Diaphorina citri psyllid: psy16712

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-

MPSEWKFTIRRSTPAVVFWQWFNQSFNAVVNYTNRSGGSPVDESLLIKSYCAATGSAVATALSLNHLAKKAPPIFARLVPFSAVAAANMVNIPFMRNKEITDGLPVYDANNNLIGNSQKAAVTGISMVVVSRIGMATPGMIGIPVILNYLERKGTIRHLKWAPTAIQIGLLAVFLTFTTPMCCALFPQQTPIQISSLEPELQERAKKLNPPPTVGYYNKGL

ccccEEEEEcccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccCEEEcccccECccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccccEEEEcccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Sideroflexin-3	Potential iron transporter.	confident	Q91V61
Sideroflexin-1	Might be involved in the transport of a component required for iron utilization into or out of the mitochondria.	confident	Q9H9B4
Sideroflexin-1	Might be involved in the transport of a component required for iron utilization into or out of the mitochondria.	confident	A5A761

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031966 [CC]	mitochondrial membrane	confident	GO:0005737, GO:0005575, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0031967, GO:0031975, GO:0044446, GO:0005740, GO:0005739, GO:0044429, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005743 [CC]	mitochondrial inner membrane	probable	GO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0055072 [BP]	iron ion homeostasis	probable	GO:0050801, GO:0048878, GO:0042592, GO:0065007, GO:0055080, GO:0008150, GO:0065008
GO:0006826 [BP]	iron ion transport	probable	GO:0006810, GO:0006812, GO:0006811, GO:0000041, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0005371 [MF]	tricarboxylate secondary active transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0022804, GO:0015291, GO:0015142, GO:0046943
GO:0030218 [BP]	erythrocyte differentiation	probable	GO:0030154, GO:0042592, GO:0007275, GO:0044699, GO:0048869, GO:0002262, GO:0008150, GO:0048513, GO:0065007, GO:0048534, GO:0065008, GO:0032502, GO:0034101, GO:0032501, GO:0009987, GO:0044767, GO:0044763, GO:0030097, GO:0002520, GO:0048872, GO:0044707, GO:0048856, GO:0002376, GO:0030099, GO:0048731
GO:0008324 [MF]	cation transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0055085 [BP]	transmembrane transport	probable	GO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted