pred             Ceehhh--hhcCC--CCeecc--cCcCcCCChHHHHHHhhhcCCCCceecc
Q psy16685          1 MIYILR--VLISE--KPHVCS--VCSKGFSTSSSLNTHRRIHSGEKPHQCQ   45 (99)
Q Consensus         1 l~~h~~--~h~~~--~~~~C~--~c~~~~~~~~~l~~h~~~~~~~~~~~C~   45 (99)
                      |.+|.+  .|.++  +|+.|+  .|+..|.....+..|...+.+..++.+.
T Consensus       305 l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         305 LTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             ccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            457778  79999  999999  8999999999999999999887766654


No 74 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=87.09  E-value=0.14  Score=23.55  Aligned_cols=29  Identities=21%  Similarity=0.620  Sum_probs=18.4

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      |.|..|+..|.....+      . ...+..|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~------~-~~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKM------S-DDPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEec------C-CCCCCCCCCCCC
Confidence            6799999877643221      1 134567888885


No 75 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=86.75  E-value=0.5  Score=21.75  Aligned_cols=30  Identities=20%  Similarity=0.577  Sum_probs=20.5

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRF   51 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   51 (99)
                      .-|.|..||+.|...          .......|+.||...
T Consensus         5 ~~Y~C~~Cg~~~~~~----------~~~~~irCp~Cg~rI   34 (49)
T COG1996           5 MEYKCARCGREVELD----------QETRGIRCPYCGSRI   34 (49)
T ss_pred             EEEEhhhcCCeeehh----------hccCceeCCCCCcEE
Confidence            358899999888211          123567999998653


No 76 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=86.53  E-value=0.36  Score=28.42  Aligned_cols=29  Identities=21%  Similarity=0.587  Sum_probs=14.6

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKR   50 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   50 (99)
                      -|.|+.|+..|+....+.         .-|.|+.||..
T Consensus       117 ~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~  145 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME---------YGFRCPQCGEM  145 (178)
T ss_pred             EEECCCCCcEEeHHHHhh---------cCCcCCCCCCC
Confidence            355666665555444331         23566666543


No 77 
>KOG2893|consensus
Probab=86.20  E-value=0.38  Score=29.69  Aligned_cols=48  Identities=21%  Similarity=0.291  Sum_probs=37.4

Q ss_pred             CCceecccccccccCcchHHHHHHhccCCCcchhhhccccccCCCcchhhhhh
Q psy16685         39 EKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSNDEKNLNK   91 (99)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~   91 (99)
                      .+|| |=.|.+.|..+..|..|++    .+-|.|.+|-.+..++-.+..|-.-
T Consensus         9 ~kpw-cwycnrefddekiliqhqk----akhfkchichkkl~sgpglsihcmq   56 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIHCMQ   56 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhh----hccceeeeehhhhccCCCceeehhh
Confidence            3555 5679999999999999887    4558999999988887777665433


No 78 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=85.73  E-value=0.93  Score=21.69  Aligned_cols=9  Identities=44%  Similarity=1.254  Sum_probs=4.1

Q ss_pred             Cceeccccc
Q psy16685         40 KPHQCQVCG   48 (99)
Q Consensus        40 ~~~~C~~C~   48 (99)
                      .+|.|+.||
T Consensus        47 ~~Y~CP~CG   55 (59)
T PRK14890         47 NPYTCPKCG   55 (59)
T ss_pred             CceECCCCC
Confidence            344444444


No 79 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=85.38  E-value=0.76  Score=26.08  Aligned_cols=35  Identities=14%  Similarity=0.402  Sum_probs=16.9

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRF   51 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   51 (99)
                      -|.|+.|+..|.....+.. ..  . ...|.|+.||...
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~-~d--~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQL-LD--M-DGTFTCPRCGEEL  133 (147)
T ss_pred             EEECcCCCCEeeHHHHHHh-cC--C-CCcEECCCCCCEE
Confidence            4666666666654332211 00  1 2236666666543


No 80 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=84.45  E-value=0.61  Score=28.30  Aligned_cols=30  Identities=20%  Similarity=0.283  Sum_probs=21.3

Q ss_pred             cCCCCeecccCcCcCCChHHHHHHhhhcCC
Q psy16685          9 ISEKPHVCSVCSKGFSTSSSLNTHRRIHSG   38 (99)
Q Consensus         9 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~   38 (99)
                      .++..|.|..|++.|.....+..|+...+.
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            345568899999999999988888876544


No 81 
>PF14353 CpXC:  CpXC protein
Probab=83.92  E-value=0.12  Score=28.54  Aligned_cols=21  Identities=33%  Similarity=0.785  Sum_probs=15.6

Q ss_pred             CceecccccccccCcchHHHH
Q psy16685         40 KPHQCQVCGKRFTASSNLYYH   60 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H   60 (99)
                      ..+.|+.||..|.-...+..|
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             CEEECCCCCCceecCCCEEEE
Confidence            357999999988776666544


No 82 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=81.93  E-value=0.48  Score=23.67  Aligned_cols=42  Identities=24%  Similarity=0.471  Sum_probs=25.3

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecc--cccccccCcchH
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQ--VCGKRFTASSNL   57 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~--~C~~~f~~~~~l   57 (99)
                      +.|+.||..-....+-.  +.....+..+.|.  .||.+|.....+
T Consensus         2 m~CP~Cg~~a~irtSr~--~s~~~~~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678          2 FHCPLCQHAAHARTSRY--ITDTTKERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             ccCCCCCCccEEEEChh--cChhhheeeeecCCCCCCCEEEEEEEE
Confidence            46899987653332211  1112345667897  899998876544


No 83 
>KOG4173|consensus
Probab=80.35  E-value=0.46  Score=28.66  Aligned_cols=49  Identities=31%  Similarity=0.609  Sum_probs=38.5

Q ss_pred             ecccCcCcCCChHHHHHHhhh-c---------CCCCceec--ccccccccCcchHHHHHHh
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRI-H---------SGEKPHQC--QVCGKRFTASSNLYYHRMT   63 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~-~---------~~~~~~~C--~~C~~~f~~~~~l~~H~~~   63 (99)
                      .|..|.+.|++..-|..|+.- |         .|..-|+|  ..|+..|.+....+.|+-.
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIR  168 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHH
Confidence            699999999999988888653 3         22334788  5799999999999999764


No 84 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=79.87  E-value=0.86  Score=23.79  Aligned_cols=30  Identities=20%  Similarity=0.445  Sum_probs=17.7

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      .|.|+.|++.-..          -.+...|.|..|++.|.
T Consensus        36 ~y~CpfCgk~~vk----------R~a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         36 KYFCPFCGKHAVK----------RQAVGIWRCKGCKKTVA   65 (90)
T ss_pred             CccCCCCCCCcee----------eeeeEEEEcCCCCCEEe
Confidence            6778888743111          11235688888877664


No 85 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=79.62  E-value=1.4  Score=23.54  Aligned_cols=25  Identities=16%  Similarity=0.274  Sum_probs=21.2

Q ss_pred             eec----ccccccccCcchHHHHHHhccC
Q psy16685         42 HQC----QVCGKRFTASSNLYYHRMTHIK   66 (99)
Q Consensus        42 ~~C----~~C~~~f~~~~~l~~H~~~h~~   66 (99)
                      |.|    ..|+....+...+..|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    8899999999999999887654


No 86 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=77.30  E-value=0.93  Score=23.72  Aligned_cols=30  Identities=27%  Similarity=0.670  Sum_probs=18.1

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      .|.|+.|++.-.     .     -.+...|.|..|+..|.
T Consensus        35 ~y~CpfCgk~~v-----k-----R~a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        35 KYVCPFCGKKTV-----K-----RGSTGIWTCRKCGAKFA   64 (91)
T ss_pred             CccCCCCCCCce-----E-----EEeeEEEEcCCCCCEEe
Confidence            577888874311     1     12234688888887664


No 87 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=77.07  E-value=1.1  Score=23.33  Aligned_cols=11  Identities=36%  Similarity=0.893  Sum_probs=5.2

Q ss_pred             CeecccCcCcC
Q psy16685         13 PHVCSVCSKGF   23 (99)
Q Consensus        13 ~~~C~~c~~~~   23 (99)
                      |..|..||..|
T Consensus        58 Pa~CkkCGfef   68 (97)
T COG3357          58 PARCKKCGFEF   68 (97)
T ss_pred             ChhhcccCccc
Confidence            44444444444


No 88 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=76.55  E-value=2  Score=23.00  Aligned_cols=15  Identities=40%  Similarity=0.955  Sum_probs=12.5

Q ss_pred             CeecccCcCcCCChH
Q psy16685         13 PHVCSVCSKGFSTSS   27 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~   27 (99)
                      |+.|..||..|..-+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            788999999998743


No 89 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=75.70  E-value=0.75  Score=24.02  Aligned_cols=30  Identities=30%  Similarity=0.706  Sum_probs=17.5

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      .|.|+.|++.-..        +  .+.-.|.|..|+..|.
T Consensus        35 ky~Cp~Cgk~~vk--------R--~a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   35 KYTCPFCGKTSVK--------R--VATGIWKCKKCGKKFA   64 (90)
T ss_dssp             -BEESSSSSSEEE--------E--EETTEEEETTTTEEEE
T ss_pred             CCcCCCCCCceeE--------E--eeeEEeecCCCCCEEe
Confidence            5778888754211        1  1234588888887664


No 90 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=75.41  E-value=2.1  Score=16.79  Aligned_cols=18  Identities=28%  Similarity=0.530  Sum_probs=9.5

Q ss_pred             ecccccccccCcchHHHHH
Q psy16685         43 QCQVCGKRFTASSNLYYHR   61 (99)
Q Consensus        43 ~C~~C~~~f~~~~~l~~H~   61 (99)
                      .|+.|+..+ ....+..|.
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            466666655 334445554


No 91 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=75.39  E-value=2.9  Score=19.04  Aligned_cols=21  Identities=43%  Similarity=0.796  Sum_probs=11.7

Q ss_pred             eecccccccccCc-----chHHHHHH
Q psy16685         42 HQCQVCGKRFTAS-----SNLYYHRM   62 (99)
Q Consensus        42 ~~C~~C~~~f~~~-----~~l~~H~~   62 (99)
                      ..|..|++.+...     ++|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            3566666555433     46666666


No 92 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=74.60  E-value=2.3  Score=19.60  Aligned_cols=37  Identities=19%  Similarity=0.442  Sum_probs=18.7

Q ss_pred             CCeecccCcCcCCChHHHHHHhhh-cCCCCceeccccc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRI-HSGEKPHQCQVCG   48 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~-~~~~~~~~C~~C~   48 (99)
                      +.+.|..||..|.-...=+..-.. .....|-.|+.|-
T Consensus         3 k~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR   40 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCR   40 (49)
T ss_pred             eeEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHH
Confidence            456788888777644332222111 1123456666663


No 93 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=74.06  E-value=2.3  Score=23.85  Aligned_cols=26  Identities=35%  Similarity=0.533  Sum_probs=15.5

Q ss_pred             ceecccccccccCcchHHHHHHhccCCCc
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMTHIKVND   69 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~   69 (99)
                      -..|-.||+.|..   |++|.+.|+|-.|
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             eeEEccCCcccch---HHHHHHHccCCCH
Confidence            4679999998754   5899999866544


No 94 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=73.79  E-value=3.4  Score=18.10  Aligned_cols=14  Identities=29%  Similarity=0.515  Sum_probs=5.6

Q ss_pred             CCeecccCcCcCCC
Q psy16685         12 KPHVCSVCSKGFST   25 (99)
Q Consensus        12 ~~~~C~~c~~~~~~   25 (99)
                      ....|..|++.+..
T Consensus        15 ~~a~C~~C~~~~~~   28 (45)
T PF02892_consen   15 KKAKCKYCGKVIKY   28 (45)
T ss_dssp             S-EEETTTTEE---
T ss_pred             CeEEeCCCCeEEee
Confidence            34456666555443


No 95 
>KOG2231|consensus
Probab=73.11  E-value=2.3  Score=30.24  Aligned_cols=30  Identities=27%  Similarity=0.541  Sum_probs=20.0

Q ss_pred             eecccccccccCcchHHHHHHhccCCCcchhhhc
Q psy16685         42 HQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEIL   75 (99)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~   75 (99)
                      -.|..|...|.....|.+|++.++    ++|..|
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----~~chfC  212 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----EFCHFC  212 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----eheeec
Confidence            456777777777777777777555    444444


No 96 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=73.11  E-value=1.3  Score=26.91  Aligned_cols=27  Identities=26%  Similarity=0.538  Sum_probs=20.9

Q ss_pred             CCceecccccccccCcchHHHHHHhcc
Q psy16685         39 EKPHQCQVCGKRFTASSNLYYHRMTHI   65 (99)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~H~~~h~   65 (99)
                      +..|.|..|++.|.-......|+...+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcC
Confidence            346999999999999999999988755


No 97 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=73.01  E-value=1.3  Score=23.18  Aligned_cols=30  Identities=33%  Similarity=0.839  Sum_probs=17.6

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      .|.|+.|++.-..          -.+...|.|..|+..|.
T Consensus        36 ~y~CpfCgk~~vk----------R~a~GIW~C~~C~~~~A   65 (90)
T PRK03976         36 KHVCPVCGRPKVK----------RVGTGIWECRKCGAKFA   65 (90)
T ss_pred             CccCCCCCCCceE----------EEEEEEEEcCCCCCEEe
Confidence            5778888643111          11234688888877664


No 98 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=72.09  E-value=1.8  Score=17.76  Aligned_cols=24  Identities=21%  Similarity=0.709  Sum_probs=11.0

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      .|+.|+..+..           .....+.|+.|+.
T Consensus         4 ~Cp~C~se~~y-----------~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGELLVCPECGH   27 (30)
T ss_dssp             --TTT-----E-----------E-SSSEEETTTTE
T ss_pred             CCCCCCCccee-----------ccCCEEeCCcccc
Confidence            57888766543           3345688888875


No 99 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=71.38  E-value=1.7  Score=24.42  Aligned_cols=14  Identities=21%  Similarity=0.482  Sum_probs=9.6

Q ss_pred             CeecccCcCcCCCh
Q psy16685         13 PHVCSVCSKGFSTS   26 (99)
Q Consensus        13 ~~~C~~c~~~~~~~   26 (99)
                      .+.|..||..|...
T Consensus        70 ~~~C~~CG~~~~~~   83 (135)
T PRK03824         70 VLKCRNCGNEWSLK   83 (135)
T ss_pred             EEECCCCCCEEecc
Confidence            46788888776553


No 100
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=71.35  E-value=2.1  Score=16.62  Aligned_cols=10  Identities=40%  Similarity=0.982  Sum_probs=6.7

Q ss_pred             Cceecccccc
Q psy16685         40 KPHQCQVCGK   49 (99)
Q Consensus        40 ~~~~C~~C~~   49 (99)
                      .+|.|+.||.
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4677777763


No 101
>KOG2482|consensus
Probab=71.05  E-value=3.4  Score=27.09  Aligned_cols=29  Identities=28%  Similarity=0.493  Sum_probs=23.6

Q ss_pred             eecccccccccCcchHHHHHHh--ccCCCcc
Q psy16685         42 HQCQVCGKRFTASSNLYYHRMT--HIKVNDD   70 (99)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~--h~~~~~~   70 (99)
                      ++|..|.+.|..+..|+.||+.  |....|.
T Consensus       196 ~~CLyCekifrdkntLkeHMrkK~HrrinPk  226 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRKKRHRRINPK  226 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHhccCcccCCC
Confidence            6899999999999999999994  5444443


No 102
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=70.22  E-value=3.3  Score=27.79  Aligned_cols=32  Identities=25%  Similarity=0.648  Sum_probs=23.0

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcch
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSN   56 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~   56 (99)
                      ..|+.||....++           |..-|+|..|+..+.....
T Consensus       351 p~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~~~  382 (421)
T COG1571         351 PVCPRCGGRMKSA-----------GRNGFRCKKCGTRARETLI  382 (421)
T ss_pred             CCCCccCCchhhc-----------CCCCcccccccccCCcccc
Confidence            3799999776543           2337999999988776543


No 103
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=69.55  E-value=1.8  Score=18.49  Aligned_cols=9  Identities=22%  Similarity=1.054  Sum_probs=5.5

Q ss_pred             ecccCcCcC
Q psy16685         15 VCSVCSKGF   23 (99)
Q Consensus        15 ~C~~c~~~~   23 (99)
                      .|+.||.+|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            466666655


No 104
>KOG4167|consensus
Probab=69.44  E-value=1  Score=32.17  Aligned_cols=25  Identities=32%  Similarity=0.458  Sum_probs=22.8

Q ss_pred             ceecccccccccCcchHHHHHHhcc
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMTHI   65 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~h~   65 (99)
                      .|.|..|++.|..-..+..||++|-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4899999999999999999999885


No 105
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=69.40  E-value=3.1  Score=18.75  Aligned_cols=22  Identities=23%  Similarity=0.380  Sum_probs=18.0

Q ss_pred             eecccccccccCcchHHHHHHh
Q psy16685         42 HQCQVCGKRFTASSNLYYHRMT   63 (99)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~   63 (99)
                      |+|-.|..+...++.|-.||+.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            5788888888888888888874


No 106
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=68.85  E-value=2.1  Score=23.25  Aligned_cols=28  Identities=18%  Similarity=0.253  Sum_probs=20.3

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceecccccccccC
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      .|+.||+.|..           ....|..|+.||++|..
T Consensus        11 idPetg~KFYD-----------LNrdPiVsPytG~s~P~   38 (129)
T COG4530          11 IDPETGKKFYD-----------LNRDPIVSPYTGKSYPR   38 (129)
T ss_pred             cCccccchhhc-----------cCCCccccCcccccchH
Confidence            47788877643           34578899999999843


No 107
>KOG2785|consensus
Probab=67.46  E-value=9.9  Score=25.27  Aligned_cols=53  Identities=19%  Similarity=0.287  Sum_probs=42.1

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcCCC-----------------------Cceeccccc---ccccCcchHHHHHHhc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHSGE-----------------------KPHQCQVCG---KRFTASSNLYYHRMTH   64 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~h   64 (99)
                      -|-.|-.|++.+.+-..-..|+..++|-                       .-+.|..|.   +.|.+-.+.+.||...
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            3556899999998887778898887763                       126788888   8899999999999853


No 108
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=67.30  E-value=4.1  Score=23.49  Aligned_cols=34  Identities=15%  Similarity=0.114  Sum_probs=16.0

Q ss_pred             CceecccccccccCcchHHHHHHhccCCCcchhhhcccc
Q psy16685         40 KPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLE   78 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~   78 (99)
                      -+|.|. |+..|.+.   .+|=..--|+ .|.|..|+..
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            356666 66554433   2222222344 5666666543


No 109
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=67.23  E-value=5.8  Score=17.90  Aligned_cols=32  Identities=16%  Similarity=0.446  Sum_probs=18.1

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   54 (99)
                      -|+.||.......        ..+...+.|+.||..+.-.
T Consensus         2 FCp~Cg~~l~~~~--------~~~~~~~vC~~Cg~~~~~~   33 (52)
T smart00661        2 FCPKCGNMLIPKE--------GKEKRRFVCRKCGYEEPIE   33 (52)
T ss_pred             CCCCCCCcccccc--------CCCCCEEECCcCCCeEECC
Confidence            3778876443221        0112368899998765543


No 110
>KOG3507|consensus
Probab=66.89  E-value=4.3  Score=19.42  Aligned_cols=29  Identities=21%  Similarity=0.516  Sum_probs=19.0

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      .|.|..|+..-..           ....++.|..||....
T Consensus        20 iYiCgdC~~en~l-----------k~~D~irCReCG~RIl   48 (62)
T KOG3507|consen   20 IYICGDCGQENTL-----------KRGDVIRCRECGYRIL   48 (62)
T ss_pred             EEEeccccccccc-----------cCCCcEehhhcchHHH
Confidence            4889999854321           1235789999997644


No 111
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=66.57  E-value=0.89  Score=19.87  Aligned_cols=11  Identities=36%  Similarity=0.887  Sum_probs=8.0

Q ss_pred             ceecccccccc
Q psy16685         41 PHQCQVCGKRF   51 (99)
Q Consensus        41 ~~~C~~C~~~f   51 (99)
                      -|.|..|+..+
T Consensus        28 fy~C~~C~~~w   38 (40)
T smart00440       28 FYVCTKCGHRW   38 (40)
T ss_pred             EEEeCCCCCEe
Confidence            37888888665


No 112
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=66.25  E-value=5.4  Score=19.29  Aligned_cols=14  Identities=21%  Similarity=0.617  Sum_probs=9.0

Q ss_pred             CCceeccccccccc
Q psy16685         39 EKPHQCQVCGKRFT   52 (99)
Q Consensus        39 ~~~~~C~~C~~~f~   52 (99)
                      .+.|.|+.||..+.
T Consensus        44 ~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   44 GRVFTCPNCGFEMD   57 (69)
T ss_pred             cceEEcCCCCCEEC
Confidence            45677777776543


No 113
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=66.03  E-value=3.8  Score=18.88  Aligned_cols=12  Identities=25%  Similarity=0.576  Sum_probs=8.5

Q ss_pred             Cceecccccccc
Q psy16685         40 KPHQCQVCGKRF   51 (99)
Q Consensus        40 ~~~~C~~C~~~f   51 (99)
                      ..+.|..|+..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            467888888654


No 114
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=65.86  E-value=3.7  Score=17.85  Aligned_cols=21  Identities=19%  Similarity=0.370  Sum_probs=14.5

Q ss_pred             CCceecccccccccCcchHHH
Q psy16685         39 EKPHQCQVCGKRFTASSNLYY   59 (99)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~   59 (99)
                      .....|+.|+..+.....|..
T Consensus        17 ~~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   17 VEIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEEEECCCCCeEEccHHHHHH
Confidence            345678888888777666644


No 115
>KOG2593|consensus
Probab=65.84  E-value=7  Score=26.38  Aligned_cols=42  Identities=19%  Similarity=0.186  Sum_probs=24.1

Q ss_pred             CCceecccccccccCcchHHHHHHhccCCCcchhhhccccccCCC
Q psy16685         39 EKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGS   83 (99)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~   83 (99)
                      ..-|.|+.|.+.|..-..++   -.-.....|.|..|+-.-....
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~gelveDe  167 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGGELVEDE  167 (436)
T ss_pred             cccccCCccccchhhhHHHH---hhcccCceEEEecCCCchhccc
Confidence            45577777777766544432   2333445677777776544433


No 116
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=65.49  E-value=2.9  Score=22.76  Aligned_cols=11  Identities=36%  Similarity=0.667  Sum_probs=5.5

Q ss_pred             eecccCcCcCC
Q psy16685         14 HVCSVCSKGFS   24 (99)
Q Consensus        14 ~~C~~c~~~~~   24 (99)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            34555554443


No 117
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=65.28  E-value=2.6  Score=19.81  Aligned_cols=31  Identities=19%  Similarity=0.499  Sum_probs=19.9

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      +.|+.||..+......       .| ....|+.||..+-
T Consensus         3 ~~CP~CG~~iev~~~~-------~G-eiV~Cp~CGaele   33 (54)
T TIGR01206         3 FECPDCGAEIELENPE-------LG-ELVICDECGAELE   33 (54)
T ss_pred             cCCCCCCCEEecCCCc-------cC-CEEeCCCCCCEEE
Confidence            5799999876543321       12 3568999987653


No 118
>PLN02294 cytochrome c oxidase subunit Vb
Probab=65.25  E-value=3.6  Score=24.15  Aligned_cols=15  Identities=33%  Similarity=0.722  Sum_probs=11.0

Q ss_pred             CCCeecccCcCcCCC
Q psy16685         11 EKPHVCSVCSKGFST   25 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~   25 (99)
                      .+|+.|++||..|..
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            357788888887754


No 119
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=64.42  E-value=3.2  Score=18.22  Aligned_cols=29  Identities=14%  Similarity=0.193  Sum_probs=17.9

Q ss_pred             eecccccccccCcchHHHHHHhccCCCcchhhhccc
Q psy16685         42 HQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNL   77 (99)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~   77 (99)
                      |.|..||..|.......      . ..+-.|-.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~------~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSIS------E-DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEcC------C-CCCCcCCCCCC
Confidence            78999998876554321      1 34555656654


No 120
>KOG3408|consensus
Probab=64.38  E-value=4.7  Score=22.29  Aligned_cols=23  Identities=26%  Similarity=0.535  Sum_probs=12.2

Q ss_pred             CCeecccCcCcCCChHHHHHHhh
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRR   34 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~   34 (99)
                      ..|.|-.|.+-|.+...++.|.+
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHh
Confidence            34555555555555555555544


No 121
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=63.87  E-value=4.8  Score=17.88  Aligned_cols=12  Identities=33%  Similarity=1.005  Sum_probs=7.2

Q ss_pred             ecccCcCcCCCh
Q psy16685         15 VCSVCSKGFSTS   26 (99)
Q Consensus        15 ~C~~c~~~~~~~   26 (99)
                      .|..|++.|.-.
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            366777666543


No 122
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=63.69  E-value=2.3  Score=22.69  Aligned_cols=40  Identities=20%  Similarity=0.423  Sum_probs=24.1

Q ss_pred             CCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCc
Q psy16685         11 EKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   54 (99)
                      .+.|.|+.|+..-.+...++    .....-...|..||..|...
T Consensus        20 ~k~FtCp~Cghe~vs~ctvk----k~~~~g~~~Cg~CGls~e~e   59 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVK----KTVNIGTAVCGNCGLSFECE   59 (104)
T ss_pred             CceEecCccCCeeeeEEEEE----ecCceeEEEcccCcceEEEe
Confidence            45688999987655433322    11222345789998877643


No 123
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=63.66  E-value=5.7  Score=17.41  Aligned_cols=23  Identities=22%  Similarity=0.616  Sum_probs=13.6

Q ss_pred             eeccccccccc--CcchHHHHHHhc
Q psy16685         42 HQCQVCGKRFT--ASSNLYYHRMTH   64 (99)
Q Consensus        42 ~~C~~C~~~f~--~~~~l~~H~~~h   64 (99)
                      ..|+.||..|.  ....-..|.+.|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            47777776655  344455565554


No 124
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=63.56  E-value=4  Score=23.01  Aligned_cols=25  Identities=32%  Similarity=0.527  Sum_probs=19.2

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKP   41 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~   41 (99)
                      ..|-++|+.|.+   |++|+.+|.+.-|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            358888988864   7889999888654


No 125
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=61.98  E-value=2.6  Score=23.51  Aligned_cols=35  Identities=26%  Similarity=0.615  Sum_probs=21.5

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   54 (99)
                      .|+.|+........     ..-.+...|.|..|++.|...
T Consensus        32 ~cP~C~s~~~~k~g-----~~~~~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          32 NCPRCKSSNVVKIG-----GIRRGHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             cCCCCCccceeeEC-----CccccccccccCCcCcceeee
Confidence            58888765411111     112235679999999988754


No 126
>KOG2593|consensus
Probab=60.28  E-value=6.5  Score=26.53  Aligned_cols=40  Identities=20%  Similarity=0.492  Sum_probs=27.7

Q ss_pred             hcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceeccccccc
Q psy16685          8 LISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKR   50 (99)
Q Consensus         8 h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   50 (99)
                      -+...-|.|+.|.+.|.....++.   .-...--|.|..|+..
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCGGE  162 (436)
T ss_pred             ccccccccCCccccchhhhHHHHh---hcccCceEEEecCCCc
Confidence            344567999999999988776542   1222346899988764


No 127
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=60.25  E-value=4.4  Score=15.37  Aligned_cols=6  Identities=50%  Similarity=1.514  Sum_probs=2.8

Q ss_pred             cccccc
Q psy16685         44 CQVCGK   49 (99)
Q Consensus        44 C~~C~~   49 (99)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444543


No 128
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=59.89  E-value=4.5  Score=21.96  Aligned_cols=10  Identities=30%  Similarity=0.464  Sum_probs=4.8

Q ss_pred             eecccCcCcC
Q psy16685         14 HVCSVCSKGF   23 (99)
Q Consensus        14 ~~C~~c~~~~   23 (99)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            3455555443


No 129
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=59.83  E-value=5.3  Score=22.42  Aligned_cols=15  Identities=40%  Similarity=0.988  Sum_probs=12.6

Q ss_pred             CeecccCcCcCCChH
Q psy16685         13 PHVCSVCSKGFSTSS   27 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~   27 (99)
                      |+.|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            678999999998654


No 130
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=59.65  E-value=6.6  Score=18.26  Aligned_cols=39  Identities=23%  Similarity=0.600  Sum_probs=19.4

Q ss_pred             CCeeccc--CcCcCCChHHHHHHhhhcCCCCceeccc----ccccc
Q psy16685         12 KPHVCSV--CSKGFSTSSSLNTHRRIHSGEKPHQCQV----CGKRF   51 (99)
Q Consensus        12 ~~~~C~~--c~~~~~~~~~l~~h~~~~~~~~~~~C~~----C~~~f   51 (99)
                      .+..|+.  |...+. ...|..|....=...+..|+.    |...+
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~   52 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERV   52 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EE
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCcc
Confidence            4556766  333333 445677777544456677776    66554


No 131
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=59.43  E-value=7.3  Score=16.88  Aligned_cols=32  Identities=25%  Similarity=0.662  Sum_probs=14.7

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKR   50 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   50 (99)
                      |..|..|+..+..      ......+.+.|.|..|+..
T Consensus         2 p~rC~~C~aylNp------~~~~~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen    2 PVRCRRCRAYLNP------FCQFDDGGKTWICNFCGTK   33 (40)
T ss_dssp             S-B-TTT--BS-T------TSEEETTTTEEEETTT--E
T ss_pred             ccccCCCCCEECC------cceEcCCCCEEECcCCCCc
Confidence            4567777543322      2233445577888888764


No 132
>KOG1146|consensus
Probab=58.97  E-value=3.8  Score=31.45  Aligned_cols=52  Identities=21%  Similarity=0.445  Sum_probs=40.6

Q ss_pred             CCCeecccCcCcCCChHHHHHHhhhcC-----------------CCCceecccccccccCcchHHHHHHh
Q psy16685         11 EKPHVCSVCSKGFSTSSSLNTHRRIHS-----------------GEKPHQCQVCGKRFTASSNLYYHRMT   63 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~~~l~~h~~~~~-----------------~~~~~~C~~C~~~f~~~~~l~~H~~~   63 (99)
                      ..+|.|..|...|.....+..|.+...                 ...+| |..|...|.....|..|++.
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~ 1350 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRS 1350 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHH
Confidence            457889999888888887777765321                 12346 99999999999999999996


No 133
>KOG2907|consensus
Probab=58.06  E-value=8.6  Score=21.00  Aligned_cols=12  Identities=33%  Similarity=0.775  Sum_probs=8.1

Q ss_pred             eecccccccccC
Q psy16685         42 HQCQVCGKRFTA   53 (99)
Q Consensus        42 ~~C~~C~~~f~~   53 (99)
                      |.|+.|++.|..
T Consensus       103 YTC~kC~~k~~e  114 (116)
T KOG2907|consen  103 YTCPKCKYKFTE  114 (116)
T ss_pred             EEcCccceeeec
Confidence            677777766643


No 134
>KOG0978|consensus
Probab=57.24  E-value=4.5  Score=29.01  Aligned_cols=22  Identities=23%  Similarity=0.517  Sum_probs=15.3

Q ss_pred             CCceecccccccccCcchHHHH
Q psy16685         39 EKPHQCQVCGKRFTASSNLYYH   60 (99)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~H   60 (99)
                      .+--+||.|+.+|+..+.+..|
T Consensus       676 tRqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  676 TRQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             HhcCCCCCCCCCCCcccccccC
Confidence            3445899999988877655443


No 135
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=57.10  E-value=11  Score=20.53  Aligned_cols=19  Identities=26%  Similarity=0.585  Sum_probs=12.6

Q ss_pred             CeecccCcCcCCChHHHHH
Q psy16685         13 PHVCSVCSKGFSTSSSLNT   31 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~   31 (99)
                      |..|+.|+-...++..|.+
T Consensus        15 P~~CpiCgLtLVss~HLAR   33 (112)
T TIGR00622        15 PVECPICGLTLILSTHLAR   33 (112)
T ss_pred             CCcCCcCCCEEeccchHHH
Confidence            5667777777666666654


No 136
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=56.97  E-value=2.8  Score=30.03  Aligned_cols=57  Identities=18%  Similarity=0.322  Sum_probs=39.9

Q ss_pred             cccCcCcCCChHHHHHHhhhcCCCCcee-cccccccccCcchHHHHHHhccCCCcchhhhccccc
Q psy16685         16 CSVCSKGFSTSSSLNTHRRIHSGEKPHQ-CQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEP   79 (99)
Q Consensus        16 C~~c~~~~~~~~~l~~h~~~~~~~~~~~-C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~   79 (99)
                      |.-||-.|+.-..+- .-+.++....|. |+.|.+-|..+.+.+-|      ..|.-|..|++..
T Consensus       126 CT~CGPRfTIi~alP-YDR~nTsM~~F~lC~~C~~EY~dP~nRRfH------AQp~aCp~CGP~~  183 (750)
T COG0068         126 CTNCGPRFTIIEALP-YDRENTSMADFPLCPFCDKEYKDPLNRRFH------AQPIACPKCGPHL  183 (750)
T ss_pred             cCCCCcceeeeccCC-CCcccCccccCcCCHHHHHHhcCccccccc------cccccCcccCCCe
Confidence            888998888666553 234456666664 89998888777665444      4678888888743


No 137
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=56.65  E-value=3.1  Score=23.91  Aligned_cols=15  Identities=40%  Similarity=0.908  Sum_probs=10.3

Q ss_pred             ceecccccccccCcc
Q psy16685         41 PHQCQVCGKRFTASS   55 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~   55 (99)
                      .-.|+.|+..|.+..
T Consensus        28 RReC~~C~~RFTTfE   42 (156)
T COG1327          28 RRECLECGERFTTFE   42 (156)
T ss_pred             hhcccccccccchhh
Confidence            356888888777653


No 138
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=56.47  E-value=5.6  Score=21.74  Aligned_cols=11  Identities=36%  Similarity=0.697  Sum_probs=5.7

Q ss_pred             eecccCcCcCC
Q psy16685         14 HVCSVCSKGFS   24 (99)
Q Consensus        14 ~~C~~c~~~~~   24 (99)
                      ..|..|+..|.
T Consensus        72 ~~C~~Cg~~~~   82 (117)
T PRK00564         72 LECKDCSHVFK   82 (117)
T ss_pred             EEhhhCCCccc
Confidence            44666664443


No 139
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=55.90  E-value=3.6  Score=17.60  Aligned_cols=30  Identities=20%  Similarity=0.517  Sum_probs=16.5

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVC   47 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C   47 (99)
                      ..|+.|+..-    .+..|-....|...|.|..|
T Consensus         6 v~CP~C~s~~----~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQSTE----GVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCC----cceeCCCCCCCCEeEecCcC
Confidence            3577776432    13344444455566777766


No 140
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=55.28  E-value=7.3  Score=20.90  Aligned_cols=37  Identities=27%  Similarity=0.516  Sum_probs=18.2

Q ss_pred             CCeecccCcCcCC--ChHHHHHHhhhcCCCCceecccccc
Q psy16685         12 KPHVCSVCSKGFS--TSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus        12 ~~~~C~~c~~~~~--~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      +|-.|+.||..-.  ....+..+... .+.-.|.|..|+-
T Consensus         1 ~p~~CpYCg~~~~l~~~~~iYg~~~~-~~~~~y~C~~C~A   39 (102)
T PF11672_consen    1 KPIICPYCGGPAELVDGSEIYGHRYD-DGPYLYVCTPCDA   39 (102)
T ss_pred             CCcccCCCCCeeEEcccchhcCccCC-CCceeEECCCCCc
Confidence            4667999986433  22222221111 1112378888763


No 141
>KOG4167|consensus
Probab=54.55  E-value=2  Score=30.89  Aligned_cols=26  Identities=31%  Similarity=0.447  Sum_probs=22.0

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcC
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHS   37 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~   37 (99)
                      .-|.|.+|+++|-.-..+..|+++|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            35889999999988888888988874


No 142
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=54.36  E-value=18  Score=21.79  Aligned_cols=35  Identities=20%  Similarity=0.396  Sum_probs=20.0

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRF   51 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   51 (99)
                      -+.|+.|+ .-.....+   ++.......+.|..||..+
T Consensus         6 y~~Cp~Cg-~eev~hEV---ik~~g~~~lvrC~eCG~V~   40 (201)
T COG1326           6 YIECPSCG-SEEVSHEV---IKERGREPLVRCEECGTVH   40 (201)
T ss_pred             EEECCCCC-cchhhHHH---HHhcCCceEEEccCCCcEe
Confidence            35799998 22222222   2222333567999999876


No 143
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=53.63  E-value=6.5  Score=17.03  Aligned_cols=15  Identities=20%  Similarity=0.450  Sum_probs=12.1

Q ss_pred             CeecccCcCcCCChH
Q psy16685         13 PHVCSVCSKGFSTSS   27 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~   27 (99)
                      |+.|..|+..|-...
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            788999998887654


No 144
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=53.51  E-value=3.5  Score=20.86  Aligned_cols=31  Identities=23%  Similarity=0.611  Sum_probs=18.7

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceeccccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKR   50 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   50 (99)
                      .|.|..|+..|.    +.+++.   ....-.|+.|+..
T Consensus        12 ~Y~c~~cg~~~d----vvq~~~---ddplt~ce~c~a~   42 (82)
T COG2331          12 SYECTECGNRFD----VVQAMT---DDPLTTCEECGAR   42 (82)
T ss_pred             EEeecccchHHH----HHHhcc---cCccccChhhChH
Confidence            478999987664    233322   2333468888754


No 145
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=53.18  E-value=5.5  Score=17.53  Aligned_cols=15  Identities=40%  Similarity=0.986  Sum_probs=9.7

Q ss_pred             CceecccccccccCc
Q psy16685         40 KPHQCQVCGKRFTAS   54 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~   54 (99)
                      .|+.|..|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            588999999888754


No 146
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=51.28  E-value=10  Score=20.57  Aligned_cols=29  Identities=14%  Similarity=0.469  Sum_probs=19.7

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   54 (99)
                      .|+.|+..|...           ....|.|+.|+......
T Consensus         4 ~CP~C~seytY~-----------dg~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYH-----------DGTQLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEe-----------cCCeeECcccccccccc
Confidence            588888766432           23468999998776544


No 147
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=51.21  E-value=8.5  Score=20.94  Aligned_cols=10  Identities=20%  Similarity=0.571  Sum_probs=5.5

Q ss_pred             eecccCcCcC
Q psy16685         14 HVCSVCSKGF   23 (99)
Q Consensus        14 ~~C~~c~~~~   23 (99)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            4466666544


No 148
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.37  E-value=4.5  Score=25.02  Aligned_cols=40  Identities=25%  Similarity=0.501  Sum_probs=25.1

Q ss_pred             CCCeecccCcCcCCChHHHHHHhhhcCCC----------C-----ceeccccccc
Q psy16685         11 EKPHVCSVCSKGFSTSSSLNTHRRIHSGE----------K-----PHQCQVCGKR   50 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~----------~-----~~~C~~C~~~   50 (99)
                      ++...|+.|+-.|.....+....++-.+.          .     .+.|+.|+.+
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~yA   71 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYYA   71 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhHH
Confidence            45688999998887665444444433322          1     2579999853


No 149
>KOG2807|consensus
Probab=50.36  E-value=26  Score=23.03  Aligned_cols=18  Identities=33%  Similarity=0.696  Sum_probs=8.8

Q ss_pred             CeecccCcCcCCChHHHH
Q psy16685         13 PHVCSVCSKGFSTSSSLN   30 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~   30 (99)
                      |..|+.|+-.......|.
T Consensus       290 P~eCpiC~ltLVss~hLA  307 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHLA  307 (378)
T ss_pred             CccCCccceeEecchHHH
Confidence            444555555544444443


No 150
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=50.26  E-value=13  Score=21.02  Aligned_cols=11  Identities=45%  Similarity=1.346  Sum_probs=6.0

Q ss_pred             ceecccccccc
Q psy16685         41 PHQCQVCGKRF   51 (99)
Q Consensus        41 ~~~C~~C~~~f   51 (99)
                      .|.|..|+..+
T Consensus       112 ~y~C~~C~~~~  122 (146)
T smart00731      112 PYRCTGCGQRY  122 (146)
T ss_pred             EEECCCCCCCC
Confidence            45566565443


No 151
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=50.09  E-value=6.8  Score=22.15  Aligned_cols=10  Identities=30%  Similarity=1.195  Sum_probs=4.7

Q ss_pred             eecccccccc
Q psy16685         42 HQCQVCGKRF   51 (99)
Q Consensus        42 ~~C~~C~~~f   51 (99)
                      |.|..|+..+
T Consensus       124 ~~C~~C~~~~  133 (157)
T PF10263_consen  124 YRCPSCGREY  133 (157)
T ss_pred             EEcCCCCCEe
Confidence            4455555443


No 152
>KOG2071|consensus
Probab=49.75  E-value=9.7  Score=26.76  Aligned_cols=28  Identities=36%  Similarity=0.646  Sum_probs=23.7

Q ss_pred             CCceecccccccccCcchHHHHHHhccC
Q psy16685         39 EKPHQCQVCGKRFTASSNLYYHRMTHIK   66 (99)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~   66 (99)
                      ..|-.|..||..|........||..|..
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhh
Confidence            4567899999999999988888888764


No 153
>PRK10220 hypothetical protein; Provisional
Probab=49.44  E-value=14  Score=20.11  Aligned_cols=29  Identities=14%  Similarity=0.524  Sum_probs=19.8

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   54 (99)
                      .|+.|+..|...           ....|.|+.|+.-+...
T Consensus         5 ~CP~C~seytY~-----------d~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYE-----------DNGMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEc-----------CCCeEECCcccCcCCcc
Confidence            588888766432           23468999998776544


No 154
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=49.25  E-value=17  Score=17.12  Aligned_cols=26  Identities=35%  Similarity=0.877  Sum_probs=17.1

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRF   51 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   51 (99)
                      ..|..|+..|..            +.....|+.|+..+
T Consensus         6 ~~C~~Cg~~~~~------------~dDiVvCp~Cgapy   31 (54)
T PF14446_consen    6 CKCPVCGKKFKD------------GDDIVVCPECGAPY   31 (54)
T ss_pred             ccChhhCCcccC------------CCCEEECCCCCCcc
Confidence            358888877743            33456788887654


No 155
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=48.21  E-value=9  Score=16.80  Aligned_cols=12  Identities=42%  Similarity=1.143  Sum_probs=9.3

Q ss_pred             Cceecccccccc
Q psy16685         40 KPHQCQVCGKRF   51 (99)
Q Consensus        40 ~~~~C~~C~~~f   51 (99)
                      .+..|+.|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            467899998776


No 156
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=48.13  E-value=6.1  Score=21.43  Aligned_cols=11  Identities=27%  Similarity=0.742  Sum_probs=5.1

Q ss_pred             eecccCcCcCC
Q psy16685         14 HVCSVCSKGFS   24 (99)
Q Consensus        14 ~~C~~c~~~~~   24 (99)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            34555555544


No 157
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=46.55  E-value=6.9  Score=18.07  Aligned_cols=13  Identities=15%  Similarity=0.746  Sum_probs=6.6

Q ss_pred             ecccCcCcCCChH
Q psy16685         15 VCSVCSKGFSTSS   27 (99)
Q Consensus        15 ~C~~c~~~~~~~~   27 (99)
                      .|+.|++.|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            7999998887543


No 158
>PHA02998 RNA polymerase subunit; Provisional
Probab=46.35  E-value=4.8  Score=23.86  Aligned_cols=38  Identities=24%  Similarity=0.624  Sum_probs=21.5

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCc----eecccccccccCc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKP----HQCQVCGKRFTAS   54 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~----~~C~~C~~~f~~~   54 (99)
                      ...|+.|+..-.....+    .+..+..|    |.|..||..|..+
T Consensus       143 ~v~CPkCg~~~A~f~ql----QTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        143 NTPCPNCKSKNTTPMMI----QTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCCceEEEEE----eeccCCCCceEEEEcCCCCCccCCc
Confidence            35688887543332222    22223333    7899999887654


No 159
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=46.26  E-value=3.5  Score=16.64  Aligned_cols=8  Identities=63%  Similarity=1.281  Sum_probs=3.9

Q ss_pred             cccCcCcC
Q psy16685         16 CSVCSKGF   23 (99)
Q Consensus        16 C~~c~~~~   23 (99)
                      |-.|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            44455444


No 160
>KOG1842|consensus
Probab=46.18  E-value=8.4  Score=26.22  Aligned_cols=26  Identities=19%  Similarity=0.225  Sum_probs=19.0

Q ss_pred             CceecccccccccCcchHHHHHHhcc
Q psy16685         40 KPHQCQVCGKRFTASSNLYYHRMTHI   65 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H~~~h~   65 (99)
                      ..|.|+.|...|...+.|..|....+
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhc
Confidence            45778888888888788888877543


No 161
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=45.56  E-value=6.2  Score=17.59  Aligned_cols=9  Identities=22%  Similarity=0.774  Sum_probs=5.0

Q ss_pred             Cceeccccc
Q psy16685         40 KPHQCQVCG   48 (99)
Q Consensus        40 ~~~~C~~C~   48 (99)
                      ..|.|..|.
T Consensus        36 ~~~~C~~C~   44 (46)
T PF12760_consen   36 GRYRCKACR   44 (46)
T ss_pred             CeEECCCCC
Confidence            455665554


No 162
>KOG2636|consensus
Probab=45.24  E-value=18  Score=24.75  Aligned_cols=26  Identities=12%  Similarity=0.263  Sum_probs=16.6

Q ss_pred             hcCCCCeecccCc-CcCCChHHHHHHh
Q psy16685          8 LISEKPHVCSVCS-KGFSTSSSLNTHR   33 (99)
Q Consensus         8 h~~~~~~~C~~c~-~~~~~~~~l~~h~   33 (99)
                      |--...|.|.+|| .++..+..+.+|-
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHh
Confidence            3444567777777 6666666676663


No 163
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=45.04  E-value=19  Score=16.61  Aligned_cols=13  Identities=38%  Similarity=0.966  Sum_probs=8.3

Q ss_pred             eecccccccccCc
Q psy16685         42 HQCQVCGKRFTAS   54 (99)
Q Consensus        42 ~~C~~C~~~f~~~   54 (99)
                      |+|+.|+..|...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            6777777665544


No 164
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=44.92  E-value=11  Score=23.37  Aligned_cols=16  Identities=19%  Similarity=0.270  Sum_probs=12.8

Q ss_pred             CCCCeecccCcCcCCC
Q psy16685         10 SEKPHVCSVCSKGFST   25 (99)
Q Consensus        10 ~~~~~~C~~c~~~~~~   25 (99)
                      ..++..|++||..|..
T Consensus       178 EGkpqRCpECGqVFKL  193 (268)
T PTZ00043        178 EGFLYRCGECDQIFML  193 (268)
T ss_pred             CCCCccCCCCCcEEEE
Confidence            3457899999999875


No 165
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=44.62  E-value=15  Score=26.79  Aligned_cols=11  Identities=36%  Similarity=1.056  Sum_probs=5.9

Q ss_pred             Cceeccccccc
Q psy16685         40 KPHQCQVCGKR   50 (99)
Q Consensus        40 ~~~~C~~C~~~   50 (99)
                      .|..|+.||..
T Consensus       474 ~p~~Cp~Cgs~  484 (730)
T COG1198         474 IPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCC
Confidence            45556666543


No 166
>COG1773 Rubredoxin [Energy production and conversion]
Probab=44.39  E-value=10  Score=17.91  Aligned_cols=15  Identities=27%  Similarity=0.576  Sum_probs=11.7

Q ss_pred             CeecccCcCcCCChH
Q psy16685         13 PHVCSVCSKGFSTSS   27 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~   27 (99)
                      .|.|..||..|.-..
T Consensus         3 ~~~C~~CG~vYd~e~   17 (55)
T COG1773           3 RWRCSVCGYVYDPEK   17 (55)
T ss_pred             ceEecCCceEecccc
Confidence            588999998886554


No 167
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=43.72  E-value=7.4  Score=26.61  Aligned_cols=16  Identities=25%  Similarity=0.470  Sum_probs=10.7

Q ss_pred             CCCeecccCcCcCCCh
Q psy16685         11 EKPHVCSVCSKGFSTS   26 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~   26 (99)
                      ...|.|..||..+...
T Consensus       423 ~~~~~c~~c~~~yd~~  438 (479)
T PRK05452        423 GPRMQCSVCQWIYDPA  438 (479)
T ss_pred             CCeEEECCCCeEECCC
Confidence            3467788887776644


No 168
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=43.60  E-value=17  Score=24.97  Aligned_cols=27  Identities=22%  Similarity=0.441  Sum_probs=22.8

Q ss_pred             CceecccccccccCcchHHHHHHh-ccC
Q psy16685         40 KPHQCQVCGKRFTASSNLYYHRMT-HIK   66 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H~~~-h~~   66 (99)
                      +=|.|+.|.+.|.....+..|+.. |.+
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            457899999999999999999985 544


No 169
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=43.59  E-value=10  Score=21.70  Aligned_cols=29  Identities=28%  Similarity=0.659  Sum_probs=15.5

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcCCCCceeccccccc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKR   50 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   50 (99)
                      ..|.|..||.....         .+. ...-.|+.|+..
T Consensus       111 G~l~C~~Cg~~~~~---------~~~-~~l~~Cp~C~~~  139 (146)
T PF07295_consen  111 GTLVCENCGHEVEL---------THP-ERLPPCPKCGHT  139 (146)
T ss_pred             ceEecccCCCEEEe---------cCC-CcCCCCCCCCCC
Confidence            35777777754321         112 234567777753


No 170
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=43.28  E-value=21  Score=22.78  Aligned_cols=11  Identities=27%  Similarity=0.612  Sum_probs=6.2

Q ss_pred             eeccccccccc
Q psy16685         42 HQCQVCGKRFT   52 (99)
Q Consensus        42 ~~C~~C~~~f~   52 (99)
                      |.|+.|.-.|.
T Consensus       256 yvCs~Clsi~C  266 (279)
T TIGR00627       256 FVCSVCLSVLC  266 (279)
T ss_pred             EECCCccCCcC
Confidence            66666655544


No 171
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=43.12  E-value=19  Score=24.60  Aligned_cols=23  Identities=22%  Similarity=0.585  Sum_probs=16.4

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      .|.|..||....              ...++|+.|+.
T Consensus         7 ~y~C~~Cg~~~~--------------~~~g~Cp~C~~   29 (454)
T TIGR00416         7 KFVCQHCGADSP--------------KWQGKCPACHA   29 (454)
T ss_pred             eEECCcCCCCCc--------------cccEECcCCCC
Confidence            599999986542              23578998863


No 172
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=42.52  E-value=0.76  Score=19.96  Aligned_cols=10  Identities=40%  Similarity=1.006  Sum_probs=7.2

Q ss_pred             eecccccccc
Q psy16685         42 HQCQVCGKRF   51 (99)
Q Consensus        42 ~~C~~C~~~f   51 (99)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6788887654


No 173
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=42.02  E-value=6.1  Score=16.64  Aligned_cols=11  Identities=27%  Similarity=0.628  Sum_probs=7.0

Q ss_pred             Cceeccccccc
Q psy16685         40 KPHQCQVCGKR   50 (99)
Q Consensus        40 ~~~~C~~C~~~   50 (99)
                      ..+.|+.|+..
T Consensus        21 ~R~vC~~Cg~I   31 (34)
T PF14803_consen   21 ERLVCPACGFI   31 (34)
T ss_dssp             -EEEETTTTEE
T ss_pred             cceECCCCCCE
Confidence            45678888754


No 174
>PRK11823 DNA repair protein RadA; Provisional
Probab=41.72  E-value=19  Score=24.43  Aligned_cols=24  Identities=25%  Similarity=0.588  Sum_probs=16.9

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      ..|.|..||....              ...++|+.|+.
T Consensus         6 ~~y~C~~Cg~~~~--------------~~~g~Cp~C~~   29 (446)
T PRK11823          6 TAYVCQECGAESP--------------KWLGRCPECGA   29 (446)
T ss_pred             CeEECCcCCCCCc--------------ccCeeCcCCCC
Confidence            4699999986542              23468998864


No 175
>PRK04351 hypothetical protein; Provisional
Probab=41.64  E-value=17  Score=20.83  Aligned_cols=31  Identities=16%  Similarity=0.215  Sum_probs=18.0

Q ss_pred             ceecccccccccCcchHHHHHHhccCCCcchhhhccccc
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEP   79 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~   79 (99)
                      .|.|..|+..+.+..      +  .....+.|..|+...
T Consensus       112 ~Y~C~~Cg~~~~r~R------r--~n~~~yrCg~C~g~L  142 (149)
T PRK04351        112 LYECQSCGQQYLRKR------R--INTKRYRCGKCRGKL  142 (149)
T ss_pred             EEECCCCCCEeeeee------e--cCCCcEEeCCCCcEe
Confidence            477877876554321      1  134667777777543


No 176
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=41.55  E-value=31  Score=14.39  Aligned_cols=22  Identities=23%  Similarity=0.433  Sum_probs=10.9

Q ss_pred             ceecccccccccCcchHHHHHHh
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMT   63 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~   63 (99)
                      .+.|+.|++.+. .+-+..|...
T Consensus         4 ~~~C~nC~R~v~-a~RfA~HLek   25 (33)
T PF08209_consen    4 YVECPNCGRPVA-ASRFAPHLEK   25 (33)
T ss_dssp             EEE-TTTSSEEE-GGGHHHHHHH
T ss_pred             eEECCCCcCCcc-hhhhHHHHHH
Confidence            356666666543 2335555543


No 177
>PRK12496 hypothetical protein; Provisional
Probab=41.07  E-value=15  Score=21.34  Aligned_cols=11  Identities=27%  Similarity=0.918  Sum_probs=6.2

Q ss_pred             eeccccccccc
Q psy16685         42 HQCQVCGKRFT   52 (99)
Q Consensus        42 ~~C~~C~~~f~   52 (99)
                      +.|..|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            45666665553


No 178
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=40.80  E-value=18  Score=22.91  Aligned_cols=16  Identities=19%  Similarity=0.478  Sum_probs=11.2

Q ss_pred             CCceecccccccccCc
Q psy16685         39 EKPHQCQVCGKRFTAS   54 (99)
Q Consensus        39 ~~~~~C~~C~~~f~~~   54 (99)
                      .+.|.|+.||..+...
T Consensus       320 ~r~~~C~~cg~~~~rD  335 (364)
T COG0675         320 GRLFKCPRCGFVHDRD  335 (364)
T ss_pred             ceeEECCCCCCeehhh
Confidence            4568898888765543


No 179
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=40.70  E-value=13  Score=19.88  Aligned_cols=35  Identities=26%  Similarity=0.387  Sum_probs=20.0

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccC
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      .-+.|+.|+. ....-.+      ..+.....|+.||..+..
T Consensus        20 t~f~CP~Cge-~~v~v~~------~k~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         20 KIFECPRCGK-VSISVKI------KKNIAIITCGNCGLYTEF   54 (99)
T ss_pred             cEeECCCCCC-eEeeeec------CCCcceEECCCCCCccCE
Confidence            3577999983 2221111      113345689999877654


No 180
>KOG0717|consensus
Probab=40.49  E-value=16  Score=25.07  Aligned_cols=22  Identities=32%  Similarity=0.608  Sum_probs=19.3

Q ss_pred             eecccccccccCcchHHHHHHh
Q psy16685         42 HQCQVCGKRFTASSNLYYHRMT   63 (99)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~   63 (99)
                      +-|..|.++|.+..++..|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7799999999999999888764


No 181
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=40.27  E-value=9.1  Score=21.68  Aligned_cols=14  Identities=36%  Similarity=0.854  Sum_probs=9.6

Q ss_pred             CCeecccCcCcCCC
Q psy16685         12 KPHVCSVCSKGFST   25 (99)
Q Consensus        12 ~~~~C~~c~~~~~~   25 (99)
                      +|..|+.||..|..
T Consensus       111 ~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  111 KPQRCPECGQVFKL  124 (136)
T ss_dssp             SEEEETTTEEEEEE
T ss_pred             CccCCCCCCeEEEE
Confidence            46778888777653


No 182
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=40.22  E-value=10  Score=17.63  Aligned_cols=23  Identities=17%  Similarity=0.408  Sum_probs=12.3

Q ss_pred             CCeecccCcCcCCChHHHHHHhh
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRR   34 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~   34 (99)
                      ..|.|+.|.+.|-..-.+-.|..
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~   42 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHET   42 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTT
T ss_pred             CeEECCCCCCccccCcChhhhcc
Confidence            46899999999887666555533


No 183
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.87  E-value=10  Score=18.32  Aligned_cols=45  Identities=16%  Similarity=0.292  Sum_probs=23.8

Q ss_pred             hhhhhcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685          4 ILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus         4 h~~~h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      |..++.+..++.|+.-+-.+..+.-+.   .. ..+.-..|+.|+..|.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~L---~m-g~~gev~CPYC~t~y~   59 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVFL---DM-GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEEE---Ec-CCCCcEecCccccEEE
Confidence            334566677788876655443322110   01 1123357888887764


No 184
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=38.72  E-value=29  Score=19.69  Aligned_cols=46  Identities=17%  Similarity=0.297  Sum_probs=25.8

Q ss_pred             eecccCcCcCCChHHH--HHHhhh---cCCCCceecccccccccCcchHHH
Q psy16685         14 HVCSVCSKGFSTSSSL--NTHRRI---HSGEKPHQCQVCGKRFTASSNLYY   59 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l--~~h~~~---~~~~~~~~C~~C~~~f~~~~~l~~   59 (99)
                      -.|..|+..+.....-  ..-+..   .....-|.|+.|++.|..-+...+
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHH
Confidence            4699998765433211  111110   011234789999999987665544


No 185
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=38.60  E-value=15  Score=20.29  Aligned_cols=10  Identities=20%  Similarity=0.278  Sum_probs=5.6

Q ss_pred             eecccCcCcCC
Q psy16685         14 HVCSVCSKGFS   24 (99)
Q Consensus        14 ~~C~~c~~~~~   24 (99)
                      ..| .|+..|.
T Consensus        71 ~~C-~Cg~~~~   80 (124)
T PRK00762         71 IEC-ECGYEGV   80 (124)
T ss_pred             EEe-eCcCccc
Confidence            456 6665554


No 186
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=38.41  E-value=21  Score=24.68  Aligned_cols=10  Identities=40%  Similarity=1.135  Sum_probs=5.8

Q ss_pred             Cceecccccc
Q psy16685         40 KPHQCQVCGK   49 (99)
Q Consensus        40 ~~~~C~~C~~   49 (99)
                      .|..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            3556666654


No 187
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=38.18  E-value=22  Score=17.03  Aligned_cols=28  Identities=32%  Similarity=0.800  Sum_probs=10.8

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccccC
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      -.|..|++.|..            -.+..-|..||..|-.
T Consensus        10 ~~C~~C~~~F~~------------~~rrhhCr~CG~~vC~   37 (69)
T PF01363_consen   10 SNCMICGKKFSL------------FRRRHHCRNCGRVVCS   37 (69)
T ss_dssp             SB-TTT--B-BS------------SS-EEE-TTT--EEEC
T ss_pred             CcCcCcCCcCCC------------ceeeEccCCCCCEECC
Confidence            357778777742            1244566666665543


No 188
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=37.01  E-value=24  Score=16.31  Aligned_cols=10  Identities=30%  Similarity=0.757  Sum_probs=7.0

Q ss_pred             ceeccccccc
Q psy16685         41 PHQCQVCGKR   50 (99)
Q Consensus        41 ~~~C~~C~~~   50 (99)
                      .|.|..||.+
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            5777777754


No 189
>PRK06260 threonine synthase; Validated
Probab=36.45  E-value=24  Score=23.45  Aligned_cols=27  Identities=26%  Similarity=0.587  Sum_probs=15.9

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      +.|..||..|...            ...+.|+.|+..+.
T Consensus         4 ~~C~~cg~~~~~~------------~~~~~Cp~cg~~l~   30 (397)
T PRK06260          4 LKCIECGKEYDPD------------EIIYTCPECGGLLE   30 (397)
T ss_pred             EEECCCCCCCCCC------------CccccCCCCCCeEE
Confidence            5677887766421            23466777765443


No 190
>PRK14873 primosome assembly protein PriA; Provisional
Probab=36.09  E-value=24  Score=25.48  Aligned_cols=10  Identities=30%  Similarity=0.896  Sum_probs=5.6

Q ss_pred             Cceecccccc
Q psy16685         40 KPHQCQVCGK   49 (99)
Q Consensus        40 ~~~~C~~C~~   49 (99)
                      .|+.|+.|+.
T Consensus       421 ~p~~Cp~Cgs  430 (665)
T PRK14873        421 PDWRCPRCGS  430 (665)
T ss_pred             cCccCCCCcC
Confidence            3556666654


No 191
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=35.43  E-value=18  Score=15.46  Aligned_cols=12  Identities=17%  Similarity=0.321  Sum_probs=6.3

Q ss_pred             CCeecccCcCcC
Q psy16685         12 KPHVCSVCSKGF   23 (99)
Q Consensus        12 ~~~~C~~c~~~~   23 (99)
                      +-|.|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            358899998764


No 192
>PRK05978 hypothetical protein; Provisional
Probab=34.74  E-value=23  Score=20.42  Aligned_cols=10  Identities=50%  Similarity=1.368  Sum_probs=4.7

Q ss_pred             eccccccccc
Q psy16685         43 QCQVCGKRFT   52 (99)
Q Consensus        43 ~C~~C~~~f~   52 (99)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            4555554443


No 193
>KOG1280|consensus
Probab=34.65  E-value=44  Score=22.20  Aligned_cols=37  Identities=22%  Similarity=0.386  Sum_probs=20.8

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcCCCCc--eeccccc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHSGEKP--HQCQVCG   48 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~--~~C~~C~   48 (99)
                      .-|.|+.|+..-.+...+..|+...+.+-+  ..|+.|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            357777777766666666666554322222  3455554


No 194
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG1088|consensus
Probab=33.66  E-value=22  Score=19.61  Aligned_cols=20  Identities=25%  Similarity=0.328  Sum_probs=12.1

Q ss_pred             hcCCCCeecccCcCcCCChH
Q psy16685          8 LISEKPHVCSVCSKGFSTSS   27 (99)
Q Consensus         8 h~~~~~~~C~~c~~~~~~~~   27 (99)
                      +..+....|+.||..|+-+.
T Consensus        93 ~v~EG~l~CpetG~vfpI~~  112 (124)
T KOG1088|consen   93 DVIEGELVCPETGRVFPISD  112 (124)
T ss_pred             hhccceEecCCCCcEeeccc
Confidence            33445566777777776543


No 196
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=33.26  E-value=17  Score=16.72  Aligned_cols=13  Identities=23%  Similarity=0.915  Sum_probs=10.0

Q ss_pred             eecccccccccCc
Q psy16685         42 HQCQVCGKRFTAS   54 (99)
Q Consensus        42 ~~C~~C~~~f~~~   54 (99)
                      |+|..||..+...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            6888998877644


No 197
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=32.98  E-value=8.9  Score=17.23  Aligned_cols=38  Identities=26%  Similarity=0.443  Sum_probs=20.1

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceecc--cccccccCc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQ--VCGKRFTAS   54 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~--~C~~~f~~~   54 (99)
                      .|+.||...........  .....+.-+.|.  .||..|...
T Consensus         1 ~CP~Cg~~a~ir~S~~~--s~~~~~~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQL--SPLTRELYCQCTNPECGHTFVAN   40 (47)
T ss_pred             CcCCCCCeeEEEEchhh--CcceEEEEEEECCCcCCCEEEEE
Confidence            37888866544432221  112223456775  488887643


No 198
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=32.93  E-value=2.9  Score=20.54  Aligned_cols=42  Identities=24%  Similarity=0.487  Sum_probs=20.9

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchH
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNL   57 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l   57 (99)
                      .|.|..|+..-.  ..+ .-...+.|....+|+.|.....-.++|
T Consensus         4 ~FTC~~C~~Rs~--~~~-sk~aY~~GvViv~C~gC~~~HlIaDnL   45 (66)
T PF05180_consen    4 TFTCNKCGTRSA--KMF-SKQAYHKGVVIVQCPGCKNRHLIADNL   45 (66)
T ss_dssp             EEEETTTTEEEE--EEE-EHHHHHTSEEEEE-TTS--EEES--SS
T ss_pred             EEEcCCCCCccc--eee-CHHHHhCCeEEEECCCCcceeeehhhh
Confidence            377888874322  111 123446677778999997654444433


No 199
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=32.46  E-value=33  Score=21.47  Aligned_cols=32  Identities=22%  Similarity=0.496  Sum_probs=17.1

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceeccccccc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKR   50 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   50 (99)
                      .|..|.-..+..  +..-++.  +..+..|+.||+.
T Consensus       199 ~C~GC~m~l~~~--~~~~V~~--~d~iv~CP~CgRI  230 (239)
T COG1579         199 VCGGCHMKLPSQ--TLSKVRK--KDEIVFCPYCGRI  230 (239)
T ss_pred             cccCCeeeecHH--HHHHHhc--CCCCccCCccchH
Confidence            466665444322  2222332  5566788888864


No 200
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=32.07  E-value=44  Score=14.96  Aligned_cols=30  Identities=33%  Similarity=0.652  Sum_probs=18.0

Q ss_pred             CCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccc
Q psy16685         11 EKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRF   51 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   51 (99)
                      ..|-.|..|++....           .+...|.|..|+...
T Consensus         9 ~~~~~C~~C~~~i~g-----------~~~~g~~C~~C~~~~   38 (53)
T PF00130_consen    9 SKPTYCDVCGKFIWG-----------LGKQGYRCSWCGLVC   38 (53)
T ss_dssp             SSTEB-TTSSSBECS-----------SSSCEEEETTTT-EE
T ss_pred             CCCCCCcccCcccCC-----------CCCCeEEECCCCChH
Confidence            567788888876511           234567888877543


No 201
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=32.04  E-value=29  Score=20.59  Aligned_cols=8  Identities=38%  Similarity=1.198  Sum_probs=4.6

Q ss_pred             eecccccc
Q psy16685         42 HQCQVCGK   49 (99)
Q Consensus        42 ~~C~~C~~   49 (99)
                      |.|+.||.
T Consensus       133 F~Cp~Cg~  140 (176)
T COG1675         133 FTCPKCGE  140 (176)
T ss_pred             CCCCCCCc
Confidence            56666654


No 202
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=31.95  E-value=19  Score=16.37  Aligned_cols=36  Identities=25%  Similarity=0.530  Sum_probs=17.5

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCC------CCceeccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSG------EKPHQCQVCGKR   50 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~------~~~~~C~~C~~~   50 (99)
                      |.|..|+.++.....-.. ..+..|      ..-|.|+.|+..
T Consensus         2 y~C~~CgyvYd~~~Gd~~-~~i~pGt~F~~Lp~~w~CP~C~a~   43 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPE-NGIPPGTPFEDLPDDWVCPVCGAP   43 (47)
T ss_dssp             EEETTTSBEEETTTBBGG-GTB-TT--GGGS-TT-B-TTTSSB
T ss_pred             cCCCCCCEEEcCCcCCcc-cCcCCCCCHHHCCCCCcCcCCCCc
Confidence            789999887765432111 011111      234788888743


No 203
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=31.92  E-value=55  Score=19.17  Aligned_cols=56  Identities=18%  Similarity=0.311  Sum_probs=33.7

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecc--cccccccCcchHHHHHHh-ccCCCcc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQ--VCGKRFTASSNLYYHRMT-HIKVNDD   70 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~--~C~~~f~~~~~l~~H~~~-h~~~~~~   70 (99)
                      ...|+.|-........+.. -+.+...|+..|.  .|.+. .+...|..|.+. |...+|-
T Consensus        80 ~L~CPLCRG~V~GWtvve~-AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~rP~  138 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVVEP-ARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSARPS  138 (162)
T ss_pred             cccCccccCceeceEEchH-HHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCCCCc
Confidence            4568888655444443322 4445566777775  35433 367789999885 5555554


No 204
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=31.80  E-value=49  Score=21.35  Aligned_cols=27  Identities=22%  Similarity=0.245  Sum_probs=22.0

Q ss_pred             CCceecccccccccCcchHHHHHHhcc
Q psy16685         39 EKPHQCQVCGKRFTASSNLYYHRMTHI   65 (99)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~H~~~h~   65 (99)
                      ...|.|..|-+-|.+...+.+|+....
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~C~   72 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAKCD   72 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHhCC
Confidence            456899999999999999999987433


No 205
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=31.70  E-value=24  Score=18.75  Aligned_cols=20  Identities=35%  Similarity=0.858  Sum_probs=14.4

Q ss_pred             hhhcCCCCceecccccccccC
Q psy16685         33 RRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus        33 ~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      +..+.+ +|.+|..||.-|.-
T Consensus        72 ~~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          72 MWLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEEeCC-CceeCCCCCcEEEE
Confidence            334455 79999999987753


No 206
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=31.48  E-value=90  Score=16.72  Aligned_cols=38  Identities=11%  Similarity=0.191  Sum_probs=27.3

Q ss_pred             CCeecccCcCcCCChHHHHHHhhhcCCCCceeccccccc
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKR   50 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   50 (99)
                      ..|.|+.-+..|..-......+.. ...+.|.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~-y~~~vwtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMIL-YNQRVWTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHH-HhCCeeEEecCCCC
Confidence            457788888889887766655443 34578999887764


No 207
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=30.93  E-value=32  Score=22.90  Aligned_cols=9  Identities=44%  Similarity=0.722  Sum_probs=5.6

Q ss_pred             eecccCcCc
Q psy16685         14 HVCSVCSKG   22 (99)
Q Consensus        14 ~~C~~c~~~   22 (99)
                      |.|..||..
T Consensus         1 ~~c~~cg~~    9 (372)
T cd01121           1 YVCSECGYV    9 (372)
T ss_pred             CCCCCCCCC
Confidence            457777644


No 208
>PTZ00448 hypothetical protein; Provisional
Probab=30.72  E-value=31  Score=23.02  Aligned_cols=23  Identities=13%  Similarity=0.297  Sum_probs=19.8

Q ss_pred             ceecccccccccCcchHHHHHHh
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMT   63 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~   63 (99)
                      .|.|..|+..|......+.|.+.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999888888888874


No 209
>KOG2857|consensus
Probab=30.23  E-value=24  Score=20.22  Aligned_cols=23  Identities=13%  Similarity=0.352  Sum_probs=19.2

Q ss_pred             CceecccccccccCcchHHHHHH
Q psy16685         40 KPHQCQVCGKRFTASSNLYYHRM   62 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H~~   62 (99)
                      ..|+|+.|...|.+-..++.|+.
T Consensus        16 ~KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   16 IKYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hhccCCCCCCccccchhhhhccC
Confidence            35899999988888888888876


No 210
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=30.11  E-value=27  Score=14.53  Aligned_cols=12  Identities=33%  Similarity=0.841  Sum_probs=7.8

Q ss_pred             CeecccCcCcCC
Q psy16685         13 PHVCSVCSKGFS   24 (99)
Q Consensus        13 ~~~C~~c~~~~~   24 (99)
                      -+.|..|+.+|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            345888877653


No 211
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=30.06  E-value=37  Score=22.29  Aligned_cols=42  Identities=21%  Similarity=0.344  Sum_probs=23.2

Q ss_pred             cCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccC
Q psy16685          9 ISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus         9 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      +.++|..--.||.+... .++.  +-...|...|+|+.|+..-..
T Consensus       347 t~ENpP~ml~CgHVIsk-eal~--~LS~nG~~~FKCPYCP~~~~~  388 (396)
T COG5109         347 TDENPPVMLECGHVISK-EALS--VLSQNGVLSFKCPYCPEMSKY  388 (396)
T ss_pred             cccCCCeeeeccceeeH-HHHH--HHhhcCcEEeeCCCCCcchhh
Confidence            34555555567665443 3332  233456678888888755433


No 212
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=29.95  E-value=13  Score=22.41  Aligned_cols=40  Identities=28%  Similarity=0.389  Sum_probs=21.0

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCC---ceecccccccccCc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEK---PHQCQVCGKRFTAS   54 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~---~~~C~~C~~~f~~~   54 (99)
                      ...|+.||..+.....+.  ---+.|..   .+.|..||+.+..-
T Consensus        14 ~~~CPvCg~~l~~~~~~~--~IPyFG~V~i~t~~C~~CgYR~~DV   56 (201)
T COG1779          14 RIDCPVCGGTLKAHMYLY--DIPYFGEVLISTGVCERCGYRSTDV   56 (201)
T ss_pred             eecCCcccceeeEEEeee--cCCccceEEEEEEEccccCCcccce
Confidence            346999988544322211  01122321   25788898776543


No 213
>PHA02942 putative transposase; Provisional
Probab=29.94  E-value=36  Score=22.72  Aligned_cols=14  Identities=21%  Similarity=0.589  Sum_probs=9.0

Q ss_pred             CCceeccccccccc
Q psy16685         39 EKPHQCQVCGKRFT   52 (99)
Q Consensus        39 ~~~~~C~~C~~~f~   52 (99)
                      .+.|.|+.||....
T Consensus       340 ~r~f~C~~CG~~~d  353 (383)
T PHA02942        340 HRYFHCPSCGYEND  353 (383)
T ss_pred             CCEEECCCCCCEeC
Confidence            34677877776543


No 214
>KOG0696|consensus
Probab=29.88  E-value=26  Score=24.25  Aligned_cols=58  Identities=19%  Similarity=0.313  Sum_probs=33.3

Q ss_pred             CCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHH-hccCCCcchhhhccc
Q psy16685         11 EKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRM-THIKVNDDFKEILNL   77 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~~~~~~~   77 (99)
                      +.-++|.+|.        +..|.+.|. -..|.|+.-++.+.+......|.- +|+=..|-+|.-|+.
T Consensus        71 KQGfQCqvC~--------fvvHkrChe-fVtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCGs  129 (683)
T KOG0696|consen   71 KQGFQCQVCC--------FVVHKRCHE-FVTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCGS  129 (683)
T ss_pred             cCceeeeEEe--------ehhhhhhcc-eEEEECCCCCCCCCCCCcccccceeeeecCCCchhhhHHH
Confidence            3445555553        234555542 245777766666666666666633 455566777766664


No 215
>PF12773 DZR:  Double zinc ribbon
Probab=29.66  E-value=39  Score=14.98  Aligned_cols=11  Identities=27%  Similarity=0.770  Sum_probs=6.7

Q ss_pred             Cceeccccccc
Q psy16685         40 KPHQCQVCGKR   50 (99)
Q Consensus        40 ~~~~C~~C~~~   50 (99)
                      ....|+.|+..
T Consensus        28 ~~~~C~~Cg~~   38 (50)
T PF12773_consen   28 SKKICPNCGAE   38 (50)
T ss_pred             CCCCCcCCcCC
Confidence            34567777654


No 216
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=29.63  E-value=30  Score=23.04  Aligned_cols=33  Identities=15%  Similarity=0.219  Sum_probs=22.6

Q ss_pred             ecccccccccCcchHHHHHHhccCCCcchhhhcc
Q psy16685         43 QCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILN   76 (99)
Q Consensus        43 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~   76 (99)
                      .|..|...|-....|.+|++..+ |+-+-|...+
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H-E~ChICD~v~  254 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH-EACHICDMVG  254 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh-hhhhhhhccC
Confidence            58888888888888888888654 3444444333


No 217
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=29.57  E-value=36  Score=16.04  Aligned_cols=16  Identities=25%  Similarity=0.704  Sum_probs=8.3

Q ss_pred             CceecccccccccCcc
Q psy16685         40 KPHQCQVCGKRFTASS   55 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~   55 (99)
                      .|+....|+..|...+
T Consensus        23 ~PV~s~~C~H~fek~a   38 (57)
T PF11789_consen   23 DPVKSKKCGHTFEKEA   38 (57)
T ss_dssp             SEEEESSS--EEEHHH
T ss_pred             CCcCcCCCCCeecHHH
Confidence            4566666777665554


No 218
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=29.51  E-value=22  Score=19.26  Aligned_cols=23  Identities=30%  Similarity=0.651  Sum_probs=13.5

Q ss_pred             CCeecccCcCcCCChHHHHHHhh
Q psy16685         12 KPHVCSVCSKGFSTSSSLNTHRR   34 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~~h~~   34 (99)
                      ..+.|-.|.+-|.+...|..|.+
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhc
Confidence            34556666666666666655544


No 219
>KOG3362|consensus
Probab=28.50  E-value=14  Score=21.14  Aligned_cols=22  Identities=23%  Similarity=0.502  Sum_probs=14.2

Q ss_pred             ceecccccccccCcchHHHHHH
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRM   62 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~   62 (99)
                      +|.|..||..+.+-..+..|..
T Consensus       129 ~ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             hhHHHhcCCceeechhhhhccc
Confidence            4566677777766666666644


No 220
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=27.99  E-value=16  Score=19.90  Aligned_cols=11  Identities=36%  Similarity=0.996  Sum_probs=7.7

Q ss_pred             eeccccccccc
Q psy16685         42 HQCQVCGKRFT   52 (99)
Q Consensus        42 ~~C~~C~~~f~   52 (99)
                      |.|..||..+.
T Consensus       101 y~C~~Cg~~wr  111 (113)
T COG1594         101 YKCTRCGYRWR  111 (113)
T ss_pred             EEecccCCEee
Confidence            67877876653


No 221
>KOG1813|consensus
Probab=27.96  E-value=40  Score=21.88  Aligned_cols=15  Identities=33%  Similarity=0.793  Sum_probs=8.1

Q ss_pred             CceecccccccccCc
Q psy16685         40 KPHQCQVCGKRFTAS   54 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~   54 (99)
                      .||.|..|...|..+
T Consensus       240 ~Pf~c~icr~~f~~p  254 (313)
T KOG1813|consen  240 LPFKCFICRKYFYRP  254 (313)
T ss_pred             CCccccccccccccc
Confidence            356666665555443


No 222
>PF05207 zf-CSL:  CSL zinc finger;  InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a probable zinc binding motif that contains four cysteines and may chelate zinc, known as the DPH-type after the diphthamide (DPH) biosynthesis protein in which it was first characterised, including the proteins DPH3 and DPH4. This domain is also found associated with N-terminal domain of heat shock protein DnaJ IPR001623 from INTERPRO domain.  Diphthamide is a unique post-translationally modified histidine residue found only in translation elongation factor 2 (eEF-2). It is conserved from archaea to humans and serves as the target for diphteria toxin and Pseudomonas exotoxin A. These two toxins catalyse the transfer of ADP-ribose to diphtamide on eEF-2, thus inactivating eEF-2, halting cellular protein synthesis, and causing cell death []. The biosynthesis of diphtamide is dependent on at least five proteins, DPH1 to -5, and a still unidentified amidating enzyme. DPH3 and DPH4 share a conserved region, which encode a putative zinc finger, the DPH-type or CSL-type (after the conserved motif of the final cysteine) zinc finger [, ]. The function of this motif is unknown. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2L6L_A 1WGE_A 2JR7_A 1YOP_A 1YWS_A.
Probab=27.24  E-value=28  Score=16.28  Aligned_cols=31  Identities=29%  Similarity=0.501  Sum_probs=17.0

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      .|.| .||..|.....-.     ..+.....|..|..
T Consensus        18 ~y~C-RCG~~f~i~e~~l-----~~~~~iv~C~sCSL   48 (55)
T PF05207_consen   18 SYPC-RCGGEFEISEEDL-----EEGEVIVQCDSCSL   48 (55)
T ss_dssp             EEEE-TTSSEEEEEHHHH-----HCT--EEEETTTTE
T ss_pred             EEcC-CCCCEEEEcchhc-----cCcCEEEECCCCcc
Confidence            4668 7887776543321     12245677877754


No 223
>KOG2231|consensus
Probab=26.88  E-value=73  Score=23.21  Aligned_cols=47  Identities=21%  Similarity=0.470  Sum_probs=31.0

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceeccccc------ccccCcchHHHHHHhcc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCG------KRFTASSNLYYHRMTHI   65 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~------~~f~~~~~l~~H~~~h~   65 (99)
                      .|..|...|.....+..|++.+    .|.|..|.      .-|.....|..|-+.++
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~----h~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFD----HEFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccc----eeheeecCcccccchhcccchHHHHHhhhcC
Confidence            5788888888888888877643    34454442      34566677777766544


No 224
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=26.52  E-value=32  Score=20.95  Aligned_cols=15  Identities=27%  Similarity=0.826  Sum_probs=10.6

Q ss_pred             CceecccccccccCc
Q psy16685         40 KPHQCQVCGKRFTAS   54 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~   54 (99)
                      .||.|..|.+.|.++
T Consensus       195 IPF~C~iCKkdy~sp  209 (259)
T COG5152         195 IPFLCGICKKDYESP  209 (259)
T ss_pred             Cceeehhchhhccch
Confidence            578888877666554


No 225
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=26.52  E-value=51  Score=22.07  Aligned_cols=26  Identities=12%  Similarity=0.257  Sum_probs=16.5

Q ss_pred             hcCCCCeecccCc-CcCCChHHHHHHh
Q psy16685          8 LISEKPHVCSVCS-KGFSTSSSLNTHR   33 (99)
Q Consensus         8 h~~~~~~~C~~c~-~~~~~~~~l~~h~   33 (99)
                      |--.+.|.|.+|| .++-....+.+|-
T Consensus       369 hgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         369 HGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             cCCCcceeeeecccccccchHHHHhhh
Confidence            4445667788887 5666666666653


No 226
>PF14369 zf-RING_3:  zinc-finger
Probab=26.16  E-value=32  Score=14.43  Aligned_cols=10  Identities=40%  Similarity=1.092  Sum_probs=8.1

Q ss_pred             ecccCcCcCC
Q psy16685         15 VCSVCSKGFS   24 (99)
Q Consensus        15 ~C~~c~~~~~   24 (99)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4999998875


No 227
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=26.03  E-value=44  Score=15.88  Aligned_cols=37  Identities=19%  Similarity=0.338  Sum_probs=19.0

Q ss_pred             eecccCcCcCCChHH-H-HHHhhhcCCCCceecccccccc
Q psy16685         14 HVCSVCSKGFSTSSS-L-NTHRRIHSGEKPHQCQVCGKRF   51 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~-l-~~h~~~~~~~~~~~C~~C~~~f   51 (99)
                      ..|..|++.+..... + ...++. ..-..|.|..|....
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrn-rPi~tYmC~eC~~RI   41 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRN-RPIHTYMCDECKERI   41 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhc-CCCcceeChhHHHHH
Confidence            467888877553321 1 112221 223458888886543


No 228
>PRK04023 DNA polymerase II large subunit; Validated
Probab=25.92  E-value=74  Score=24.55  Aligned_cols=9  Identities=33%  Similarity=0.892  Sum_probs=5.5

Q ss_pred             eecccCcCc
Q psy16685         14 HVCSVCSKG   22 (99)
Q Consensus        14 ~~C~~c~~~   22 (99)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            357777654


No 229
>PF12907 zf-met2:  Zinc-binding
Probab=25.90  E-value=25  Score=15.40  Aligned_cols=20  Identities=25%  Similarity=0.600  Sum_probs=9.0

Q ss_pred             eccccccccc---CcchHHHHHH
Q psy16685         43 QCQVCGKRFT---ASSNLYYHRM   62 (99)
Q Consensus        43 ~C~~C~~~f~---~~~~l~~H~~   62 (99)
                      .|..|-.+|.   ....|..|-.
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~e   25 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAE   25 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHH
Confidence            4555553333   2234555544


No 230
>KOG3352|consensus
Probab=25.87  E-value=30  Score=19.99  Aligned_cols=13  Identities=23%  Similarity=0.669  Sum_probs=7.3

Q ss_pred             CCeecccCcCcCC
Q psy16685         12 KPHVCSVCSKGFS   24 (99)
Q Consensus        12 ~~~~C~~c~~~~~   24 (99)
                      +...|.+||..|.
T Consensus       132 e~~rc~eCG~~fk  144 (153)
T KOG3352|consen  132 ETQRCPECGHYFK  144 (153)
T ss_pred             CcccCCcccceEE
Confidence            3445666665554


No 231
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.62  E-value=62  Score=15.71  Aligned_cols=40  Identities=18%  Similarity=0.370  Sum_probs=18.7

Q ss_pred             eecccCcCcC-CChHHHHHHhhhcCCCCceecccccccccC
Q psy16685         14 HVCSVCSKGF-STSSSLNTHRRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus        14 ~~C~~c~~~~-~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      ..|.+|.+.- .....+..-.-....-.-|.|+.|......
T Consensus         3 vkCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rva~   43 (68)
T COG4896           3 VKCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRVAI   43 (68)
T ss_pred             ceEEEecceeeecchhHHHHHhhCCCceeEechhhHhhhch
Confidence            3577776542 222222211111222244788888755443


No 232
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=25.58  E-value=45  Score=21.42  Aligned_cols=31  Identities=19%  Similarity=0.506  Sum_probs=19.4

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccccC
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      ..|+.|+.....+. |.        ...+.|+.|+.-|.-
T Consensus        27 ~~c~~c~~~~~~~~-l~--------~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-LE--------RNLEVCPKCDHHMRM   57 (285)
T ss_pred             eECCCCcchhhHHH-HH--------hhCCCCCCCCCcCcC
Confidence            46888887654333 11        234689999887653


No 233
>PRK06450 threonine synthase; Validated
Probab=25.50  E-value=54  Score=21.44  Aligned_cols=26  Identities=31%  Similarity=0.684  Sum_probs=16.8

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceeccccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFT   52 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   52 (99)
                      +.|..||+.+..             ...+.|+.|+..+.
T Consensus         4 ~~C~~Cg~~~~~-------------~~~~~C~~cg~~l~   29 (338)
T PRK06450          4 EVCMKCGKERES-------------IYEIRCKKCGGPFE   29 (338)
T ss_pred             eEECCcCCcCCC-------------cccccCCcCCCEeE
Confidence            679999987632             12367887875443


No 234
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=25.49  E-value=48  Score=15.67  Aligned_cols=13  Identities=15%  Similarity=0.278  Sum_probs=7.6

Q ss_pred             CCCeecccCcCcC
Q psy16685         11 EKPHVCSVCSKGF   23 (99)
Q Consensus        11 ~~~~~C~~c~~~~   23 (99)
                      ...|.|+.||-.+
T Consensus        12 ~v~~~Cp~cGipt   24 (55)
T PF13824_consen   12 HVNFECPDCGIPT   24 (55)
T ss_pred             ccCCcCCCCCCcC
Confidence            3456677776543


No 235
>PLN02748 tRNA dimethylallyltransferase
Probab=25.37  E-value=63  Score=22.39  Aligned_cols=24  Identities=17%  Similarity=0.418  Sum_probs=15.3

Q ss_pred             CCeecccCcC-cCCChHHHHHHhhh
Q psy16685         12 KPHVCSVCSK-GFSTSSSLNTHRRI   35 (99)
Q Consensus        12 ~~~~C~~c~~-~~~~~~~l~~h~~~   35 (99)
                      +.|.|..|+. ++........|+..
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            4566777776 56666666666553


No 236
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=25.36  E-value=35  Score=21.60  Aligned_cols=27  Identities=19%  Similarity=0.527  Sum_probs=13.4

Q ss_pred             ecccCcCcCCChHHHHHHhhhcCCCCceeccccc
Q psy16685         15 VCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCG   48 (99)
Q Consensus        15 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~   48 (99)
                      .|+.||+-......+       .+.-.|+|..|.
T Consensus       222 ~CP~Cg~~W~L~~pl-------h~iFdFKCD~CR  248 (258)
T PF10071_consen  222 KCPSCGGDWRLKEPL-------HDIFDFKCDPCR  248 (258)
T ss_pred             CCCCCCCccccCCch-------hhceeccCCcce
Confidence            466666555544433       122345666554


No 237
>PRK07591 threonine synthase; Validated
Probab=25.18  E-value=48  Score=22.39  Aligned_cols=28  Identities=21%  Similarity=0.561  Sum_probs=18.2

Q ss_pred             CeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccC
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      -+.|..||..|..            ... |.|+.|+..+..
T Consensus        18 ~l~C~~Cg~~~~~------------~~~-~~C~~cg~~l~~   45 (421)
T PRK07591         18 ALKCRECGAEYPL------------GPI-HVCEECFGPLEV   45 (421)
T ss_pred             EEEeCCCCCcCCC------------CCC-ccCCCCCCeEEE
Confidence            4679999987752            122 788888755443


No 238
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=24.61  E-value=62  Score=19.13  Aligned_cols=19  Identities=21%  Similarity=0.588  Sum_probs=14.4

Q ss_pred             CCeecccCcCcCCChHHHH
Q psy16685         12 KPHVCSVCSKGFSTSSSLN   30 (99)
Q Consensus        12 ~~~~C~~c~~~~~~~~~l~   30 (99)
                      ....|..||+.|.....+.
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            4667999999998765554


No 239
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=24.29  E-value=29  Score=15.80  Aligned_cols=10  Identities=30%  Similarity=0.966  Sum_probs=3.6

Q ss_pred             Cceecccccc
Q psy16685         40 KPHQCQVCGK   49 (99)
Q Consensus        40 ~~~~C~~C~~   49 (99)
                      ..|.|+.|++
T Consensus        40 ~~W~CPiC~~   49 (50)
T PF02891_consen   40 PKWKCPICNK   49 (50)
T ss_dssp             ---B-TTT--
T ss_pred             CCeECcCCcC
Confidence            3489998864


No 240
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=24.25  E-value=30  Score=22.91  Aligned_cols=12  Identities=25%  Similarity=0.839  Sum_probs=7.9

Q ss_pred             ceeccccccccc
Q psy16685         41 PHQCQVCGKRFT   52 (99)
Q Consensus        41 ~~~C~~C~~~f~   52 (99)
                      .|.|+.||..+.
T Consensus       265 ~wrCpkCGg~ik  276 (403)
T COG1379         265 RWRCPKCGGKIK  276 (403)
T ss_pred             cccCcccccchh
Confidence            367777777543


No 241
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=24.20  E-value=33  Score=14.45  Aligned_cols=13  Identities=38%  Similarity=0.733  Sum_probs=5.5

Q ss_pred             eecccCcCcCCCh
Q psy16685         14 HVCSVCSKGFSTS   26 (99)
Q Consensus        14 ~~C~~c~~~~~~~   26 (99)
                      -.|..|++.|..+
T Consensus         4 ~~C~eC~~~f~dS   16 (34)
T PF01286_consen    4 PKCDECGKPFMDS   16 (34)
T ss_dssp             EE-TTT--EES-S
T ss_pred             chHhHhCCHHHHH
Confidence            3577777776543


No 242
>KOG0402|consensus
Probab=24.17  E-value=23  Score=18.31  Aligned_cols=12  Identities=25%  Similarity=0.506  Sum_probs=7.3

Q ss_pred             Cceecccccccc
Q psy16685         40 KPHQCQVCGKRF   51 (99)
Q Consensus        40 ~~~~C~~C~~~f   51 (99)
                      ..|.|..|.+.+
T Consensus        53 GiW~C~~C~kv~   64 (92)
T KOG0402|consen   53 GIWKCGSCKKVV   64 (92)
T ss_pred             eEEecCCcccee
Confidence            356777666544


No 243
>PRK05580 primosome assembly protein PriA; Validated
Probab=24.14  E-value=52  Score=23.81  Aligned_cols=11  Identities=36%  Similarity=1.008  Sum_probs=6.8

Q ss_pred             Cceeccccccc
Q psy16685         40 KPHQCQVCGKR   50 (99)
Q Consensus        40 ~~~~C~~C~~~   50 (99)
                      .|+.|+.|+..
T Consensus       420 ~~~~Cp~Cg~~  430 (679)
T PRK05580        420 IPKACPECGST  430 (679)
T ss_pred             CCCCCCCCcCC
Confidence            45667777643


No 244
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=24.13  E-value=25  Score=22.70  Aligned_cols=32  Identities=25%  Similarity=0.393  Sum_probs=19.6

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   54 (99)
                      .+|+.|+.....+. |        ....+.|+.|+.-|.-.
T Consensus        39 ~kc~~C~~~~~~~~-l--------~~~~~vcp~c~~h~rlt   70 (296)
T CHL00174         39 VQCENCYGLNYKKF-L--------KSKMNICEQCGYHLKMS   70 (296)
T ss_pred             eECCCccchhhHHH-H--------HHcCCCCCCCCCCcCCC
Confidence            45888876654332 1        12346899998876543


No 245
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=24.12  E-value=47  Score=22.80  Aligned_cols=13  Identities=23%  Similarity=0.452  Sum_probs=9.6

Q ss_pred             CCeecccCcCcCC
Q psy16685         12 KPHVCSVCSKGFS   24 (99)
Q Consensus        12 ~~~~C~~c~~~~~   24 (99)
                      ..|.|..||....
T Consensus         6 t~f~C~~CG~~s~   18 (456)
T COG1066           6 TAFVCQECGYVSP   18 (456)
T ss_pred             cEEEcccCCCCCc
Confidence            4588999986643


No 246
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=24.01  E-value=26  Score=21.43  Aligned_cols=31  Identities=16%  Similarity=0.103  Sum_probs=0.0

Q ss_pred             CceecccccccccCcchHHHHHHhccCCCcch
Q psy16685         40 KPHQCQVCGKRFTASSNLYYHRMTHIKVNDDF   71 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~   71 (99)
                      .-..|+.||..... +.+..|+++..-.-.|.
T Consensus       167 ~~~~cPitGe~IP~-~e~~eHmRi~LlDP~wk  197 (229)
T PF12230_consen  167 KMIICPITGEMIPA-DEMDEHMRIELLDPRWK  197 (229)
T ss_dssp             --------------------------------
T ss_pred             cccccccccccccc-ccccccccccccccccc
Confidence            44689999887643 45888998876543333


No 247
>KOG4727|consensus
Probab=23.97  E-value=49  Score=19.66  Aligned_cols=22  Identities=23%  Similarity=0.317  Sum_probs=17.8

Q ss_pred             CeecccCcCcCCChHHHHHHhh
Q psy16685         13 PHVCSVCSKGFSTSSSLNTHRR   34 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l~~h~~   34 (99)
                      -|.|.+|.-++....++..|+-
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            5889999999988877776654


No 248
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=23.73  E-value=38  Score=19.53  Aligned_cols=17  Identities=24%  Similarity=0.468  Sum_probs=13.1

Q ss_pred             CeecccCcCcCCChHHH
Q psy16685         13 PHVCSVCSKGFSTSSSL   29 (99)
Q Consensus        13 ~~~C~~c~~~~~~~~~l   29 (99)
                      .=.|..|++.|++-..+
T Consensus        28 RReC~~C~~RFTTyErv   44 (147)
T TIGR00244        28 RRECLECHERFTTFERA   44 (147)
T ss_pred             cccCCccCCccceeeec
Confidence            34799999999876544


No 249
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=23.70  E-value=40  Score=13.78  Aligned_cols=12  Identities=25%  Similarity=0.534  Sum_probs=8.7

Q ss_pred             CCeecccCcCcC
Q psy16685         12 KPHVCSVCSKGF   23 (99)
Q Consensus        12 ~~~~C~~c~~~~   23 (99)
                      +-|.|..||...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            357888888664


No 250
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=23.68  E-value=59  Score=22.43  Aligned_cols=25  Identities=24%  Similarity=0.279  Sum_probs=21.2

Q ss_pred             CceecccccccccCcchHHHHHHhc
Q psy16685         40 KPHQCQVCGKRFTASSNLYYHRMTH   64 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H~~~h   64 (99)
                      ..|.|..|.+-|.....|.+|+...
T Consensus       197 ~lyiCe~Cl~y~~~~~~~~~H~~~C  221 (450)
T PLN00104        197 KLYFCEFCLKFMKRKEQLQRHMKKC  221 (450)
T ss_pred             eEEEchhhhhhhcCHHHHHHHHhcC
Confidence            4589999999999999999998743


No 251
>PRK12722 transcriptional activator FlhC; Provisional
Probab=23.49  E-value=54  Score=19.73  Aligned_cols=32  Identities=16%  Similarity=0.316  Sum_probs=19.6

Q ss_pred             CceecccccccccCcchHHHHHHhccCCCcchhhhccccc
Q psy16685         40 KPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEP   79 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~   79 (99)
                      ....|..|+..|.....        .-...+.|..|.+..
T Consensus       133 ~l~~C~~Cgg~fv~~~~--------e~~~~f~CplC~~ps  164 (187)
T PRK12722        133 QLSSCNCCGGHFVTHAH--------DPVGSFVCGLCQPPS  164 (187)
T ss_pred             eeccCCCCCCCeecccc--------ccCCCCcCCCCCCcc
Confidence            34568888877764432        224567777777643


No 252
>PRK00420 hypothetical protein; Validated
Probab=23.35  E-value=61  Score=17.76  Aligned_cols=13  Identities=31%  Similarity=0.560  Sum_probs=8.4

Q ss_pred             ceecccccccccC
Q psy16685         41 PHQCQVCGKRFTA   53 (99)
Q Consensus        41 ~~~C~~C~~~f~~   53 (99)
                      ...|+.||....-
T Consensus        40 ~~~Cp~Cg~~~~v   52 (112)
T PRK00420         40 EVVCPVHGKVYIV   52 (112)
T ss_pred             ceECCCCCCeeee
Confidence            4678888775443


No 253
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=23.28  E-value=36  Score=16.07  Aligned_cols=10  Identities=20%  Similarity=0.707  Sum_probs=6.4

Q ss_pred             CeecccCcCc
Q psy16685         13 PHVCSVCSKG   22 (99)
Q Consensus        13 ~~~C~~c~~~   22 (99)
                      -..|+.||..
T Consensus         4 Wi~CP~CgnK   13 (55)
T PF14205_consen    4 WILCPICGNK   13 (55)
T ss_pred             EEECCCCCCc
Confidence            3468888753


No 254
>PRK12860 transcriptional activator FlhC; Provisional
Probab=23.04  E-value=54  Score=19.75  Aligned_cols=49  Identities=10%  Similarity=0.095  Sum_probs=27.0

Q ss_pred             CCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccCCCcchhhhcccccc
Q psy16685         23 FSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPV   80 (99)
Q Consensus        23 ~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~   80 (99)
                      +.....|.+..... --....|..|+..|.....        .....+.|..|.+...
T Consensus       117 ~tRAw~LvRf~~s~-~L~l~~C~~Cgg~fv~~~~--------e~~~~f~CplC~~psR  165 (189)
T PRK12860        117 LTRAWTLVRFFDAG-MLQLARCCRCGGKFVTHAH--------DLRHNFVCGLCQPPSR  165 (189)
T ss_pred             HHHHHHHHHHhcCC-CeeeccCCCCCCCeecccc--------ccCCCCcCCCCCCccc
Confidence            33344455444422 1244678888888764422        3345677888875443


No 255
>KOG1994|consensus
Probab=23.01  E-value=66  Score=20.13  Aligned_cols=21  Identities=29%  Similarity=0.738  Sum_probs=12.4

Q ss_pred             CceecccccccccCcchHHHH
Q psy16685         40 KPHQCQVCGKRFTASSNLYYH   60 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H   60 (99)
                      ..|=|-.||..|.+...|..|
T Consensus       238 eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             cceEEEEeccccCCHHHHHHh
Confidence            445566666666666665554


No 256
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=22.92  E-value=30  Score=16.37  Aligned_cols=11  Identities=27%  Similarity=0.869  Sum_probs=3.5

Q ss_pred             CCeecccCcCc
Q psy16685         12 KPHVCSVCSKG   22 (99)
Q Consensus        12 ~~~~C~~c~~~   22 (99)
                      +.|.|+.||..
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            45778888754


No 257
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.81  E-value=25  Score=16.14  Aligned_cols=11  Identities=36%  Similarity=0.908  Sum_probs=8.4

Q ss_pred             ecccccccccC
Q psy16685         43 QCQVCGKRFTA   53 (99)
Q Consensus        43 ~C~~C~~~f~~   53 (99)
                      .|+.|++.|.-
T Consensus        14 ICpvCqRPFsW   24 (54)
T COG4338          14 ICPVCQRPFSW   24 (54)
T ss_pred             hhhhhcCchHH
Confidence            58888888753


No 258
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=22.73  E-value=42  Score=13.72  Aligned_cols=11  Identities=18%  Similarity=0.528  Sum_probs=7.7

Q ss_pred             CeecccCcCcC
Q psy16685         13 PHVCSVCSKGF   23 (99)
Q Consensus        13 ~~~C~~c~~~~   23 (99)
                      -|.|..||...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            47788887654


No 259
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=22.62  E-value=50  Score=14.33  Aligned_cols=10  Identities=30%  Similarity=0.826  Sum_probs=6.5

Q ss_pred             CeecccCcCc
Q psy16685         13 PHVCSVCSKG   22 (99)
Q Consensus        13 ~~~C~~c~~~   22 (99)
                      |..|+.||..
T Consensus         2 ~~~Cp~Cg~~   11 (47)
T PF14690_consen    2 PPRCPHCGSP   11 (47)
T ss_pred             CccCCCcCCC
Confidence            5567788743


No 260
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=22.51  E-value=40  Score=14.41  Aligned_cols=14  Identities=21%  Similarity=0.698  Sum_probs=9.0

Q ss_pred             CceecccccccccC
Q psy16685         40 KPHQCQVCGKRFTA   53 (99)
Q Consensus        40 ~~~~C~~C~~~f~~   53 (99)
                      ..+.|+.||..+.+
T Consensus        31 p~~~C~~CGE~~~~   44 (46)
T TIGR03831        31 PALVCPQCGEEYLD   44 (46)
T ss_pred             CccccccCCCEeeC
Confidence            34678888876543


No 261
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=22.51  E-value=15  Score=19.38  Aligned_cols=8  Identities=38%  Similarity=1.165  Sum_probs=4.0

Q ss_pred             eecccccc
Q psy16685         42 HQCQVCGK   49 (99)
Q Consensus        42 ~~C~~C~~   49 (99)
                      ..|+.||.
T Consensus        63 ~~Cp~Cg~   70 (104)
T TIGR01384        63 VECPKCGH   70 (104)
T ss_pred             CCCCCCCC
Confidence            35555553


No 262
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=22.47  E-value=49  Score=17.98  Aligned_cols=12  Identities=33%  Similarity=0.822  Sum_probs=6.7

Q ss_pred             CeecccCcCcCC
Q psy16685         13 PHVCSVCSKGFS   24 (99)
Q Consensus        13 ~~~C~~c~~~~~   24 (99)
                      ...|..|+..|.
T Consensus        54 ~~~C~~C~~~fg   65 (118)
T PF02318_consen   54 ERHCARCGKPFG   65 (118)
T ss_dssp             CSB-TTTS-BCS
T ss_pred             CcchhhhCCccc
Confidence            346888887764


No 263
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=22.06  E-value=36  Score=15.85  Aligned_cols=10  Identities=40%  Similarity=1.072  Sum_probs=6.3

Q ss_pred             eccccccccc
Q psy16685         43 QCQVCGKRFT   52 (99)
Q Consensus        43 ~C~~C~~~f~   52 (99)
                      .|+.||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            5777776544


No 264
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=21.99  E-value=24  Score=22.74  Aligned_cols=10  Identities=40%  Similarity=1.215  Sum_probs=6.6

Q ss_pred             eecccccccc
Q psy16685         42 HQCQVCGKRF   51 (99)
Q Consensus        42 ~~C~~C~~~f   51 (99)
                      |.|..|+..+
T Consensus       287 ~~C~~Cg~~w  296 (299)
T TIGR01385       287 VTCEECGNRW  296 (299)
T ss_pred             EEcCCCCCee
Confidence            5777777554


No 265
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=21.96  E-value=55  Score=15.05  Aligned_cols=17  Identities=29%  Similarity=0.583  Sum_probs=10.7

Q ss_pred             CCCceecccccccccCc
Q psy16685         38 GEKPHQCQVCGKRFTAS   54 (99)
Q Consensus        38 ~~~~~~C~~C~~~f~~~   54 (99)
                      +.....|+.|+..|-..
T Consensus        37 ~~~~v~C~~C~~~fC~~   53 (64)
T smart00647       37 GCNRVTCPKCGFSFCFR   53 (64)
T ss_pred             CCCeeECCCCCCeECCC
Confidence            34556777777766543


No 266
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=21.89  E-value=38  Score=22.20  Aligned_cols=24  Identities=25%  Similarity=0.722  Sum_probs=12.8

Q ss_pred             ceecccccccccCcchHHHHHHhc
Q psy16685         41 PHQCQVCGKRFTASSNLYYHRMTH   64 (99)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~h   64 (99)
                      .|.|+.|...|......-.|...|
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHHh
Confidence            455555555555555555554443


No 267
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=21.74  E-value=62  Score=20.39  Aligned_cols=38  Identities=21%  Similarity=0.343  Sum_probs=19.8

Q ss_pred             hcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685          8 LISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus         8 h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      |-.-..+.|..|+..+........    .....+-.|+.|+.
T Consensus       117 HGsl~~~~C~~C~~~~~~~~~~~~----~~~~~~p~C~~Cg~  154 (250)
T COG0846         117 HGSLKRVRCSKCGNQYYDEDVIKF----IEDGLIPRCPKCGG  154 (250)
T ss_pred             ccceeeeEeCCCcCccchhhhhhh----cccCCCCcCccCCC
Confidence            333455678888777664331111    01113456777776


No 268
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=21.73  E-value=21  Score=22.66  Aligned_cols=18  Identities=33%  Similarity=0.741  Sum_probs=10.7

Q ss_pred             CceecccccccccCcchH
Q psy16685         40 KPHQCQVCGKRFTASSNL   57 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l   57 (99)
                      ++++|+.|+........|
T Consensus       208 k~~PCPKCg~et~eTkdL  225 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDL  225 (314)
T ss_pred             CCCCCCCCCCcccccccc
Confidence            567777777654444444


No 269
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=21.69  E-value=54  Score=14.03  Aligned_cols=11  Identities=45%  Similarity=1.111  Sum_probs=6.4

Q ss_pred             ecccCcCcCCC
Q psy16685         15 VCSVCSKGFST   25 (99)
Q Consensus        15 ~C~~c~~~~~~   25 (99)
                      .|+.|++.|--
T Consensus         4 ~CprC~kg~Hw   14 (36)
T PF14787_consen    4 LCPRCGKGFHW   14 (36)
T ss_dssp             C-TTTSSSCS-
T ss_pred             cCcccCCCcch
Confidence            57888877643


No 270
>PTZ00064 histone acetyltransferase; Provisional
Probab=21.66  E-value=75  Score=22.39  Aligned_cols=25  Identities=24%  Similarity=0.347  Sum_probs=21.2

Q ss_pred             CceecccccccccCcchHHHHHHhc
Q psy16685         40 KPHQCQVCGKRFTASSNLYYHRMTH   64 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H~~~h   64 (99)
                      ..|.|..|.+-|.....|.+|+...
T Consensus       279 ~LYICEfCLkY~~s~~~l~rH~~~C  303 (552)
T PTZ00064        279 TLHFCEYCLDFFCFEDELIRHLSRC  303 (552)
T ss_pred             eEEEccchhhhhCCHHHHHHHHhcC
Confidence            4589999999999999999998743


No 271
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=21.64  E-value=1.2e+02  Score=18.33  Aligned_cols=39  Identities=21%  Similarity=0.430  Sum_probs=19.1

Q ss_pred             hcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccc
Q psy16685          8 LISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGK   49 (99)
Q Consensus         8 h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   49 (99)
                      |-.-....|..|+..+.....+..   .........|+.|+.
T Consensus        90 HG~~~~~~C~~C~~~~~~~~~~~~---~~~~~~~p~C~~Cgg  128 (206)
T cd01410          90 HGNMFIEVCKSCGPEYVRDDVVET---RGDKETGRRCHACGG  128 (206)
T ss_pred             cCCcCcccCCCCCCccchHHHHHH---hhcCCCCCcCCCCcC
Confidence            444455668778766654332211   111122345777764


No 272
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=21.16  E-value=74  Score=17.50  Aligned_cols=10  Identities=30%  Similarity=0.657  Sum_probs=5.0

Q ss_pred             CeecccCcCc
Q psy16685         13 PHVCSVCSKG   22 (99)
Q Consensus        13 ~~~C~~c~~~   22 (99)
                      ...|+.|++.
T Consensus        69 ~V~CP~C~K~   78 (114)
T PF11023_consen   69 QVECPNCGKQ   78 (114)
T ss_pred             eeECCCCCCh
Confidence            3445555543


No 273
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=20.92  E-value=57  Score=14.10  Aligned_cols=29  Identities=17%  Similarity=0.362  Sum_probs=14.9

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccc
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRF   51 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   51 (99)
                      +.|+.|+....         .......-+.|..||...
T Consensus         1 m~Cp~Cg~~~~---------~~D~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen    1 MKCPNCGSKEI---------VFDPERGELVCPNCGLVL   29 (43)
T ss_dssp             ESBTTTSSSEE---------EEETTTTEEEETTT-BBE
T ss_pred             CCCcCCcCCce---------EEcCCCCeEECCCCCCEe
Confidence            45777776431         111223446788887653


No 274
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=20.80  E-value=47  Score=17.17  Aligned_cols=12  Identities=25%  Similarity=0.927  Sum_probs=7.5

Q ss_pred             ecccccccccCc
Q psy16685         43 QCQVCGKRFTAS   54 (99)
Q Consensus        43 ~C~~C~~~f~~~   54 (99)
                      .|+.||..|...
T Consensus        10 ~C~~CG~d~~~~   21 (86)
T PF06170_consen   10 RCPHCGLDYSHA   21 (86)
T ss_pred             cccccCCccccC
Confidence            577777665543


No 275
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=20.65  E-value=94  Score=13.25  Aligned_cols=12  Identities=25%  Similarity=0.584  Sum_probs=4.6

Q ss_pred             CeecccCcCcCC
Q psy16685         13 PHVCSVCSKGFS   24 (99)
Q Consensus        13 ~~~C~~c~~~~~   24 (99)
                      .|-|+.|...+.
T Consensus         3 ryyCdyC~~~~~   14 (38)
T PF06220_consen    3 RYYCDYCKKYLT   14 (38)
T ss_dssp             S-B-TTT--B-S
T ss_pred             Ceecccccceec
Confidence            466777877663


No 276
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=20.60  E-value=42  Score=13.50  Aligned_cols=11  Identities=27%  Similarity=0.821  Sum_probs=5.7

Q ss_pred             CCceecccccc
Q psy16685         39 EKPHQCQVCGK   49 (99)
Q Consensus        39 ~~~~~C~~C~~   49 (99)
                      +....|+.|+.
T Consensus        19 g~~r~C~~Cg~   29 (32)
T PF09297_consen   19 GWARRCPSCGH   29 (32)
T ss_dssp             SS-EEESSSS-
T ss_pred             cCEeECCCCcC
Confidence            34556777764


No 277
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=20.20  E-value=46  Score=16.43  Aligned_cols=14  Identities=21%  Similarity=0.712  Sum_probs=9.0

Q ss_pred             CceecccccccccC
Q psy16685         40 KPHQCQVCGKRFTA   53 (99)
Q Consensus        40 ~~~~C~~C~~~f~~   53 (99)
                      -...|..||.....
T Consensus        37 t~V~C~~CG~~l~~   50 (67)
T COG2051          37 TVVTCLICGTTLAE   50 (67)
T ss_pred             eEEEecccccEEEe
Confidence            35678888776543


No 278
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=20.12  E-value=32  Score=22.12  Aligned_cols=31  Identities=19%  Similarity=0.558  Sum_probs=19.1

Q ss_pred             eecccCcCcCCChHHHHHHhhhcCCCCceecccccccccC
Q psy16685         14 HVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTA   53 (99)
Q Consensus        14 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   53 (99)
                      ..|+.|+.....+. |.        ...+.|+.|+.-|.-
T Consensus        28 ~~c~~c~~~~~~~~-l~--------~~~~vc~~c~~h~rl   58 (292)
T PRK05654         28 TKCPSCGQVLYRKE-LE--------ANLNVCPKCGHHMRI   58 (292)
T ss_pred             eECCCccchhhHHH-HH--------hcCCCCCCCCCCeeC
Confidence            45888886554332 11        224689999987753


No 279
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=20.10  E-value=66  Score=15.47  Aligned_cols=15  Identities=33%  Similarity=0.782  Sum_probs=10.0

Q ss_pred             CceecccccccccCc
Q psy16685         40 KPHQCQVCGKRFTAS   54 (99)
Q Consensus        40 ~~~~C~~C~~~f~~~   54 (99)
                      -...|..|+.....+
T Consensus        29 t~V~C~~Cg~~L~~P   43 (59)
T PRK00415         29 TVVRCLVCGKTLAEP   43 (59)
T ss_pred             cEEECcccCCCcccC
Confidence            456788888765443


Done!