Diaphorina citri psyllid: psy16739

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MPTHYAIACWCYVISGLLDAIDGHAARYFNQSYGRIVLALISFYFMPTHYAIACWCYVISGLLDAIDGHAARYFNQSTKFGAMLDQLTDRVGTMCLCVTLSTFYPKYQFLFQLSMAIDIACHWIYLHSN
cccccHHHHHHHHHHccccHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccc
**THYAIACWCYVISGLLDAIDGHAARYFNQSYGRIVLALISFYFMPTHYAIACWCYVISGLLDAIDGHAARYFNQSTKFGAMLDQLTDRVGTMCLCVTLSTFYPKYQFLFQLSMAIDIACHWIYLHSN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTHYAIACWCYVISGLLDAIDGHAARYFNQSYGRIVLALISFYFMPTHYAIACWCYVISGLLDAIDGHAARYFNQSTKFGAMLDQLTDRVGTMCLCVTLSTFYPKYQFLFQLSMAIDIACHWIYLHSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CDP-diacylglycerol--inositol 3-phosphatidyltransferase Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.confidentQ8VDP6
CDP-diacylglycerol--inositol 3-phosphatidyltransferase Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.confidentP70500
CDP-diacylglycerol--inositol 3-phosphatidyltransferase Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.confidentO14735

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046341 [BP]CDP-diacylglycerol metabolic processprobableGO:0044238, GO:0006644, GO:0006650, GO:0009987, GO:0044710, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0046486, GO:0044255, GO:0006629
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030145 [MF]manganese ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0008654 [BP]phospholipid biosynthetic processprobableGO:0071704, GO:1901576, GO:0006644, GO:0006629, GO:0044238, GO:0009987, GO:0006796, GO:0044237, GO:0044249, GO:0009058, GO:0044710, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044255, GO:0090407, GO:0008610

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted