Query         psy1670
Match_columns 68
No_of_seqs    26 out of 28
Neff          2.1 
Searched_HMMs 46136
Date          Fri Aug 16 19:47:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1670.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1670hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3977|consensus               99.9 6.6E-22 1.4E-26  146.1   6.4   67    1-67      1-67  (221)
  2 PF00992 Troponin:  Troponin;    93.8    0.11 2.3E-06   35.0   3.8   24   44-67      1-24  (132)
  3 PF03457 HA:  Helicase associat  68.2     7.4 0.00016   22.1   2.7   19   32-50     47-65  (68)
  4 PF07946 DUF1682:  Protein of u  60.6      39 0.00084   25.1   5.9   17   31-47    294-310 (321)
  5 KOG3088|consensus               50.0      27 0.00059   27.7   3.9   25    6-30     68-92  (313)
  6 PF08278 DnaG_DnaB_bind:  DNA p  35.9      87  0.0019   19.3   3.9   15   36-51    113-127 (127)
  7 PF08035 Op_neuropeptide:  Opio  34.0      14 0.00031   20.6   0.1    9   36-44      2-12  (31)
  8 PLN02316 synthase/transferase   31.9 1.2E+02  0.0026   27.1   5.3   45    9-53    263-309 (1036)
  9 PF00645 zf-PARP:  Poly(ADP-rib  31.6      51  0.0011   19.3   2.2   17   35-51     63-81  (82)
 10 PRK14600 ruvA Holliday junctio  29.3      47   0.001   23.4   2.1   18   35-52     60-77  (186)
 11 COG2118 DNA-binding protein [G  27.8 2.1E+02  0.0046   19.8   6.2   27   24-50     35-61  (116)
 12 COG0632 RuvA Holliday junction  26.2      59  0.0013   23.6   2.2   19   34-52     59-77  (201)
 13 PRK14605 ruvA Holliday junctio  24.7      64  0.0014   22.6   2.1   18   35-52     60-77  (194)
 14 PF10057 DUF2294:  Uncharacteri  24.3   2E+02  0.0043   18.4   4.4   27   36-62     45-83  (118)
 15 KOG1029|consensus               23.5 5.7E+02   0.012   23.8   8.0   35   11-46    336-370 (1118)
 16 PRK14601 ruvA Holliday junctio  23.3      71  0.0015   22.6   2.1   18   35-52     60-77  (183)
 17 TIGR00084 ruvA Holliday juncti  22.9      75  0.0016   22.2   2.1   18   35-52     59-76  (191)
 18 KOG2357|consensus               21.5 4.8E+02    0.01   21.8   7.7   48   11-65    382-429 (440)
 19 PF10003 DUF2244:  Integral mem  21.0 1.1E+02  0.0024   20.2   2.5   17   36-52    121-137 (140)

No 1  
>KOG3977|consensus
Probab=99.86  E-value=6.6e-22  Score=146.13  Aligned_cols=67  Identities=58%  Similarity=0.738  Sum_probs=64.2

Q ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy1670           1 MADDAAKKAKQAEIDRKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKV   67 (68)
Q Consensus         1 m~d~~~~~rk~~E~erKkAEvrkrleea~~~kK~kkGflTpErKKkLr~Llm~KAAEelK~eq~~k~   67 (68)
                      |.|+++.+|+.++++.+++|||+||++|+..++.|+||+||+||++||+|||++|||||++||++++
T Consensus         1 ~~dg~~~~rka~~re~kk~evrkrleeA~~~~~~KKgfltpeRKkkLrkLlm~kAaedLkqqq~~kE   67 (221)
T KOG3977|consen    1 EVDGDDAARKAQEREAKKAEVRKRLEEAGMPKKEKKGFLTPERKKKLRKLLMQKAAEDLKQQQELKE   67 (221)
T ss_pred             CCccchhhhhccchhHHHHHHHHHHHHhcccchhhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5788889999999999999999999999999999999999999999999999999999999999875


No 2  
>PF00992 Troponin:  Troponin;  InterPro: IPR001978 The troponin (Tn) complex regulates Ca2+ induced muscle contraction. Tn contains three subunits, Ca2+ binding (TnC), inhibitory (TnI), and tropomyosin binding (TnT). This family includes troponin T and troponin I. Troponin I binds to actin and troponin T binds to tropomyosin [, , ].; PDB: 1J1D_C 1MXL_I 1LXF_I 2KRD_I 1J1E_F 2L1R_B 2KGB_I 1YTZ_I 1YV0_I 1VDJ_A ....
Probab=93.79  E-value=0.11  Score=34.98  Aligned_cols=24  Identities=46%  Similarity=0.404  Sum_probs=21.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhh
Q psy1670          44 KKKLRLLLRKKAAEELKKEQERKV   67 (68)
Q Consensus        44 KKkLr~Llm~KAAEelK~eq~~k~   67 (68)
                      |++|+.|++.+|+++|..+|+.++
T Consensus         1 K~~lK~L~~~kA~~el~~e~~~ke   24 (132)
T PF00992_consen    1 KRMLKDLLLLKAKIELHFEQRKKE   24 (132)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHH
Confidence            678999999999999999998765


No 3  
>PF03457 HA:  Helicase associated domain;  InterPro: IPR005114 This short domain is found in multiple copies in bacterial helicase proteins. The domain is predicted to contain 3 alpha helices. The function of this domain may be to bind nucleic acid.; PDB: 2KTA_A.
Probab=68.17  E-value=7.4  Score=22.13  Aligned_cols=19  Identities=47%  Similarity=0.744  Sum_probs=12.1

Q ss_pred             HhhhccCCCHHHHHHHHHH
Q psy1670          32 KKAKKGFMTPERKKKLRLL   50 (68)
Q Consensus        32 kK~kkGflTpErKKkLr~L   50 (68)
                      .+.++|-|||++...|..|
T Consensus        47 ~~~r~g~L~~er~~~L~~l   65 (68)
T PF03457_consen   47 RKYRKGKLTPERIERLDAL   65 (68)
T ss_dssp             HHHHHT---HHHHHHHHHH
T ss_pred             HHHHcCCCCHHHHHHHHcC
Confidence            4445577999999999876


No 4  
>PF07946 DUF1682:  Protein of unknown function (DUF1682);  InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function. One member (Q920S6 from SWISSPROT) is described as being an adipocyte-specific protein, but no evidence of this was found. 
Probab=60.63  E-value=39  Score=25.10  Aligned_cols=17  Identities=24%  Similarity=0.487  Sum_probs=10.5

Q ss_pred             HHhhhccCCCHHHHHHH
Q psy1670          31 AKKAKKGFMTPERKKKL   47 (68)
Q Consensus        31 ~kK~kkGflTpErKKkL   47 (68)
                      .+..+-.=||||..+|+
T Consensus       294 e~~~~~~~lspeeQrK~  310 (321)
T PF07946_consen  294 ERERKLSKLSPEEQRKY  310 (321)
T ss_pred             HHHHHHhcCCHHHHHHH
Confidence            33343334999987775


No 5  
>KOG3088|consensus
Probab=49.96  E-value=27  Score=27.71  Aligned_cols=25  Identities=28%  Similarity=0.388  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy1670           6 AKKAKQAEIDRKRAEVRKRMEEASK   30 (68)
Q Consensus         6 ~~~rk~~E~erKkAEvrkrleea~~   30 (68)
                      |-+++|+|-+||.+|.-+|-++...
T Consensus        68 eL~~rqeEL~Rke~ELdRREr~~a~   92 (313)
T KOG3088|consen   68 ELLKKQEELRRKEQELDRRERALAR   92 (313)
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHhh
Confidence            4567778888888888777777665


No 6  
>PF08278 DnaG_DnaB_bind:  DNA primase DnaG DnaB-binding ;  InterPro: IPR013173 Eubacterial DnaG primases interact with several factors to form the replisome. One of these factors is DnaB, a helicase. This domain has been demonstrated to be responsible for the interaction between DnaG and DnaB []. This domain has a multi-helical structure that forms an orthogonal bundle [].; GO: 0003896 DNA primase activity, 0006269 DNA replication, synthesis of RNA primer; PDB: 2HAJ_A 1T3W_B.
Probab=35.89  E-value=87  Score=19.32  Aligned_cols=15  Identities=53%  Similarity=0.767  Sum_probs=10.8

Q ss_pred             ccCCCHHHHHHHHHHH
Q psy1670          36 KGFMTPERKKKLRLLL   51 (68)
Q Consensus        36 kGflTpErKKkLr~Ll   51 (68)
                      .| +|++.|+-|+.||
T Consensus       113 ~~-Lt~eEk~el~~Ll  127 (127)
T PF08278_consen  113 GG-LTDEEKQELRRLL  127 (127)
T ss_dssp             T----HHHHHHHHHHH
T ss_pred             CC-cCHHHHHHHHHhC
Confidence            55 9999999999986


No 7  
>PF08035 Op_neuropeptide:  Opioids neuropeptide;  InterPro: IPR013532 Pro-opiomelanocortin is present in high levels in the pituitary and is processed into 3 major peptide families: adrenocorticotrophin (ACTH); alpha-, beta- and gamma-melanocyte- stimulating hormones (MSH); and beta-endorphin []. ACTH regulates the synthesis and release of glucocorticoids and, to some extent, aldosterone in the adrenal cortex. It is synthesised and released in response to corticotrophin-releasing factor at times of stress (i.e. heat, cold, infection, etc.), its release leading to increased metabolism. The action of MSH in man is poorly understood, but it may be involved in temperature regulation []. Full activity of ACTH resides in the first 20 N-terminal amino acids, the first 13 of which are identical to alpha-MSH [, ]. This region corresponds to the conserved YGG motif that is found in a wide variety of opioid neuropeptides such as enkephalin
Probab=33.96  E-value=14  Score=20.56  Aligned_cols=9  Identities=56%  Similarity=0.951  Sum_probs=6.9

Q ss_pred             ccCCCH--HHH
Q psy1670          36 KGFMTP--ERK   44 (68)
Q Consensus        36 kGflTp--ErK   44 (68)
                      +|||++  |+-
T Consensus         2 GGFM~s~~e~s   12 (31)
T PF08035_consen    2 GGFMKSWDERS   12 (31)
T ss_pred             Ccccccccccc
Confidence            699998  653


No 8  
>PLN02316 synthase/transferase
Probab=31.92  E-value=1.2e+02  Score=27.10  Aligned_cols=45  Identities=36%  Similarity=0.507  Sum_probs=24.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH--HHHhhhccCCCHHHHHHHHHHHHH
Q psy1670           9 AKQAEIDRKRAEVRKRMEEAS--KAKKAKKGFMTPERKKKLRLLLRK   53 (68)
Q Consensus         9 rk~~E~erKkAEvrkrleea~--~~kK~kkGflTpErKKkLr~Llm~   53 (68)
                      +.++|++|...|.+++-++.+  .+..+.-.--+.+++++|+.|+..
T Consensus       263 ~e~ae~~~~~ee~~r~~~~kaa~~a~~a~akae~~~~~~~~~~~~~~  309 (1036)
T PLN02316        263 KEEAERERQAEEQRRREEEKAAMEADRAQAKAEVEKRREKLQNLLKK  309 (1036)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhHHHHHHHHHHHHHHhh
Confidence            345677777777777765532  112221121455667777776643


No 9  
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=31.56  E-value=51  Score=19.34  Aligned_cols=17  Identities=47%  Similarity=0.913  Sum_probs=13.4

Q ss_pred             hccC--CCHHHHHHHHHHH
Q psy1670          35 KKGF--MTPERKKKLRLLL   51 (68)
Q Consensus        35 kkGf--lTpErKKkLr~Ll   51 (68)
                      -.||  |+|+-+.+|+.+|
T Consensus        63 i~G~~~L~~~Dq~~i~~~i   81 (82)
T PF00645_consen   63 IKGFDELKPEDQEKIRKLI   81 (82)
T ss_dssp             CETCCCS-HHHHHHHHHHH
T ss_pred             CCChHHCCHHHHHHHHHHh
Confidence            4577  9999999999886


No 10 
>PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional
Probab=29.27  E-value=47  Score=23.39  Aligned_cols=18  Identities=33%  Similarity=0.648  Sum_probs=15.7

Q ss_pred             hccCCCHHHHHHHHHHHH
Q psy1670          35 KKGFMTPERKKKLRLLLR   52 (68)
Q Consensus        35 kkGflTpErKKkLr~Llm   52 (68)
                      .-||.|++.+...+.|+-
T Consensus        60 LyGF~~~~Er~lF~~Lis   77 (186)
T PRK14600         60 LYGFLNREEQDCLRMLVK   77 (186)
T ss_pred             eeCCCCHHHHHHHHHHhC
Confidence            469999999999999874


No 11 
>COG2118 DNA-binding protein [General function prediction only]
Probab=27.79  E-value=2.1e+02  Score=19.84  Aligned_cols=27  Identities=26%  Similarity=0.488  Sum_probs=18.1

Q ss_pred             HHHHHHHHHhhhccCCCHHHHHHHHHH
Q psy1670          24 RMEEASKAKKAKKGFMTPERKKKLRLL   50 (68)
Q Consensus        24 rleea~~~kK~kkGflTpErKKkLr~L   50 (68)
                      |.+..++..-...-||||+-+.-|..+
T Consensus        35 r~~~eaqkqaiLrqiLtpeAreRL~~i   61 (116)
T COG2118          35 RQEEEAQKQAILRQILTPEARERLARV   61 (116)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHh
Confidence            333334444458889999999888754


No 12 
>COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair]
Probab=26.22  E-value=59  Score=23.56  Aligned_cols=19  Identities=37%  Similarity=0.634  Sum_probs=16.8

Q ss_pred             hhccCCCHHHHHHHHHHHH
Q psy1670          34 AKKGFMTPERKKKLRLLLR   52 (68)
Q Consensus        34 ~kkGflTpErKKkLr~Llm   52 (68)
                      ..-||.|.+.|...|.||-
T Consensus        59 ~LyGF~~~~ER~lF~~Lis   77 (201)
T COG0632          59 LLYGFLTEEERELFRLLIS   77 (201)
T ss_pred             HHcCCCCHHHHHHHHHHHc
Confidence            4679999999999999985


No 13 
>PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional
Probab=24.74  E-value=64  Score=22.64  Aligned_cols=18  Identities=28%  Similarity=0.327  Sum_probs=15.5

Q ss_pred             hccCCCHHHHHHHHHHHH
Q psy1670          35 KKGFMTPERKKKLRLLLR   52 (68)
Q Consensus        35 kkGflTpErKKkLr~Llm   52 (68)
                      .-||.|++.+...+.|+-
T Consensus        60 LyGF~~~~Er~lF~~Li~   77 (194)
T PRK14605         60 LFGFATTEELSLFETLID   77 (194)
T ss_pred             eeCCCCHHHHHHHHHHhC
Confidence            459999999999998873


No 14 
>PF10057 DUF2294:  Uncharacterized conserved protein (DUF2294);  InterPro: IPR018745  This domain of unknown function is found in a family of hypothetical bacterial proteins with no known function. It is also found at the C terminus of proteins provisionally annotated as response regulators.
Probab=24.33  E-value=2e+02  Score=18.37  Aligned_cols=27  Identities=37%  Similarity=0.455  Sum_probs=17.3

Q ss_pred             ccCCCHHHHHHH------------HHHHHHHHHHHHHHH
Q psy1670          36 KGFMTPERKKKL------------RLLLRKKAAEELKKE   62 (68)
Q Consensus        36 kGflTpErKKkL------------r~Llm~KAAEelK~e   62 (68)
                      .|||||.-+-.+            |..|+...-++++..
T Consensus        45 ~g~LTp~Ek~L~~~~~g~~lv~~~R~~l~~~~~~~l~~~   83 (118)
T PF10057_consen   45 EGFLTPAEKFLAETEEGRELVKQVRTSLIESLKPELKEM   83 (118)
T ss_pred             ECCCCHHHHHHHhCcchHHHHHHHHHHHHHHHHHHHHHH
Confidence            589999877544            455665555555543


No 15 
>KOG1029|consensus
Probab=23.50  E-value=5.7e+02  Score=23.75  Aligned_cols=35  Identities=23%  Similarity=0.306  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhccCCCHHHHHH
Q psy1670          11 QAEIDRKRAEVRKRMEEASKAKKAKKGFMTPERKKK   46 (68)
Q Consensus        11 ~~E~erKkAEvrkrleea~~~kK~kkGflTpErKKk   46 (68)
                      ..|.+++++|-+.+.|.....||-+-- .-.|||+-
T Consensus       336 leeqqqreree~eqkEreE~ekkerer-qEqErk~q  370 (1118)
T KOG1029|consen  336 LEEQQQREREEVEQKEREEEEKKERER-QEQERKAQ  370 (1118)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHH
Confidence            344444444444444444433333222 33444443


No 16 
>PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional
Probab=23.33  E-value=71  Score=22.55  Aligned_cols=18  Identities=28%  Similarity=0.628  Sum_probs=15.6

Q ss_pred             hccCCCHHHHHHHHHHHH
Q psy1670          35 KKGFMTPERKKKLRLLLR   52 (68)
Q Consensus        35 kkGflTpErKKkLr~Llm   52 (68)
                      .-||.|++.+...+.|+-
T Consensus        60 LyGF~~~~Er~lF~~Li~   77 (183)
T PRK14601         60 LYGFLDKDEQKMFEMLLK   77 (183)
T ss_pred             eeCCCCHHHHHHHHHHhc
Confidence            469999999999998874


No 17 
>TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=22.90  E-value=75  Score=22.25  Aligned_cols=18  Identities=28%  Similarity=0.434  Sum_probs=15.5

Q ss_pred             hccCCCHHHHHHHHHHHH
Q psy1670          35 KKGFMTPERKKKLRLLLR   52 (68)
Q Consensus        35 kkGflTpErKKkLr~Llm   52 (68)
                      .-||.|++.+...+.|+.
T Consensus        59 LyGF~~~~Er~lF~~L~~   76 (191)
T TIGR00084        59 LFGFNTLEERELFKELIK   76 (191)
T ss_pred             eeCCCCHHHHHHHHHHhC
Confidence            469999999999998874


No 18 
>KOG2357|consensus
Probab=21.52  E-value=4.8e+02  Score=21.78  Aligned_cols=48  Identities=25%  Similarity=0.384  Sum_probs=26.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhccCCCHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy1670          11 QAEIDRKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQER   65 (68)
Q Consensus        11 ~~E~erKkAEvrkrleea~~~kK~kkGflTpErKKkLr~Llm~KAAEelK~eq~~   65 (68)
                      .-...|.+|.-.+|.|..-..+..-+.-..||+-+       ++=|++++++.+.
T Consensus       382 ~th~~rqEaaQ~kk~Ek~Ka~kekl~a~~d~Ek~r-------r~EakerkR~~K~  429 (440)
T KOG2357|consen  382 LTHAARQEAAQEKKAEKKKAEKEKLKASGDPEKQR-------RKEAKERKRQAKK  429 (440)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhcCCHHHHH-------HHHHHHHHHHHHh
Confidence            33445666666667666654555555557887633       3445555555443


No 19 
>PF10003 DUF2244:  Integral membrane protein (DUF2244);  InterPro: IPR019253  This entry consists of various bacterial putative membrane proteins with no known function. 
Probab=20.95  E-value=1.1e+02  Score=20.17  Aligned_cols=17  Identities=35%  Similarity=0.628  Sum_probs=13.8

Q ss_pred             ccCCCHHHHHHHHHHHH
Q psy1670          36 KGFMTPERKKKLRLLLR   52 (68)
Q Consensus        36 kGflTpErKKkLr~Llm   52 (68)
                      +-||||+.+..|-..|.
T Consensus       121 G~fL~~~eR~~la~~L~  137 (140)
T PF10003_consen  121 GRFLNPEEREELARELR  137 (140)
T ss_pred             ccCCCHHHHHHHHHHHH
Confidence            56999999998876664


Done!