RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy16764
         (113 letters)



>gnl|CDD|132748 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding domain of
           Tailless-like proteins,  orphan nuclear receptors.  The
           ligand binding domain of the photoreceptor cell-specific
           nuclear receptor (PNR)  like family: This family
           includes photoreceptor cell-specific nuclear receptor
           (PNR), Tailless (TLX), and related receptors. TLX is an
           orphan receptor that is expressed by neural
           stem/progenitor cells in the adult brain of the
           subventricular zone (SVZ) and the dentate gyrus (DG). It
           plays a key role in neural development by promoting cell
           cycle progression and preventing apoptosis in the
           developing brain. PNR is expressed only in the outer
           layer of retinal photoreceptor cells. It may be involved
           in the signaling pathway regulating photoreceptor
           differentiation and/or maintenance. Like other members
           of the nuclear receptor (NR) superfamily of
           ligand-activated transcription factors, TLX and PNR
           have  a central well conserved DNA binding domain (DBD),
           a variable N-terminal domain, a flexible hinge and a
           C-terminal ligand binding domain (LBD).
          Length = 206

 Score = 69.6 bits (171), Expect = 5e-16
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 6/70 (8%)

Query: 33  VRFKTGSKFT------AAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVL 86
           V FK  ++         A+Q   Q+ LNK+I T YP+QP RF K+ L+LP L+ I S  +
Sbjct: 136 VLFKPETRGLKDPAQVEALQDQAQLMLNKHIRTRYPTQPARFGKLLLLLPSLRFISSSTI 195

Query: 87  EELFFRNIIG 96
           EELFF+  IG
Sbjct: 196 EELFFKKTIG 205


>gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin
           upstream promoter transcription factors, a member of the
           nuclear receptor family.  The ligand binding domain of
           chicken ovalbumin upstream promoter transcription
           factors (COUP-TFs): COUP-TFs are orphan members of the
           steroid/thyroid hormone receptor superfamily. They are
           expressed in many tissues and are involved in the
           regulation of several important biological processes,
           such as neurogenesis, organogenesis, cell fate
           determination, and metabolic homeostasis. In mammals two
           isoforms named COUP-TFI and COUP-TFII have been
           identified. Both genes show an exceptional homology and
           overlapping expression patterns, suggesting that they
           may serve redundant functions. Although COUP-TF was
           originally characterized as a transcriptional activator
           of the chicken ovalbumin gene, COUP-TFs are generally
           considered to be repressors of transcription for other
           nuclear hormone receptors, such as retinoic acid
           receptor (RAR), thyroid hormone receptor (TR), vitamin D
           receptor (VDR), peroxisome proliferator activated
           receptor (PPAR), and hepatocyte nuclear factor 4 (HNF4).
           Like other members of the nuclear receptor (NR)
           superfamily of ligand-activated transcription factors,
           COUP-TFs  have  a central well cons erved DNA binding
           domain (DBD), a variable N-terminal domain, a flexible
           hinge and a C-terminal ligand binding domain (LBD).
          Length = 236

 Score = 57.5 bits (139), Expect = 3e-11
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 44  AIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKK 103
           ++Q  +Q  L +Y+ T YP+QPTRF K+ L LP L+++ S V+E+LFF  ++G  T I+ 
Sbjct: 159 SLQEKSQCALEEYVRTQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVG-KTPIET 217

Query: 104 TIWHM 108
            I  M
Sbjct: 218 LIRDM 222


>gnl|CDD|132749 cd06951, NR_LBD_Dax1_like, The ligand binding domain of DAX1
           protein, a nuclear receptor lacking DNA binding domain. 
           The ligand binding domain of DAX1-like proteins: This
           orphan nuclear receptor family includes  DAX1
           (dosage-sensitive sex reversal adrenal hypoplasia
           congenita critical region on chromosome X gene 1) and
           the Small Heterodimer Partner (SHP). Both receptors have
           a typical ligand binding domain, but lack the DNA
           binding domain, typical to almost all of the nuclear
           receptors. They function as a transcriptional
           coregulator by directly interacting with other nuclear
           receptors. DAX1 and SHP can form heterodimers with each
           other, as well as with many other nuclear receptors. In
           addition, DAX1 can also form homodimers. DAX1 plays an
           important role in the normal development of several
           hormone-producing tissues.  SHP has shown to regulate a
           variety of target genes.
          Length = 222

 Score = 53.7 bits (129), Expect = 6e-10
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 40  KFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIG 96
            +  A+Q   Q  LN++     P +  R  ++ L+L  L+ I +  + ELFFR IIG
Sbjct: 156 HYIEALQKEAQQALNEHTMMTRPLEQLRSARLLLMLSLLRGIKTEPVTELFFRPIIG 212


>gnl|CDD|132763 cd07349, NR_LBD_SHP, The ligand binding domain of DAX1 protein, a
           nuclear receptor lacking DNA binding domain.  The ligand
           binding domain of the Small Heterodimer Partner (SHP):
           SHP is a member of the nuclear receptor superfamily. SHP
           has a ligand binding domain, but lacks the DNA binding
           domain, typical to almost all of the nuclear receptors.
           It functions as a transcriptional coregulator by
           directly interacting with other nuclear receptors
           through its AF-2 motif. The closest relative of SHP is
           DAX1 and they can form heterodimer. SHP is an orphan
           receptor, lacking an identified ligand.
          Length = 222

 Score = 47.1 bits (112), Expect = 2e-07
 Identities = 22/60 (36%), Positives = 31/60 (51%)

Query: 37  TGSKFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIG 96
           T S     +Q   Q  L + +  ++P    RF +I L    LKSIP  ++ +LFFR IIG
Sbjct: 151 TASSHVGHLQQEAQWALCEVLEPLHPQDQGRFARILLTASTLKSIPPSLITDLFFRPIIG 210


>gnl|CDD|132750 cd06952, NR_LBD_TR2_like, The ligand binding domain of the orphan
           nuclear receptors TR4 and TR2.  The ligand binding
           domain of the TR4 and TR2 (human testicular receptor 4
           and 2):  TR4 and TR2 are orphan nuclear receptors.
           Several isoforms of TR4 and TR2 have been isolated in
           various tissues. TR2 is abundantly expressed in the
           androgen-sensitive prostate. TR4 transcripts are
           expressed in many tissues, including central nervous
           system, adrenal gland, spleen, thyroid gland, and
           prostate. The expression of TR2 is negatively regulated
           by androgen, retinoids, and radiation. The expression of
           both mouse TR2 and TR4 is up-regulated by neurocytokine
           ciliary neurotrophic factor (CNTF) in mouse. It has
           shown that human TR2 binds to a wide spectrum of natural
           hormone response elements (HREs) with distinct
           affinities suggesting that TR2 may cross-talk with other
           gene expression regulation systems. The genes responding
           to TR2 or TR4 include genes that are regulated by
           retinoic acid receptor, vitamin D receptor, peroxisome
           proliferator-activated receptor. TR4/2 binds to HREs as
           a dimer. Like other members of the nuclea r receptor
           (NR) superfamily of ligand-activated transcription
           factors, TR2-like receptors  have  a central well
           conserved DNA binding domain (DBD), a variable
           N-terminal domain, a flexible hinge and a C-terminal
           ligand binding domain (LBD).
          Length = 222

 Score = 44.2 bits (105), Expect = 2e-06
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 53  LNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIG 96
           L  Y+   YP    R  K+ L LP L+S+   + EELFF  +IG
Sbjct: 165 LRDYVGKTYPEDEYRLSKLLLRLPPLRSLSPAITEELFFAGLIG 208


>gnl|CDD|132764 cd07350, NR_LBD_Dax1, The ligand binding domain of DAX1 protein, a
           nuclear receptor lacking DNA binding domain.  The ligand
           binding domain of the DAX1 protein: DAX1
           (dosage-sensitive sex reversal adrenal hypoplasia
           congenita critical region on chromosome X gene 1) is a
           nuclear receptor with a typical ligand binding domain,
           but lacks the   DNA binding domain. DAX1 plays an
           important role in the normal development of several
           hormone-producing tissues. Duplications of the region of
           the X chromosome containing DAX1 cause dosage sensitive
           sex reversal. DAX1 acts as a global repressor of many
           nuclear receptors, including SF-1, LRH-1, ERR, ER, AR
           and PR. DAX1 can form homodimer and heterodimerizes with
           its alternatively spliced isoform DAX1A and other
           nuclear receptors such as SHP, ERalpha and SF-1.
          Length = 232

 Score = 43.3 bits (102), Expect = 5e-06
 Identities = 19/57 (33%), Positives = 33/57 (57%)

Query: 40  KFTAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIG 96
           ++   +Q   Q  LN+++  ++     RF K+ + L  L++I + V+ ELFFR IIG
Sbjct: 166 QYIQGLQWEAQQALNEHVRMIHRGDQARFAKLNIALSLLRAINANVIAELFFRPIIG 222


>gnl|CDD|132741 cd06943, NR_LBD_RXR_like, The ligand binding domain of the retinoid
           X receptor and Ultraspiracle, members of nuclear
           receptor superfamily.  The ligand binding domain of the
           retinoid X receptor (RXR) and Ultraspiracle (USP): This
           family includes two evolutionary related nuclear
           receptors: retinoid X receptor (RXR) and Ultraspiracle
           (USP). RXR is a nuclear receptor in mammalian and USP is
           its counterpart in invertebrates.  The native ligand of
           retinoid X receptor is 9-cis retinoic acid (RA). RXR
           functions as a DNA binding partner by forming
           heterodimers with other nuclear receptors including CAR,
           FXR, LXR, PPAR, PXR, RAR, TR, and VDR. RXRs can play
           different roles in these heterodimers. It acts  either
           as a structural component of the heterodimer complex,
           required for DNA binding but not acting as a receptor or
           as both a structural and a functional component of the
           heterodimer, allowing 9-cis RA to signal through the
           corresponding heterodimer. In addition, RXR can also
           form homodimers, functioning as a receptor for 9-cis RA,
           independently of other nuclear receptors. Ultraspiracle
           (USP) plays similar roles as DNA binding partner of
           other nuclear rec eptors in invertebrates. USP has no
           known high-affinity ligand and is thought to be a silent
           component in the heterodimeric complex with partner
           receptors. Like other members of the nuclear receptor
           (NR) superfamily of ligand-activated transcription
           factors, RXR and USP  have a central well conserved DNA
           binding domain (DBD), a variable N-terminal domain, a
           flexible hinge and a C-terminal ligand binding domain
           (LBD).
          Length = 207

 Score = 41.5 bits (98), Expect = 2e-05
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 53  LNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFF 91
           L +Y    +P QP RF K+ L LP L+SI    LE LFF
Sbjct: 167 LEEYCRQKHPEQPGRFAKLLLRLPALRSIGLKCLEHLFF 205


>gnl|CDD|132729 cd06931, NR_LBD_HNF4_like, The ligand binding domain of heptocyte
           nuclear factor 4, which is explosively expanded in
           nematodes.  The ligand binding domain of hepatocyte
           nuclear factor 4 (HNF4) like proteins: HNF4 is a member
           of the nuclear receptor superfamily. HNF4 plays a key
           role in establishing and maintenance of hepatocyte
           differentiation in the liver. It is also expressed in
           gut, kidney, and pancreatic beta cells. HNF4 was
           originally classified as an orphan receptor, but later
           it is found that HNF4 binds with very high affinity to a
           variety of fatty acids. However, unlike other nuclear
           receptors, the ligands do not act as a molecular switch
           for HNF4. They seem to constantly bind to the receptor,
           which is constitutively active as a transcription
           activator. Like other members of the nuclear receptor
           (NR) superfamily of ligand-activated transcription
           factors, HNF4  has a central well conserved DNA binding
           domain (DBD), a variable N-terminal domain, a flexible
           hinge and a C-terminal ligand binding domain (LBD). The
           LBD domain is also responsible for recruiting
           co-activator proteins. More than 280 nuclear receptors
           are found in C. ele gans, most of which are originated
           from an explosive burst of duplications of HNF4.
          Length = 222

 Score = 39.7 bits (93), Expect = 7e-05
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 50  QIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIG 96
           Q+ L  YI+        RF ++ L+LP L+SI   ++E++ F  + G
Sbjct: 165 QVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFARLFG 211


>gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor
           family 2.  Ligand-binding domain (LBD) of nuclear
           receptor (NR) family 2:  This is one of the major
           subfamily of nuclear receptors, including some well
           known nuclear receptors such as glucocorticoid receptor
           (GR), mineralocorticoid receptor (MR), estrogen receptor
           (ER), progesterone receptor (PR), and androgen receptor
           (AR), other related receptors. Nuclear receptors form a
           superfamily of ligand-activated transcription
           regulators, which regulate various physiological
           functions, from development, reproduction, to
           homeostasis and metabolism in animals (metazoans). The
           family contains not only receptors for known ligands but
           also orphan receptors for which ligands do not exist or
           have not been identified. NRs share a common structural
           organization with a central well conserved DNA binding
           domain (DBD), a variable N-terminal domain, a
           non-conserved hinge and a C-terminal ligand binding
           domain (LBD).
          Length = 165

 Score = 39.1 bits (92), Expect = 1e-04
 Identities = 16/29 (55%), Positives = 19/29 (65%)

Query: 53  LNKYIHTVYPSQPTRFCKIQLILPRLKSI 81
           L +YI   YP QP RF K+ L LP L+SI
Sbjct: 137 LQEYIRKRYPQQPARFAKLLLRLPELRSI 165


>gnl|CDD|132743 cd06945, NR_LBD_Nurr1_like, The ligand binding domain of Nurr1 and
           related nuclear receptor proteins, members of nuclear
           receptor superfamily.  The ligand binding domain of
           nuclear receptor Nurr1_like: This family of nuclear
           receptors, including Nurr1, Nerve growth
           factor-induced-B (NGFI-B) and DHR38 are involved in the
           embryo development. Nurr1 is a transcription factor that
           is expressed in the embryonic ventral midbrain and is
           critical for the development of dopamine (DA) neurons.
           Structural studies have shown that the ligand binding
           pocket of Nurr1 is filled by bulky hydrophobic residues,
           making it unable to bind to ligands. Therefore, it
           belongs to the class of orphan receptors. However, Nurr1
           forms heterodimers with RXR and can promote signaling
           via its partner, RXR. NGFI-B is an early immediate gene
           product of embryo development that is rapidly produced
           in response to a variety of cellular signals including
           nerve growth factor. It is involved in T-cell-mediated
           apoptosis, as well as neuronal differentiation and
           function. NGFI-B regulates transcription by binding to a
           specific DNA target upstream of its target genes and
           regulating the rate of tr anscriptional initiation.
           Another group of receptor in this family is DHR38.
           DHR38 is the Drosophila homolog to the vertebrate
           NGFI-B-type orphan receptor. It interacts with the USP
           component of the ecdysone receptor complex, suggesting
           that DHR38 might modulate ecdysone-triggered signals in
           the fly, in addition to the ECR/USP pathway. Nurr1_like
           proteins exhibit a modular structure that is
           characteristic for nuclear receptors; they have a
           central well conserved DNA binding domain (DBD), a
           variable N-terminal domain, a non-conserved hinge and a
           C-terminal ligand binding domain (LBD).
          Length = 239

 Score = 28.9 bits (65), Expect = 0.47
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 53  LNKYIHTVYPSQ--PTRFCKIQLILPRLKSIPSLVLEELFF 91
           L  ++ + YP Q  P R  K+ L LP L+++    L+ +FF
Sbjct: 176 LRDHVTSNYPGQDKPNRLSKLLLKLPELRTLSKKGLQRIFF 216


>gnl|CDD|132727 cd06929, NR_LBD_F1, Ligand-binding domain of nuclear receptor
           family 1.  Ligand-binding domain (LBD) of nuclear
           receptor (NR) family 1:  This is one of the major
           subfamily of nuclear receptors, including thyroid
           receptor, retinoid acid receptor, ecdysone receptor,
           farnesoid X receptor, vitamin D receptor, and other
           related receptors. Nuclear receptors form a superfamily
           of ligand-activated transcription regulators, which
           regulate various physiological functions, from
           development, reproduction, to homeostasis and metabolism
           in animals (metazoans). The family contains not only
           receptors for known ligands but also orphan receptors
           for which ligands do not exist or have not been
           identified. NRs share a common structural organization
           with a central well conserved DNA binding domain (DBD),
           a variable N-terminal domain, a flexible hinge and a
           C-terminal ligand binding domain (LBD).
          Length = 174

 Score = 28.7 bits (65), Expect = 0.53
 Identities = 8/29 (27%), Positives = 15/29 (51%)

Query: 53  LNKYIHTVYPSQPTRFCKIQLILPRLKSI 81
           L +Y+   +P  P  F K+   L  L+++
Sbjct: 138 LQRYLKVNHPDAPQMFAKLLKKLTELRTL 166


>gnl|CDD|132754 cd07069, NR_LBD_Lrh-1, The ligand binding domain of the liver
           receptor homolog-1, a member of  nuclear receptor
           superfamily,.  The ligand binding domain (LBD) of the
           liver receptor homolog-1 (LRH-1): LRH-1 belongs to
           nuclear hormone receptor superfamily, and is expressed
           mainly in the liver, intestine, exocrine pancreas, and
           ovary. Most nuclear receptors function as homodimer or
           heterodimers. However, LRH-1 binds DNA as a monomer, and
           is a regulator of bile-acid homeostasis,
           steroidogenesis, reverse cholesterol transport and the
           initial stages of embryonic development. Recently,
           phospholipids have been identified as potential ligand
           for LRH-1 and steroidogenic factor-1 (SF-1).  Like other
           members of the nuclear receptor (NR) superfamily of
           ligand-activated transcription factors, LRH-1 has  a
           central well conserved DNA binding domain (DBD), a
           variable N-terminal domain, a flexible hinge and a
           C-terminal ligand binding domain (LBD).
          Length = 241

 Score = 28.1 bits (62), Expect = 0.90
 Identities = 14/53 (26%), Positives = 26/53 (49%)

Query: 44  AIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIG 96
            +Q      L  Y    YP Q  +F ++ L LP +++I     E L+++++ G
Sbjct: 172 GVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNG 224


>gnl|CDD|214658 smart00430, HOLI, Ligand binding domain of hormone receptors. 
          Length = 163

 Score = 27.7 bits (62), Expect = 0.94
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 53  LNKYIHTVYPSQ-PTRFCKIQLILPRLKSI 81
           L+ Y    YP   P RF K+ LILP L+ I
Sbjct: 134 LHDYYLKNYPMNYPGRFAKLLLILPELRKI 163


>gnl|CDD|132742 cd06944, NR_LBD_Ftz-F1_like, The ligand binding domain of FTZ-F1
           like nuclear receptors.  The ligand binding domain of
           FTZ-F1 like nuclear receptors: This nuclear receptor
           family includes at least three subgroups of receptors
           that function in embryo development and differentiation,
           and other processes. FTZ-F1 interacts with the
           cis-acting DNA motif of ftz gene, which required at
           several stages of development. Particularly, FTZ-F1
           genes are strongly linked to steroid biosynthesis and
           sex-determination; LRH-1 is a regulator of bile-acid
           homeostasis, steroidogenesis, reverse cholesterol
           transport and the initial stages of embryonic
           development. SF-1 is an essential regulator of endocrine
           development and function and is considered a master
           regulator of reproduction; SF-1 functions cooperatively
           with other transcription factors to modulate gene
           expression. Phospholipids have been identified as
           potential ligand for LRH-1 and steroidogenic factor-1
           (SF-1). However, the ligand for FTZ-F1 has not yet been
           identified. Most nuclear receptors function as homodimer
           or heterodimers. However, LRH-1 and SF-1 bind to DNA as
           a monomer. Like other members of the nuclear receptor
           (NR) superfamily of ligand-activated transcription
           factors, receptors in this family  have  a central well
           conserved DNA binding domain (DBD), a variable
           N-terminal domain, a flexible hinge and a C-terminal
           ligand binding domain (LBD).
          Length = 237

 Score = 27.6 bits (62), Expect = 1.1
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 56  YIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIG 96
           Y    YP Q  +F ++ L LP +++I     E L+++++ G
Sbjct: 182 YTLCNYPQQTDKFGQLLLRLPEIRAISMQAEEYLYYKHLNG 222


>gnl|CDD|132751 cd06953, NR_LBD_DHR4_like, The ligand binding domain of orphan
           nuclear receptor Ecdysone-induced receptor DHR4.  The
           ligand binding domain of Ecdysone-induced receptor DHR4:
           Ecdysone-induced orphan receptor DHR4 is a member of the
           nuclear receptor family. DHR4 is expressed during the
           early Drosophila larval development and is induced by
           ecdysone. DHR4 coordinates growth and maturation in
           Drosophila by mediating endocrine response to the
           attainment of proper body size during larval
           development. Mutations in DHR4 result in shorter larval
           development which translates into smaller and lighter
           flies. Like other members of the nuclear receptor (NR)
           superfamily of ligand-activated transcription factors,
           DHR4  has  a central well conserved DNA binding domain
           (DBD), a variable N-terminal domain, a flexible hinge
           and a C-terminal ligand binding domain (LBD). .
          Length = 213

 Score = 27.3 bits (61), Expect = 1.4
 Identities = 11/39 (28%), Positives = 18/39 (46%)

Query: 53  LNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFF 91
           L  +    YP+QP RF  +   LP +++    +L    F
Sbjct: 167 LQDFTELNYPNQPNRFSDLLSCLPEIRAAAGKLLHSKLF 205


>gnl|CDD|218151 pfam04561, RNA_pol_Rpb2_2, RNA polymerase Rpb2, domain 2.  RNA
           polymerases catalyze the DNA dependent polymerisation of
           RNA. Prokaryotes contain a single RNA polymerase
           compared to three in eukaryotes (not including
           mitochondrial. and chloroplast polymerases). Rpb2 is the
           second largest subunit of the RNA polymerase. This
           domain forms one of the two distinctive lobes of the
           Rpb2 structure. This domain is also known as the lobe
           domain. DNA has been demonstrated to bind to the concave
           surface of the lobe domain, and plays a role in
           maintaining the transcription bubble. Many of the
           bacterial members contain large insertions within this
           domain, as region known as dispensable region 1 (DRI).
          Length = 185

 Score = 26.9 bits (60), Expect = 2.3
 Identities = 15/75 (20%), Positives = 26/75 (34%), Gaps = 3/75 (4%)

Query: 1   MFQTELTMLRIVTEENSNLEIRNAYTSRRGSRVRFKTGSKFTAAIQGHTQIFLNKYIHTV 60
           +         I T+E +   I   +  RRG   R +   +   +     +  LNK++  +
Sbjct: 86  LKPELEEAENIYTQEEALDYIGKGFALRRGEEPRLQRAREILYSRDP--KYNLNKHL-GL 142

Query: 61  YPSQPTRFCKIQLIL 75
                    K Q IL
Sbjct: 143 NEPFENERLKAQDIL 157


>gnl|CDD|132738 cd06940, NR_LBD_REV_ERB, The ligand binding domain of REV-ERB
           receptors, members of the nuclear receptor superfamily. 
           The ligand binding domain (LBD) of REV-ERB receptors:
           REV-ERBs are transcriptional regulators belonging to the
           nuclear receptor superfamily. They regulate a number of
           physiological functions including the circadian rhythm,
           lipid metabolism, and cellular differentiation. The LBD
           domain of REV-ERB is unusual   in the nuclear receptor
           family by lacking the AF-2 region that is responsible
           for coactivator interaction.  REV-ERBs act as
           constitutive repressors because of their inability to
           bind coactivators.  REV-ERB receptors can bind to two
           classes of DNA response elements as either a monomer or
           heterodimer, indicating functional diversity. When bound
           to the DNA, they recruit corepressors (NcoR/histone
           deacetylase 3) to the promoter, resulting in repression
           of the target gene. The porphyrin heme has been
           demonstrated to function as a ligand for REV-ERB. Like
           other members of the nuclear receptor (NR) superfamily
           of ligand-activated transcription factors, REV-ERB
           receptors have a central well conserved DNA binding
           domain (DBD), a variable N-terminal domain, a
           non-conserved hinge and a C-terminal ligand binding
           domain (LBD).
          Length = 189

 Score = 25.5 bits (56), Expect = 5.8
 Identities = 11/29 (37%), Positives = 21/29 (72%)

Query: 61  YPSQPTRFCKIQLILPRLKSIPSLVLEEL 89
           +P++P+ F K+ L LP L+++ +L  E+L
Sbjct: 156 HPNEPSIFTKLLLKLPDLRTLNNLHSEKL 184


>gnl|CDD|215719 pfam00104, Hormone_recep, Ligand-binding domain of nuclear hormone
           receptor.  This all helical domain is involved in
           binding the hormone in these receptors.
          Length = 186

 Score = 25.4 bits (56), Expect = 7.3
 Identities = 11/45 (24%), Positives = 19/45 (42%), Gaps = 2/45 (4%)

Query: 53  LNKYIHTVY--PSQPTRFCKIQLILPRLKSIPSLVLEELFFRNII 95
           L+ Y       P+   R  K+  +LP L+ I   + E+L    + 
Sbjct: 142 LHNYYKDENSPPNYSGRLAKLLKLLPALRKISRKLREKLELAKLF 186


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.324    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0702    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,534,005
Number of extensions: 460165
Number of successful extensions: 463
Number of sequences better than 10.0: 1
Number of HSP's gapped: 462
Number of HSP's successfully gapped: 23
Length of query: 113
Length of database: 10,937,602
Length adjustment: 77
Effective length of query: 36
Effective length of database: 7,522,344
Effective search space: 270804384
Effective search space used: 270804384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (24.2 bits)