Diaphorina citri psyllid: psy1673


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MYGLLYLMATSPNVTISTVTSVLGYCLLPMVVLAGVNVILSLQGAVGLSLTILTVLWCAMSASKLLVTCFAMSHQQPLVAYPCAILYSVFALITFVTMSTVLTPFVSRGAVGLSLTILTVLWCAMSASKLLVTCFAMSHQQPLVAYPCAILYSVFALITVF
cEEHHHcccccccCEEEEEEEEEcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcc
MYGLLYLMATSPNVTISTVTSVLGYCLLPMVVLAGVNVILSLQGAVGLSLTILTVLWCAMSASKLLVTCFAMSHQQPLVAYPCAILYSVFALITFVTMSTVLTPFVSRGAVGLSLTILTVLWCAMSASKLLVTCFAMSHQQPLVAYPCAILYSVFALITVF
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYGLLYLMATSPNVTISTVTSVLGYCLLPMVVLAGVNVILSLQGAVGLSLTILTVLWCAMSASKLLVTCFAMSHQQPLVAYPCAILYSVFALITFVTMSTVLTPFVSRGAVGLSLTILTVLWCAMSASKLLVTCFAMSHQQPLVAYPCAILYSVFALITVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein YIPF5 Plays a role in transport between endoplasmic reticulum and Golgi.confidentQ9EQQ2
Protein YIPF5 Plays a role in transport between endoplasmic reticulum and Golgi.confidentQ5R6W5
Protein YIPF5 Plays a role in transport between endoplasmic reticulum and Golgi.confidentQ5E9E8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042175 [CC]nuclear outer membrane-endoplasmic reticulum membrane networkprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425
GO:0070971 [CC]endoplasmic reticulum exit siteprobableGO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030134 [CC]ER to Golgi transport vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0030133, GO:0005622, GO:0030135, GO:0043226, GO:0031982

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted