RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy16714
         (68 letters)



>gnl|CDD|188673 cd08718, RGS_RZ-like, Regulator of G protein signaling (RGS)
          domain found in the RZ protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RZ subfamily of the RGS protein family.  They are a
          diverse group of multifunctional proteins that regulate
          cellular signaling events downstream of G-protein
          coupled receptors (GPCRs). RGS proteins play critical
          regulatory roles as GTPase activating proteins (GAPs)
          of the heterotrimeric G-protein G-alpha-subunits.
          Deactivation of G-protein signaling is controlled by
          RGS domains, which accelerate GTPase activity of the
          alpha subunit by hydrolysis of GTP to GDP, which
          results in reassociation of the alpha-subunit with the
          beta-gamma-dimer and inhibition of downstream activity.
          As a major G-protein regulator, RGS domain containing
          proteins are involved in many crucial cellular
          processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. The RZ subfamily
          of RGS proteins includes RGS17, RGS19 (former GAIP),
          RGS20, and its splice variant Ret-RGS.
          Length = 118

 Score =  109 bits (274), Expect = 4e-33
 Identities = 47/56 (83%), Positives = 51/56 (91%)

Query: 13 AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          AGR +FREFLR EYSEEN+LFWLACE+LKKE+N  VIEEKAR IYEDYISILSPKE
Sbjct: 13 AGRNVFREFLRTEYSEENMLFWLACEELKKEANKHVIEEKARLIYEDYISILSPKE 68


>gnl|CDD|188700 cd08746, RGS_RGS20, Regulator of G protein signaling (RGS) domain
           found in the RGS20 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS20 protein (also known as RGSZ1), a member of the RZ
           subfamily of the RGS protein family.  They are a diverse
           group of multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). RGS proteins play critical regulatory
           roles as GTPase activating proteins (GAPs) of the
           heterotrimeric G-protein G-alpha-subunits. Deactivation
           of G-protein signaling is controlled by the RGS domain,
           which accelerates GTPase activity of the alpha subunit
           by hydrolysis of GTP to GDP resulting in reassociation
           of the alpha-subunit with the beta-gamma-dimer and
           inhibition of downstream activity. As a major G-protein
           regulator, the RGS domain containing proteins are
           involved in many crucial cellular processes such as
           regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. The RZ subfamily of RGS proteins include
           RGS17, RGS19 (former GAIP), and the splice variant of
           RGS20, Ret-RGS. RGS20 is expressed exclusively in brain,
           with the highest concentrations in the temporal lobe and
           the caudate nucleus and may play a role in signaling
           regulation in these brain regions. RGS20 acts as a GAP
           of both G-alpha-z and G-alpha-I and controls signaling
           in the mu opioid receptor pathway.
          Length = 167

 Score = 95.4 bits (237), Expect = 5e-27
 Identities = 45/56 (80%), Positives = 50/56 (89%)

Query: 13  AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
           AGR  FREFLR E+SEEN+LFW+ACE+LKKE+N  VIEEKAR IYEDYISILSPKE
Sbjct: 62  AGRNAFREFLRTEFSEENMLFWMACEELKKEANKSVIEEKARIIYEDYISILSPKE 117


>gnl|CDD|188698 cd08744, RGS_RGS17, Regulator of G protein signaling (RGS) domain
          found in the RGS17 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS17 protein, a member of  the RZ subfamily of the RGS
          protein family.  They are a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). As a major G-protein regulator, the
          RGS domain containing proteins are involved in many
          crucial cellular processes such as regulation of
          intracellular trafficking, glial differentiation,
          embryonic axis formation, skeletal and muscle
          development, and cell migration during early
          embryogenesis. RGS proteins play critical regulatory
          roles as GTPase activating proteins (GAPs) of the
          heterotrimeric G-protein G-alpha-subunits. Deactivation
          of the G-protein signaling controlled by the RGS
          domain, which accelerates GTPase activity of the alpha
          subunit by hydrolysis of GTP to GDP, results in
          reassociation of the alpha-subunit with the
          beta-gamma-dimer and inhibition of downstream activity.
          The RZ subfamily of RGS proteins includes RGS19 (former
          GAIP), RGS20, and its splice variant Ret-RGS. RGS17 is
          a relatively non-selective GAP for G-alpha-z and other
          G-alpha-i/o proteins. RGS17 blocks dopamine
          receptor-mediated inhibition of cAMP accumulation; it
          also blocks thyrotropin releasing hormone-stimulated
          Ca++ mobilization. RGS17, like other members of RZ
          subfamily, can act either as a GAP or as G-protein
          effector antogonist.
          Length = 118

 Score = 92.9 bits (230), Expect = 1e-26
 Identities = 49/56 (87%), Positives = 50/56 (89%)

Query: 13 AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          AGR LFREFLR EYSEEN+LFWLACEDLKKE N  VIEEKAR IYEDYISILSPKE
Sbjct: 13 AGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARLIYEDYISILSPKE 68


>gnl|CDD|188699 cd08745, RGS_RGS19, Regulator of G protein signaling (RGS) domain
          found in the RGS19 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS19 protein (also known as GAIP), a member of the RZ
          subfamily of the RGS protein family. They are a diverse
          group of multifunctional proteins that regulate
          cellular signaling events downstream of G-protein
          coupled receptors (GPCRs). RGS proteins play critical
          regulatory roles as GTPase activating proteins (GAPs)
          of the heterotrimeric G-protein G-alpha-subunits.
          Deactivation of G-protein signaling is controlled by
          RGS domains, which accelerate GTPase activity of the
          alpha subunit by hydrolysis of GTP to GDP, resulting in
          a reassociation of the alpha-subunit with the
          beta-gamma-dimer and an inhibition of downstream
          activity. As a major G-protein regulator, the RGS
          domain containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. The RZ subfamily
          of RGS proteins includes RGS17, RGS20, and its splice
          variant Ret-RGS. RGS19 participates in regulation of
          dopamine receptor D2R and D3R, as well as
          beta-adrenergic receptors .
          Length = 118

 Score = 92.8 bits (230), Expect = 1e-26
 Identities = 45/56 (80%), Positives = 50/56 (89%)

Query: 13 AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          AGR +FREFLR EYSEEN+LFWLACE+LK E+N  VI+EKAR IYEDYISILSPKE
Sbjct: 13 AGRNVFREFLRTEYSEENMLFWLACEELKAEANKHVIDEKARLIYEDYISILSPKE 68


>gnl|CDD|216023 pfam00615, RGS, Regulator of G protein signaling domain.  RGS
          family members are GTPase-activating proteins for
          heterotrimeric G-protein alpha-subunits.
          Length = 117

 Score = 68.0 bits (167), Expect = 8e-17
 Identities = 29/57 (50%), Positives = 40/57 (70%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          + GR+LFREFL  E+SEEN+ FWLACE+ KK  + +   +KAR IY  +++  SP E
Sbjct: 9  QPGRRLFREFLESEFSEENLEFWLACEEFKKAKSDEERLKKAREIYNKFLAPDSPSE 65


>gnl|CDD|188669 cd08714, RGS_RGS4, Regulator of G protein signaling (RGS) domain
          found in the RGS4 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS4 protein. RGS4 is a member of the R4/RGS subfamily
          of the RGS family, a diverse group of multifunctional
          proteins that regulate cellular signaling events
          downstream of G-protein coupled receptors (GPCRs). As a
          major G-protein regulator, RGS domain containing
          proteins are involved in many crucial cellular
          processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. RGS proteins play
          critical regulatory roles as GTPase activating proteins
          (GAPs) of the heterotrimeric G-protein G-alpha
          subunits. The RGS domain controls G-protein signaling
          by accelerating the GTPase activity of the G-alpha
          subunit which leads to G protein deactivation and
          promotes desensitization. RGS4 is expressed widely in
          brain including prefrontal cortex, striatum, locus
          coeruleus (LC), and hippocampus and has been implicated
          in regulation of opioid, cholinergic, and serotonergic
          signaling. Dysfunctions in RGS4 proteins are involved
          in etiology of Parkinson's disease, addiction, and
          schizophrenia. RGS4 also is up-regulated in the failing
          human heart. RGS4 interacts with many binding partners
          outside of GPCR pathways, including calmodulin, COP,
          Kir3, PIP, calcium/CaM, PA, ErbB3, and 14-3-3.
          Length = 114

 Score = 68.0 bits (166), Expect = 9e-17
 Identities = 29/55 (52%), Positives = 39/55 (70%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          G   F+ FL+ EYSEENI FW++CED KK  +P  +  KAR IYE++IS+ + KE
Sbjct: 10 GLAAFKAFLKSEYSEENIDFWVSCEDYKKTKSPSKLSPKARKIYEEFISVQATKE 64


>gnl|CDD|188668 cd08713, RGS_RGS3, Regulator of G protein signaling (RGS) domain
          found in the RGS3 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS3 protein. RGS3 is a member of the R4/RGS subfamily
          of the RGS family, a diverse group of multifunctional
          proteins that regulate cellular signaling events
          downstream of G-protein coupled receptors (GPCRs). As a
          major G-protein regulator, RGS domain containing
          proteins are involved in many crucial cellular
          processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. RGS proteins play
          critical regulatory roles as GTPase activating proteins
          (GAPs) of the heterotrimeric G-protein G-alpha
          subunits. The RGS domain controls G-protein signaling
          by accelerating the GTPase activity of the G-alpha
          subunit which leads to G protein deactivation and
          promotes desensitization. As a major G-protein
          regulator, RGS domain containing proteins are involved
          in many crucial cellular processes. RGS3 induces
          apoptosis when overexpressed and is involved in cell
          migration through interaction with the Ephrin receptor.
          RGS3 exits as several splice isoforms and interacts
          with neuroligin, estrogen receptor-alpha, and 14-3-3
          outside of the GPCR pathways.
          Length = 114

 Score = 65.7 bits (160), Expect = 7e-16
 Identities = 27/57 (47%), Positives = 39/57 (68%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          K G  +FR FL+ E+SEEN+ FWLACE+ KK  +   +  +A+ I+ +YI+I S KE
Sbjct: 8  KYGLAVFRAFLQTEFSEENLEFWLACEEYKKIKSQSKMASRAKKIFAEYIAIQSCKE 64


>gnl|CDD|188672 cd08717, RGS_RGS5, Regulator of G protein signaling (RGS) domain
          found in the RGS5 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS5 protein. RGS5 is member of the R4/RGS subfamily of
          the RGS family, a diverse group of multifunctional
          proteins that regulate cellular signaling events
          downstream of G-protein coupled receptors (GPCRs). RGS
          proteins play critical regulatory roles as GTPase
          activating proteins (GAPs) of the heterotrimeric
          G-protein G-alpha subunits. The RGS domain controls
          G-protein signaling by accelerating the GTPase activity
          of the G-alpha subunit which leads to G protein
          deactivation and promotes desensitization. As a major
          G-protein regulator, RGS domain containing proteins are
          involved in many crucial cellular processes such as
          regulation of intracellular trafficking, glial
          differentiation, embryonic axis formation, skeletal and
          muscle development, and cell migration during early
          embryogenesis.  Two splice isoforms of RGS5 has been
          found: RGS5L (long) which is expressed in smooth muscle
          cells (pericytes) and heart and RGS5S (short) which is
          highly expressed in the ciliary body of the eye,
          kidney, brain, spleen, skeletal muscle, and small
          intestine. Outside of the GPCR pathway, RGS5 interacts
          with the 14-3-3 protein.
          Length = 114

 Score = 63.1 bits (153), Expect = 6e-15
 Identities = 28/55 (50%), Positives = 37/55 (67%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          G   F+ FL+ E+SEENI FW ACED KK  +P  +  KA+ IYE++I   +PKE
Sbjct: 10 GLASFKSFLKSEFSEENIEFWEACEDYKKTKSPLKMATKAKKIYEEFIQTEAPKE 64


>gnl|CDD|214613 smart00315, RGS, Regulator of G protein signalling domain.  RGS
          family members are GTPase-activating proteins for
          heterotrimeric G-protein alpha-subunits.
          Length = 118

 Score = 62.7 bits (153), Expect = 1e-14
 Identities = 29/57 (50%), Positives = 38/57 (66%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
            GR LFREFL  E+SEEN+ FWLA E+ KK  + +    KAR IY+ ++S  +PKE
Sbjct: 9  PIGRLLFREFLESEFSEENLEFWLAVEEFKKAEDDEERIAKAREIYDKFLSPNAPKE 65


>gnl|CDD|188661 cd08706, RGS_R12-like, Regulator of G protein signaling (RGS)
          domain found in the R12 subfamily of proteins.  The RGS
          (Regulator of G-protein Signaling) domain is an
          essential part of the R12 (Neuronal RGS) protein
          subfamily of the RGS protein family, a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). RGS proteins play a critical
          regulatory role as GTPase activating proteins (GAPs) of
          the heterotrimeric G-protein G-alpha-subunits.
          Deactivation of G-protein signaling, controlled by RGS
          domain, accelerates GTPase activity of the alpha
          subunit by hydrolysis of GTP to GDP that results in
          reassociation of the alpha-subunit with the
          beta-gamma-dimer and thereby inhibition of downstream
          activity. As a major G-protein regulator, RGS domain
          containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. The R12 RGS
          subfamily includes RGS10, RGS12 and RGS14 all of which
          are highly selective for G-alpha-i1 over G-alpha-q.
          Length = 113

 Score = 61.2 bits (149), Expect = 4e-14
 Identities = 25/50 (50%), Positives = 34/50 (68%)

Query: 13 AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYIS 62
           G K F EFL+ E+SEENILFW ACE  KK  +   + ++AR IY+ ++S
Sbjct: 9  VGVKYFTEFLKKEFSEENILFWQACEKFKKIPDKKQLVQEAREIYDTFLS 58


>gnl|CDD|188667 cd08712, RGS_RGS18, Regulator of G protein signaling (RGS) domain
          found in the RGS18 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS18 protein.  RGS18 is a member of the RGS protein
          family, a diverse group of multifunctional proteins
          that regulate cellular signaling events downstream of
          G-protein coupled receptors (GPCRs). RGS proteins play
          critical regulatory roles as GTPase activating proteins
          (GAPs) of the heterotrimeric G-protein G-alpha
          subunits. The RGS domain controls G-protein signaling
          by accelerating the GTPase activity of the G-alpha
          subunit which leads to G protein deactivation and
          promotes desensitization. As a major G-protein
          regulator, RGS domain containing proteins are involved
          in many crucial cellular processes such as regulation
          of intracellular trafficking, glial differentiation,
          embryonic axis formation, skeletal and muscle
          development, and cell migration during early
          embryogenesis. RGS18 is a member of the R4/RGS
          subfamily and is expressed predominantly in osteoclasts
          where it acts as a negative regulator of the
          acidosis-induced osteoclastogenic OGR1/NFAT signaling
          pathway. RANKL (receptor activator of nuclear factor B
          ligand) stimulates osteoclastogenesis by inhibiting
          expression of RGS18.
          Length = 114

 Score = 59.6 bits (144), Expect = 1e-13
 Identities = 30/57 (52%), Positives = 37/57 (64%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          K G + F  FL+ E+SEENI FW+ACED KK   P  I  KA+ IYE +I   +PKE
Sbjct: 8  KDGLEAFTRFLKTEFSEENIEFWIACEDYKKSKTPQQIHLKAKAIYEKFIQTDAPKE 64


>gnl|CDD|188678 cd08723, RGS_RGS21, Regulator of G protein signaling (RGS) domain
          found in the RGS21 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part RGS21
          protein, a member of RGS protein family. They are a
          diverse group of multifunctional proteins that regulate
          cellular signaling events downstream of G-protein
          coupled receptors (GPCRs). RGS proteins play critical
          regulatory roles as GTPase activating proteins (GAPs)
          of the heterotrimeric G-protein G-alpha-subunits. As a
          major G-protein regulator, RGS domain containing
          proteins are involved in many crucial cellular
          processes. RGS proteins regulate many aspects of
          embryonic development such as glial differentiation,
          embryonic axis formation, skeletal and muscle
          development, cell migration during early embryogenesis,
          apoptosis, and cell proliferation, as well as
          modulation of cardiac development.  RGS21 is a member
          of the R4/RGS subfamily and its mRNA was detected only
          in sensory taste cells that express sweet taste
          receptors and the taste G-alpha subunit, gustducin,
          suggesting a potential role in regulating taste
          transduction.
          Length = 111

 Score = 59.3 bits (143), Expect = 2e-13
 Identities = 29/57 (50%), Positives = 38/57 (66%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          +AG   FR FL+ E+SEEN+ FWLACED KK  +   I  KA+ IY ++I   +PKE
Sbjct: 5  QAGLDAFRTFLKSEFSEENVEFWLACEDFKKTKSSTEIALKAQMIYSEFIQADAPKE 61


>gnl|CDD|188664 cd08709, RGS_RGS2, Regulator of G protein signaling (RGS) domain
          found in the RGS2 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS2 protein. RGS2 is a member of R4/RGS subfamily of
          RGS family, a diverse group of multifunctional proteins
          that regulate cellular signaling events downstream of
          G-protein coupled receptors (GPCRs). RGS proteins play
          critical regulatory roles as GTPase activating proteins
          (GAPs) of the heterotrimeric G-protein
          G-alpha-subunits. The RGS domain controls G-protein
          signaling by accelerating the GTPase activity of the G-
          alpha subunit which leads to G protein deactivation and
          promotes desensitization. As a major G-protein
          regulator, RGS domain containing proteins are involved
          in many crucial cellular processes such as regulation
          of intracellular trafficking, glial differentiation,
          embryonic axis formation, skeletal and muscle
          development, and cell migration during early
          embryogenesis. RGS2 plays important roles in the
          regulation of blood pressure and the pathogenesis of
          human hypertension, as well as in bone formation in
          osteoblasts. Outside of the GPCR pathway RGS2 interacts
          with calmodulin, beta- COP, tubulin, PKG1-alpha, and
          TRPV6.
          Length = 114

 Score = 58.9 bits (142), Expect = 3e-13
 Identities = 31/57 (54%), Positives = 38/57 (66%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          K G   FR FL+ E+SEENI FWLACED KK  +P  +  KA+ IY D+I   +PKE
Sbjct: 8  KYGVAAFRAFLKSEFSEENIEFWLACEDFKKTKSPQKLTSKAKKIYTDFIEKEAPKE 64


>gnl|CDD|188660 cd08705, RGS_R7-like, Regulator of G protein signaling (RGS)
          domain found in the R7 subfamily of proteins.  The RGS
          (Regulator of G-protein Signaling) domain is an
          essential part of the R7 (Neuronal RGS) protein
          subfamily of the RGS protein family, a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). As a major G-protein regulator, RGS
          domain containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. The R7 subfamily
          includes RGS6, RGS7, RGS9, and RGS11, all of which, in
          humans, are expressed predominantly in the nervous
          system, form an obligatory complex with G-beta-5, and
          play important roles in the regulation of crucial
          neuronal processes. In addition, R7 proteins were found
          to bind many other proteins outside of the G protein
          signaling pathways including: m-opioid receptor,
          beta-arrestin, alpha-actinin-2, NMDAR, polycystin,
          spinophilin, guanylyl cyclase, among others.
          Length = 121

 Score = 56.5 bits (137), Expect = 2e-12
 Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYIS 62
          GR+ F +FL  E+S EN+ FW AC+DLK      V  EK + IY+++++
Sbjct: 18 GREQFLKFLEKEFSGENLRFWEACQDLKYGPQSQV-PEKVQEIYQEFLA 65


>gnl|CDD|188659 cd07440, RGS, Regulator of G protein signaling (RGS) domain
          superfamily.  The RGS domain is an essential part of
          the Regulator of G-protein Signaling (RGS) protein
          family, a diverse group of multifunctional proteins
          that regulate cellular signaling events downstream of
          G-protein coupled receptors (GPCRs). RGS proteins play
          critical regulatory roles as GTPase activating proteins
          (GAPs) of the heterotrimeric G-protein
          G-alpha-subunits. While inactive, G-alpha-subunits bind
          GDP, which is released and replaced by GTP upon agonist
          activation. GTP binding leads to dissociation of the
          alpha-subunit and the beta-gamma-dimer, allowing them
          to interact with effectors molecules and propagate
          signaling cascades associated with cellular growth,
          survival, migration, and invasion. Deactivation of the
          G-protein signaling controlled by the RGS domain
          accelerates GTPase activity of the alpha subunit by
          hydrolysis of GTP to GDP, which results in the
          reassociation of the alpha-subunit with the
          beta-gamma-dimer and thereby inhibition of downstream
          activity. As a major G-protein regulator, RGS domain
          containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. RGS proteins are
          also involved in apoptosis and cell proliferation, as
          well as modulation of cardiac development. Several RGS
          proteins can fine-tune immune responses, while others
          play important roles in neuronal signals modulation.
          Some RGS proteins are principal elements needed for
          proper vision.
          Length = 113

 Score = 56.2 bits (136), Expect = 3e-12
 Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPD-VIEEKARFIYEDYISILSPKE 68
            G + FR+FL+ E+ EEN+ FWLA E  KK ++ D  ++ KA+ IY+ YIS  +PKE
Sbjct: 4  PYGLEYFRQFLKSEHCEENLEFWLAVEKFKKTTSSDEELKSKAKEIYDKYISKDAPKE 61


>gnl|CDD|188666 cd08711, RGS_RGS8, Regulator of G protein signaling (RGS) domain
          found in the RGS8 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS8 protein. RGS8 is a member of R4/RGS subfamily of
          RGS family, a diverse group of multifunctional proteins
          that regulate cellular signaling events downstream of
          G-protein coupled receptors (GPCRs). RGS proteins play
          critical regulatory roles as GTPase activating proteins
          (GAPs) of the heterotrimeric G-protein G-alpha
          subunits. The RGS domain controls G-protein signaling
          by accelerating the GTPase activity of the G-alpha
          subunit which leads to G protein deactivation and
          promotes desensitization. As a major G-protein
          regulator, RGS domain containing proteins are involved
          in many crucial cellular processes such as regulation
          of intracellular trafficking, glial differentiation,
          embryonic axis formation, skeletal and muscle
          development, and cell migration during early
          embryogenesis. RGS8 is involved in G-protein-gated
          potassium channels regulation and predominantly
          expressed in the brain. RGS8 also is selectively
          expressed in the hematopoietic system (NK cells).
          Length = 125

 Score = 54.7 bits (131), Expect = 1e-11
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 10 TFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          + K G   FR FL+ E+SEEN+ FWLACE+ KK  +   +  KA  I+E+++ + +P+E
Sbjct: 17 SHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE 75


>gnl|CDD|188670 cd08715, RGS_RGS1, Regulator of G protein signaling (RGS) domain
          found in the RGS1 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS1 protein. RGS1 is a member of the R4/RGS subfamily
          of the RGS family, a diverse group of multifunctional
          proteins that regulate cellular signaling events
          downstream of G-protein coupled receptors (GPCRs). RGS
          proteins play critical regulatory roles as GTPase
          activating proteins (GAPs) of the heterotrimeric
          G-protein G-alpha subunits. The RGS domain controls
          G-protein signaling by accelerating the GTPase activity
          of the G-alpha subunit which leads to G protein
          deactivation and promotes desensitization. As a major
          G-protein regulator, RGS domain containing proteins are
          involved in many crucial cellular processes such as
          regulation of intracellular trafficking, glial
          differentiation, embryonic axis formation, skeletal and
          muscle development, and cell migration during early
          embryogenesis.  RGS 1 is expressed predominantly in
          hematopoietic compartments, including T and B
          lymphocytes, and may play a major role in
          chemokine-mediated homing of lymphocytes to secondary
          lymphoid organs. In addition, RGS1 interacts with
          calmodulin and 14-3-3 protein outside of the GPCR
          pathway.
          Length = 114

 Score = 54.2 bits (130), Expect = 2e-11
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 1/50 (2%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYI 61
          + G+ +FR FL+ E+SEENI FWLACED KK +  D++  KA  IY++++
Sbjct: 8  QTGQNVFRSFLKSEFSEENIEFWLACEDYKK-TESDLLPCKAEEIYKEFV 56


>gnl|CDD|188695 cd08741, RGS_RGS10, Regulator of G protein signaling (RGS) domain
          found in the RGS10 protein.  RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS10 protein. RGS10 is a member of the RA/RGS
          subfamily of RGS proteins family, a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). As a major G-protein regulator, RGS
          domain containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. RGS10 belong to
          the R12 RGS subfamily, which includes RGS12 and RGS14,
          all of which are highly selective for G-alpha-i1 over
          G-alpha-q. RGS10 exists in 2 splice isoforms. RGS10A is
          specifically expressed in osteoclasts and is a key
          component in the RANKL signaling mechanism for
          osteoclast differentiation, whereas RGS10B expressed in
          brain and in immune tissues and  has been implicated in
          diverse processes including: promoting of  dopaminergic
          neuron survival via regulation of the microglial
          inflammatory response, modulation of presynaptic and
          postsynaptic G-protein signalling, as well as a
          possible role in regulation of gene expression.
          Length = 113

 Score = 53.5 bits (128), Expect = 3e-11
 Identities = 28/55 (50%), Positives = 39/55 (70%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          G K FREFL+ E+SEEN+LFWLACED KK  +   ++EKA+ IY  ++S  +  +
Sbjct: 10 GVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQ 64


>gnl|CDD|188665 cd08710, RGS_RGS16, Regulator of G protein signaling (RGS) domain
          found in the RGS16 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS16 protein. RGS16 is a member of the RGS protein
          family, a diverse group of multifunctional proteins
          that regulate cellular signaling events downstream of
          G-protein coupled receptors (GPCRs). RGS proteins play
          critical regulatory roles as GTPase activating proteins
          (GAPs) of the heterotrimeric G-protein G-alpha
          subunits. The RGS domain controls G-protein signaling
          by accelerating the GTPase activity of the G-alpha
          subunit which leads to G protein deactivation and
          promotes desensitization. As a major G-protein
          regulator, RGS domain containing proteins are involved
          in many crucial cellular processes such as regulation
          of intracellular trafficking, glial differentiation,
          embryonic axis formation, skeletal and muscle
          development, and cell migration during early
          embryogenesis. RGS16 is a member of the R4/RGS
          subfamily and interacts with neuronal G-alpha0. RGS16
          expression is upregulated by IL-17 of the NF-kappaB
          signaling pathway in autoimmune B cells.
          Length = 114

 Score = 52.0 bits (124), Expect = 2e-10
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          K G   F  FL+ E+SEEN+ FWLACE+ KK  +   +  +A  I+E++I   +PKE
Sbjct: 8  KNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFEEFIRSEAPKE 64


>gnl|CDD|188697 cd08743, RGS_RGS14, Regulator of G protein signaling (RGS) domain
          found in the RGS14 protein.  RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS14 protein. RGS14 is a member of the RA/RGS
          subfamily of RGS proteins family, a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). As a major G-protein regulator, RGS
          domain containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. RGS14 belong to
          the R12 RGS subfamily, which includes RGS10 and RGS12,
          all of which are highly selective for G-alpha-i1 over
          G-alpha-q.  RGS14 binds and regulates the subcellular
          localization and activities of H-Ras and Raf  kinases
          in cells and thereby integrates G protein and Ras/Raf
          signaling pathways.
          Length = 129

 Score = 45.8 bits (108), Expect = 5e-08
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKESNPDV--IEEKARFIYEDYIS 62
          G + F EFL+ E+S EN+ FW ACE  ++    D   + ++AR IY +++S
Sbjct: 20 GVEYFTEFLKKEFSAENVNFWKACERFQQIPASDTQQLAQEARKIYNEFLS 70


>gnl|CDD|188693 cd08739, RGS_RGS9, Regulator of G protein signaling (RGS) domain
          found in the RGS9 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS9 protein, a member of R7 subfamily of the RGS
          protein family. RGS is a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). As a major G-protein regulator, RGS
          domain containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis.  Other members of
          the R7 subfamily (Neuronal RGS) include: RGS6, RGS7,
          and RGS11, all of which are expressed predominantly in
          the nervous system, form an obligatory complex with
          G-beta-5, and play important roles in the regulation of
          crucial neuronal processes such as vision and motor
          control.  Additionally they have been implicated in
          many neurological conditions such as anxiety,
          schizophrenia, and drug dependence. RGS9 forms
          constitutive complexes with G-beta-5 subunit and
          controls such fundamental functions as vision and
          behavior. RGS9 exists in two splice isoforms: RGS9-1
          which regulates phototransduction in rods and cones and
          RGS9-2 which regulates dopamine and opioid signaling in
          the basal ganglia. In addition, RGS9 was found to bind
          many other proteins outside of G protein signaling
          pathways including: mu-opioid receptor, beta-arrestin,
          alpha-actinin-2, NMDAR, polycystin, spinophilin, and
          guanylyl cyclase, among others.
          Length = 121

 Score = 45.4 bits (107), Expect = 5e-08
 Identities = 22/54 (40%), Positives = 36/54 (66%), Gaps = 1/54 (1%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPK 67
          GR+ F+ FL+ E+S EN+ FW ACEDLK   +   ++EKA  IY+ +++  + +
Sbjct: 18 GRQSFQLFLKKEFSGENLGFWEACEDLKY-GDQSKVKEKAEEIYKLFLAPGARR 70


>gnl|CDD|188671 cd08716, RGS_RGS13, Regulator of G protein signaling (RGS) domain
          found in the RGS13 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS13 protein. RGS13 is member of the R4/RGS subfamily
          of the RGS family, a diverse group of multifunctional
          proteins that regulate cellular signaling events
          downstream of G-protein coupled receptors (GPCRs). RGS
          proteins play critical regulatory roles as GTPase
          activating proteins (GAPs) of the heterotrimeric
          G-protein G-alpha subunits. The RGS domain controls
          G-protein signaling by accelerating the GTPase activity
          of the G-alpha subunit which leads to G protein
          deactivation and promotes desensitization. As a major
          G-protein regulator, RGS domain containing proteins are
          involved in many crucial cellular processes such as
          regulation of intracellular trafficking, glial
          differentiation, embryonic axis formation, skeletal and
          muscle development, and cell migration during early
          embryogenesis.  RGS13 is predominantly expressed in T
          and B lymphocytes and in mast cells, and plays a role
          in adaptive immune responses. RGS13 also found in
          Rgs13, which is also expressed in dendritic cells and
          in neuroendocrine cells of the thymus,
          gastrointestinal, and respiratory tracts. Outside of
          the GPCR pathway, RGS5 interacts with the PIP3 protein.
          Length = 114

 Score = 43.0 bits (101), Expect = 5e-07
 Identities = 22/57 (38%), Positives = 34/57 (59%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          K G  ++  +L+ E+S+ENI FWLACE  KK ++       AR ++  YI   +P+E
Sbjct: 8  KYGPIIYATYLKTEHSDENIEFWLACETYKKIASQRKRISMARKLFASYIQPQAPRE 64


>gnl|CDD|188696 cd08742, RGS_RGS12, Regulator of G protein signaling (RGS) domain
          found in the RGS12 protein.  RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS12 protein. RGS12 is a member of the RA/RGS
          subfamily of RGS proteins family, a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). As a major G-protein regulator, RGS
          domain containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. RGS12 belong to
          the R12 RGS subfamily, which includes RGS10 and RGS14,
          all of which are highly selective for G-alpha-i1 over
          G-alpha-q.  RGS12 exist in multiple splice variants:
          RGS12s (short) contains the core RGS/RBD/GoLoco
          domains, while RGS12L (long) has additional N-terminal
          PDZ and PTB domains. RGS12 splice variants show
          distinct expression patterns, suggesting that they have
          discrete functions during mouse embryogenesis. RGS12
          also may play a critical role in coordinating
          Ras-dependent signals that are required for promoting
          and maintaining neuronal differentiation.
          Length = 115

 Score = 41.6 bits (97), Expect = 2e-06
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKK--ESNPDVIEEKARFIYEDYIS 62
          G + F EFLR E+SEENILFW ACE        +   +  +AR I+  ++ 
Sbjct: 10 GVRYFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLC 60


>gnl|CDD|188691 cd08737, RGS_RGS6, Regulator of G protein signaling (RGS) domain
          found in the RGS6 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS6 protein, a member of R7 subfamily of the RGS
          protein family. RGS is a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). Other members of the R7 subfamily
          (Neuronal RGS) include: RGS7, RGS9, and RGS11, all of
          which are expressed predominantly in the nervous
          system, form an obligatory complex with G-beta-5, and
          play important roles in the regulation of crucial
          neuronal processes such as vision and motor control.
          Additionally they have been implicated in many
          neurological conditions such as anxiety, schizophrenia,
          and drug dependence. RGS6 exists in multiple splice
          isoforms with identical RGS domains, but possess
          complete or incomplete GGL domains and distinct N- and
          C-terminal domains. RGS6 interacts with SCG10, a
          neuronal growth-associated protein and therefore
          regulates neuronal differentiation. Another
          RGS6-binding protein is DMAP1, a component of the Dnmt1
          complex involved in repression of newly replicated
          genes. Mutations of a critical residue required for
          interaction of RGS6 protein with G proteins did not
          affect the ability of RGS6 to interact with both SCG10
          and DMAP1. As a major G-protein regulator, RGS domain
          containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis.
          Length = 125

 Score = 41.2 bits (96), Expect = 3e-06
 Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYIS 62
          GR  F  FL  E+S EN+ FWLA +DLKK+   DV  ++   I++++++
Sbjct: 19 GRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDV-AKRVEEIWQEFLA 66


>gnl|CDD|188692 cd08738, RGS_RGS7, Regulator of G protein signaling (RGS) domain
          found in the RGS7 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS7 protein, a member of R7 subfamily of the RGS
          protein family. RGS is a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs).  As a major G-protein regulator, RGS
          domain containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. As a major
          G-protein regulator, RGS domain containing proteins are
          involved in many crucial cellular processes such as
          regulation of intracellular trafficking, glial
          differentiation, embryonic axis formation, skeletal and
          muscle development, and cell migration during early
          embryogenesis. Other members of the R7 subfamily
          (Neuronal RGS) include: RGS6, RGS9, and RGS11, all of
          which are expressed predominantly in the nervous
          system, form an obligatory complex with G-beta-5, and
          play important roles in the regulation of crucial
          neuronal processes such as vision and motor control.
          Additionally they have been implicated in many
          neurological conditions such as anxiety, schizophrenia,
          and drug dependence. R7 RGS proteins are key modulators
          of the pharmacological effects of drugs involved in the
          development of tolerance and addiction. In addition,
          RGS7 was found to bind a component of the synaptic
          fusion complex, snapin, and some other proteins outside
          of G protein signaling pathways.
          Length = 121

 Score = 38.9 bits (90), Expect = 2e-05
 Identities = 21/53 (39%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSP 66
          GR+ F +FL  E+S EN+ FWLA EDLKK    +V   + + I++++++  +P
Sbjct: 18 GREQFLKFLESEFSSENLRFWLAVEDLKKRPIREV-PSRVQEIWQEFLAPGAP 69


>gnl|CDD|188694 cd08740, RGS_RGS11, Regulator of G protein signaling (RGS) domain
          found in the RGS11 protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          RGS11 protein, a member of R7 subfamily of the RGS
          protein family. RGS is a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). As a major G-protein regulator, RGS
          domain containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. Other members of
          the R7 subfamily (Neuronal RGS) include: RGS6, RGS7,
          and RGS9, all of which are expressed predominantly in
          the nervous system, form an obligatory complex with
          G-beta-5, and play important roles in the regulation of
          crucial neuronal processes such as vision and motor
          control.  Additionally they have been implicated in
          many neurological conditions such as anxiety,
          schizophrenia, and drug dependence. RGS11 is expressed
          exclusively in retinal ON-bipolar neurons in which it
          forms complexes with G-beta-5  and  R7AP (RGS7 anchor
          protein ) and plays crucial roles in processing the
          light responses of retinal neurons.
          Length = 126

 Score = 38.4 bits (89), Expect = 3e-05
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYIS 62
          GRK F +FL  E+S EN+ FW ACE+L+       I E    +Y+ +++
Sbjct: 19 GRKEFLDFLEKEFSAENLSFWEACEELRYGEQSK-IPELVDSVYQQFLA 66


>gnl|CDD|188688 cd08734, RGS-like_1, Uncharacterized Regulator of G protein
          Signaling (RGS) domain subfamily, child 1.  These
          uncharacterized RGS-like domains consists largely of
          hypothetical proteins. The RGS domain is an essential
          part of the Regulator of G-protein Signaling (RGS)
          protein family, a diverse group of multifunctional
          proteins that regulate cellular signaling events
          downstream of G-protein coupled receptors (GPCRs). RGS
          proteins play critical regulatory role as GTPase
          activating proteins (GAPs) of the heterotrimeric
          G-protein G-alpha-subunits. As a major G-protein
          regulator, the RGS domain containing proteins that are
          involved in many crucial cellular processes. RGS
          proteins play critical regulatory role as GTPase
          activating proteins (GAPs) of the heterotrimeric
          G-protein G-alpha-subunits. RGS proteins regulate many
          aspects of embryonic development such as glial
          differentiation, embryonic axis formation, skeletal and
          muscle development, cell migration during early
          embryogenesis, as well as apoptosis, cell
          proliferation, and modulation of cardiac development.
          Several RGS proteins can fine-tune immune responses,
          while others play an important role in neuronal signal
          modulation. Some RGS proteins are the principal
          elements needed for proper vision.
          Length = 109

 Score = 37.4 bits (87), Expect = 5e-05
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 16 KLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
           LF      ++S EN+ F    ++ K+ SNP      A  IY+++IS  SP +
Sbjct: 6  PLFGFSAESDFSGENLSFLTLVKEYKRLSNPAEKFTLASKIYKEFISSESPFQ 58


>gnl|CDD|188662 cd08707, RGS_Axin, Regulator of G protein signaling (RGS) domain
          found in the Axin protein.  The RGS (Regulator of
          G-protein Signaling) domain is an essential part of the
          Axin protein. Axin is a member of the RA/RGS subfamily
          of the RGS protein family, a diverse group of
          multifunctional proteins that regulate cellular
          signaling events downstream of G-protein coupled
          receptors (GPCRs). As a major G-protein regulator, RGS
          domain containing proteins are involved in many crucial
          cellular processes such as regulation of intracellular
          trafficking, glial differentiation, embryonic axis
          formation, skeletal and muscle development, and cell
          migration during early embryogenesis. RGS proteins
          regulate many aspects of embryonic development such as
          glial differentiation, embryonic axis formation, and
          skeletal and muscle development. The RGS domain of Axin
          is specifically interacts with the heterotrimeric
          G-alpha12 protein, but not with closely related
          G-alpha13, and provides a unique tool to regulate
          G-alpha12-mediated signaling processes. The RGS domain
          of Axin also interacts with the tumor suppressor
          protein APC (Adenomatous Polyposis Coli) in order to
          control the cytoplasmic level of the proto-oncogene,
          beta-catenin.
          Length = 117

 Score = 37.1 bits (86), Expect = 9e-05
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLKKES-NPDVIEEKARFIYEDYI 61
          G +LFR +L  E   + + FW AC   +K S + +   + A+ IY  YI
Sbjct: 10 GIELFRTYLEQEGCADLLDFWFACNGFRKMSDSEEKRSKLAKAIYRRYI 58


>gnl|CDD|188683 cd08728, RGS-like_2, Uncharacterized Regulator of G protein
          Signaling (RGS) domain subfamily, child 2.  These
          uncharacterized RGS-like domains consists largely of
          hypothetical proteins. The RGS domain is an essential
          part of the Regulator of G-protein Signaling (RGS)
          protein family, a diverse group of multifunctional
          proteins that regulate cellular signaling events
          downstream of G-protein coupled receptors (GPCRs). RGS
          proteins regulate many aspects of embryonic development
          such as glial differentiation, embryonic axis
          formation, skeletal and muscle development, cell
          migration during early embryogenesis, as well as
          apoptosis, cell proliferation, and modulation of
          cardiac development. Several RGS proteins can fine-tune
          immune responses, while others play an important role
          in neuronal signal modulation. Some RGS proteins are
          the principal elements needed for proper vision.
          Length = 179

 Score = 33.3 bits (76), Expect = 0.004
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 18 FREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          F+ FL+   S+  +LFW+A E ++ E N    + K   I + Y     P  
Sbjct: 10 FKRFLKSRGSDGPLLFWIAVEKMRVEENEKEQKAKIELIVKRYFHGQDPPG 60


>gnl|CDD|188663 cd08708, RGS_FLBA, Regulator of G protein signaling (RGS) domain
          found in the FLBA (Fluffy Low BrlA) protein.  The RGS
          (Regulator of G-protein Signaling) domain is an
          essential part of the FLBA (Fluffy Low BrlA) protein.
          FLBA is a member of the RGS protein family, a diverse
          group of multifunctional proteins that regulate
          cellular signaling events downstream of G-protein
          coupled receptors (GPCRs). As a major G-protein
          regulator, RGS domain containing proteins are involved
          in many crucial cellular processes such as regulation
          of intracellular trafficking, glial differentiation,
          embryonic axis formation, skeletal and muscle
          development, and cell migration during early
          embryogenesis. RGS proteins play a critical regulatory
          role as GTPase activating proteins (GAPs) of the
          heterotrimeric G-protein G-alpha-subunits. Deactivation
          of the G-protein signaling controlled by the RGS domain
          accelerates the GTPase activity of the alpha subunit by
          hydrolysis of GTP to GDP which results in reassociation
          of the alpha-subunit with the beta-gamma-dimer and
          thereby inhibition of downstream activity. As a major
          G-protein regulator, RGS domain containing proteins are
          involved in many crucial cellular processes. The RGS
          domain of the FLBA protein antagonizes G protein
          signaling to block proliferation and allow development.
          It is required for control of mycelial proliferation
          and activation of asexual sporulation in yeast.
          Length = 148

 Score = 30.4 bits (69), Expect = 0.028
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 15 RKLFREFLRCEYSEENILFWLACEDLKK 42
          R LFRE L  E+ EEN+ F+L  ++  K
Sbjct: 12 RYLFREHLEKEFCEENLSFYLEVKEFLK 39


>gnl|CDD|226503 COG4016, COG4016, Uncharacterized protein conserved in archaea
           [Function unknown].
          Length = 165

 Score = 29.1 bits (65), Expect = 0.11
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 5   KRTRNTFKAGRKLFREFLRCEY 26
           +R +N  + G K F E L+ EY
Sbjct: 143 ERQKNGIEKGLKRFLEILKKEY 164


>gnl|CDD|183684 PRK12689, flgF, flagellar basal body rod protein FlgF; Reviewed.
          Length = 253

 Score = 28.9 bits (65), Expect = 0.13
 Identities = 10/22 (45%), Positives = 13/22 (59%)

Query: 9  NTFKAGRKLFREFLRCEYSEEN 30
          N FKA   LF+E+L     E+N
Sbjct: 32 NGFKARSSLFQEYLMPGAHEDN 53


>gnl|CDD|188681 cd08726, RGS_RGS22_3, Regulator of G protein signaling domain
          RGS_RGS22_3.  The RGS (Regulator of G-protein
          Signaling) domain found in the RGS22 protein, a member
          of the RA/RGS subfamily of the RGS protein family. They
          are a diverse group of multifunctional proteins that
          regulate cellular signaling events downstream of
          G-protein coupled receptors (GPCRs). RGS proteins
          regulate many aspects of embryonic development such as
          glial differentiation, embryonic axis formation,
          skeletal and muscle development, cell migration during
          early embryogenesis, as well as apoptosis, cell
          proliferation, and modulation of cardiac development.
          RGS22 contains at least 3 copies of the RGS domain in
          vertebrata and exists in multiple splicing variants.
          RGS22 is predominantly expressed in testis and believed
          to play an important role in spermatogenesis.
          Length = 130

 Score = 25.1 bits (55), Expect = 2.3
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 18 FREFLRCEYSEENILFWLACEDLKKESNPD--VIEEKARFIYEDYI 61
          FR+FL    +  ++L WL  E  ++  + D    +EKA+ I   Y+
Sbjct: 14 FRKFLEENSASMDLLCWLDIEQFRRIPHTDNAKRDEKAKEIKNKYL 59


>gnl|CDD|220776 pfam10483, Hap2_elong, Histone acetylation protein 2.  Hap2 is
          one of three histone acetyltransferases proteins that,
          in yeasts, are found associated with elongating forms
          of RNA polymerase II (Elongator). The Haps can be
          isolated in two forms, as a six-subunit complex with
          Elongator and as a complex of the three proteins on
          their own. The role of the Hap complex in transcription
          is still speculative, being possibly to keep the HAT
          activity of free Elongator in check, allowing histone
          acetylation only in the presence of a transcribing
          polymerase, or the interaction with Haps might render
          Elongator susceptible to modifications thereby altering
          its activity.
          Length = 280

 Score = 25.4 bits (56), Expect = 2.4
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 14 GRKLFREFL-RCEYSEENILFWLACEDLKKESNPD 47
           R L REF+ R +  +E ++F L+ E L K    D
Sbjct: 25 ARPLLREFIRRAKLRKEKVIF-LSFETLNKPEGAD 58


>gnl|CDD|188679 cd08724, RGS_GRK-like, Regulator of G protein signaling domain
          (RGS) found in G protein-coupled receptor kinase (GRK).
           The RGS domain is found in G protein-coupled receptor
          kinases (GRKs).  These proteins play a key role in
          phosphorylation-dependent
          desensitization/resensitization of GPCRs (G
          protein-coupled receptors), intracellular trafficking,
          endocytosis, as well as in the modulation of important
          intracellular signaling cascades by GPCR. GRKs also
          modulate cellular response in
          phosphorylation-independent manner using their ability
          to interact with multiple signaling proteins involved
          in many essential cellular pathways. The RGS domain of
          the GRKs has very little sequence similarity with the
          canonical RGS domain of the RGS proteins and therefore
          is often refered to as the RH (RGS Homology) domain.
          Based on sequence homology the GRK family consists of
          three major subfamilies: the GRK4 subfamily (GRK4, GRK5
          and GRK6), the rhodopsin kinase or visual GRK subfamily
          (GRK1 and GRK7), and the beta-adrenergic receptor
          kinases subfamily (GRK2/GRK3). RGS proteins regulate
          many aspects of embryonic development such as glial
          differentiation, embryonic axis formation, skeletal and
          muscle development, cell migration during early
          embryogenesis, as well as apoptosis, cell
          proliferation, and modulation of cardiac development.
          Length = 114

 Score = 24.8 bits (55), Expect = 2.5
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 10/54 (18%)

Query: 14 GRKLFREFLRCEYSEEN---ILFWLACEDLKK-ESNPDVIE-EKARFIYEDYIS 62
          GR LFR+F  CE   E    I F    +++K+ E   D    +KAR IY+ YI 
Sbjct: 8  GRLLFRQF--CETRPELVPQIEFL---DEIKEYEVAEDEERAKKAREIYDKYIM 56


>gnl|CDD|188675 cd08720, RGS_SNX25, Regulator of G protein signaling (RGS) domain
          found in the Sorting Nexin 25 (SNX25) protein.  The RGS
          (Regulator of G-protein Signaling) domain is an
          essential part of the SNX25 (Sorting Nexin 25) protein,
          a member of  the RGS protein family. They are a diverse
          group of multifunctional proteins that regulate
          cellular signaling events downstream of G-protein
          coupled receptors (GPCRs). RGS proteins regulate many
          aspects of embryonic development such as glial
          differentiation, embryonic axis formation, skeletal and
          muscle development, cell migration during early
          embryogenesis, as well as apoptosis, cell
          proliferation, and modulation of cardiac development.
          SNX25 is a member of the Dopamine receptors (DAR)
          signalplex and regulates the trafficking of D1 and D2
          DARs.
          Length = 110

 Score = 25.1 bits (55), Expect = 2.8
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 14 GRKLFREFLRCEYSEENILFWLACEDLK 41
          GRK   +FL    S+  I FW A E+L+
Sbjct: 7  GRKYLSQFLERMDSQALIGFWEAVEELR 34


>gnl|CDD|111994 pfam03158, DUF249, Multigene family 530 protein.  Members of this
          family are multigene family 530 proteins from African
          swine fever viruses. These proteins may be involved in
          promoting survival of infected macrophages.
          Length = 192

 Score = 25.0 bits (55), Expect = 3.5
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 18 FREFLRCEYSEENILFWLACEDLKKE 43
          ++E L        +LF LACE+ K +
Sbjct: 65 YKEDLSGHLYLTQLLFELACEERKYD 90


>gnl|CDD|188676 cd08721, RGS_AKAP2_2, Regulator of G protein signaling (RGS)
          domain 2 found in the A-kinase anchoring protein,
          D-AKAP2.  The RGS (Regulator of G-protein Signaling)
          domain is an essential part of the D-AKAP2 (A-kinase
          anchoring protein), a member of the RGS protein family.
          They are a diverse group of multifunctional proteins
          that regulate cellular signaling events downstream of
          G-protein coupled receptors (GPCRs). RGS proteins
          regulate many aspects of embryonic development such as
          glial differentiation, embryonic axis formation,
          skeletal and muscle development, cell migration during
          early embryogenesis, as well as apoptosis, cell
          proliferation, and modulation of cardiac development.
          D-AKAP2 contains two RGS domains which play an
          important role in spatiotemporal localization of
          cAMP-dependent PKA (cyclic AMP-dependent protein
          kinase) that regulates many different signaling
          pathways by phosphorylation of target proteins. This cd
          contains the second RGS domain.
          Length = 121

 Score = 24.6 bits (54), Expect = 3.8
 Identities = 12/56 (21%), Positives = 25/56 (44%), Gaps = 7/56 (12%)

Query: 18 FREFLRCEYSEENILFWLACEDLKK-------ESNPDVIEEKARFIYEDYISILSP 66
          F E++  E +   + FWLA ++ +        + +    +  A  IY+ Y S+ + 
Sbjct: 11 FMEYMEQEGARNLLQFWLAADNFQSQLAAKEGQYDGQQAQNDAMIIYDKYFSLQAT 66


>gnl|CDD|179185 PRK00962, PRK00962, hypothetical protein; Provisional.
          Length = 165

 Score = 24.2 bits (53), Expect = 6.0
 Identities = 9/23 (39%), Positives = 13/23 (56%)

Query: 4   IKRTRNTFKAGRKLFREFLRCEY 26
           +KR +N  +   K F E L+ EY
Sbjct: 140 LKRQKNGIEKALKKFLEILKKEY 162


>gnl|CDD|222883 PHA02572, nrdA, ribonucleoside-diphosphate reductase subunit alpha;
           Provisional.
          Length = 753

 Score = 23.9 bits (52), Expect = 8.4
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 54  RFIYEDYISILSPKE 68
           RFI  DYI++ SP +
Sbjct: 344 RFIKNDYITLFSPHD 358


>gnl|CDD|203389 pfam06093, Spt4, Spt4/RpoE2 zinc finger.  This family consists of
          several eukaryotic transcription elongation Spt4
          proteins as well as archaebacterial RpoE2. Three
          transcription-elongation factors Spt4, Spt5, and Spt6
          are conserved among eukaryotes and are essential for
          transcription via the modulation of chromatin
          structure. Spt4 and Spt5 are tightly associated in a
          complex, while the physical association of the
          Spt4-Spt5 complex with Spt6 is considerably weaker. It
          has been demonstrated that Spt4, Spt5, and Spt6 play
          roles in transcription elongation in both yeast and
          humans including a role in activation by Tat. It is
          known that Spt4, Spt5, and Spt6 are general
          transcription-elongation factors, controlling
          transcription both positively and negatively in
          important regulatory and developmental roles. RpoE2 is
          one of 13 subunits in the archaeal RNA polymerase.
          These proteins contain a C4-type zinc finger, and the
          structure has been solved in. The structure reveals
          that Spt4-Spt5 binding is governed by an acid-dipole
          interaction between Spt5 and Spt4, and the complex
          binds to and travels along the elongating RNA
          polymerase. The Spt4-Spt5 complex is likely to be an
          ancient, core component of the transcription elongation
          machinery.
          Length = 77

 Score = 23.1 bits (50), Expect = 9.9
 Identities = 8/32 (25%), Positives = 17/32 (53%)

Query: 37 CEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          CE L  + + + + E     +E  ++IL P++
Sbjct: 24 CEFLHMKGDRERVSECTSENFEGLVAILDPEK 55


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.323    0.139    0.418 

Gapped
Lambda     K      H
   0.267   0.0750    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,566,500
Number of extensions: 265414
Number of successful extensions: 306
Number of sequences better than 10.0: 1
Number of HSP's gapped: 303
Number of HSP's successfully gapped: 52
Length of query: 68
Length of database: 10,937,602
Length adjustment: 39
Effective length of query: 29
Effective length of database: 9,207,796
Effective search space: 267026084
Effective search space used: 267026084
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.2 bits)