Diaphorina citri psyllid: psy16727


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MWRRYYLGTYLVSRKIQEVGVYIASLMGLGDVIAQSLAVHNFTSLMGLGDVIAQTFIDGKQLTQINPMRTLQYSVVGLVVGPTVGKWYRILEGIYGKEAVVKKVLTDQLIFSPVFIAILVTSLNLLQGLSWDEAVTKVQNSYFDILLTGYQIWPAVQVVNFYFIPIQYRVLLVQAVAVVWNTYLSWKLNSTTVEATLTSALAKELTSKSQ
cHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHcHHHHHHcccccc
MWRRYYLGTYLVSRKIQEVGVYIASLMGLGDVIAQSLAVHNFTSLMGLGDVIAQTFIDGKQLTQINPMRTLQYSVVGLVVGPTVGKWYRILEGIYGKEAVVKKVLTDQLIFSPVFIAILVTSLNLLQGLSWDEAVTKVQNSYFDILLTGYQIWPAVQVVNFYFIPIQYRVLLVQAVAVVWNTYLSWKLNS********************
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWRRYYLGTYLVSRKIQEVGVYIASLMGLGDVIAQSLAVHNFTSLMGLGDVIAQTFIDGKQLTQINPMRTLQYSVVGLVVGPTVGKWYRILEGIYGKEAVVKKVLTDQLIFSPVFIAILVTSLNLLQGLSWDEAVTKVQNSYFDILLTGYQIWPAVQVVNFYFIPIQYRVLLVQAVAVVWNTYLSWKLNSTTVEATLTSALAKELTSKSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein Mpv17 Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.confidentQ5BK62
Protein SYM1 May be involved in cellular response to stress. Required to maintain mitochondrial DNA (mtDNA) integrity and stability.confidentQ4IPX8
Protein SYM1 May be involved in cellular response to stress. Required to maintain mitochondrial DNA (mtDNA) integrity and stability.confidentQ6BMY0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0072593 [BP]reactive oxygen species metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted