RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy16791
         (126 letters)



>gnl|CDD|202894 pfam04117, Mpv17_PMP22, Mpv17 / PMP22 family.  The 22-kDa
           peroxisomal membrane protein (PMP22) is a major
           component of peroxisomal membranes. PMP22 seems to be
           involved in pore forming activity and may contribute to
           the unspecific permeability of the organelle membrane.
           PMP22 is synthesised on free cytosolic ribosomes and
           then directed to the peroxisome membrane by specific
           targeting information. Mpv17 is a closely related
           peroxisomal protein. In mouse, the Mpv17 protein is
           involved in the development of early-onset
           glomerulosclerosis. More recently a homolog of Mpv17 in
           S. cerevisiae has been been found to be an integral
           membrane protein of the inner mitochondrial membrane
           where it has been proposed to have a role in ethanol
           metabolism and tolerance during heat-shock. Defects in
           MPV17 is associated with mitochondrial DNA depletion
           syndrome (MDDS) and Navajo neurohepatopathy (NNH). MDDS
           is a clinically heterogeneous group of disorders
           characterized by a reduction in mitochondrial DNA
           (mtDNA) copy number. Primary mtDNA depletion is
           inherited as an autosomal recessive trait and may affect
           single organs, typically muscle or liver, or multiple
           tissues. Individuals with the hepatocerebral form of
           mitochondrial DNA depletion syndrome have early
           progressive liver failure and neurologic abnormalities,
           hypoglycemia, and increased lactate in body fluids. NNH
           is an autosomal recessive disease that is prevalent
           among Navajo children in the South Western states of
           America. The major clinical features are hepatopathy,
           peripheral neuropathy, corneal anesthesia and scarring,
           acral mutilation, cerebral leukoencephalopathy, failure
           to thrive, and recurrent metabolic acidosis with
           intercurrent infections. Infantile, childhood, and
           classic forms of NNH have been described. Mitochondrial
           DNA depletion was detected in the livers of patients,
           suggesting a primary defect in mtDNA maintenance.
          Length = 68

 Score = 78.8 bits (195), Expect = 9e-21
 Identities = 24/68 (35%), Positives = 40/68 (58%)

Query: 53  MTLLEGKTVDDGLHEVSHKFWPTYRIGVMVWPFAQLINYTLVSEKNRVPYVSVCSLLWTS 112
           M LLEGK++++   ++  KFWPT +    VWP  Q IN+  V    RV +V++  + W +
Sbjct: 1   MGLLEGKSLEEIKEKLKEKFWPTLKANWKVWPPVQFINFAFVPVHYRVLFVNLVGIGWNT 60

Query: 113 FLAYMKYN 120
           +L+Y+   
Sbjct: 61  YLSYVNNK 68


>gnl|CDD|235643 PRK05907, PRK05907, hypothetical protein; Provisional.
          Length = 311

 Score = 27.9 bits (62), Expect = 1.7
 Identities = 11/52 (21%), Positives = 24/52 (46%)

Query: 25  PTLSHSLKKALVEQVTYTPFAMISFYFGMTLLEGKTVDDGLHEVSHKFWPTY 76
               HSL ++L+  +   P  +I+F     L   +++++   E  H+ +  Y
Sbjct: 220 RVEGHSLLRSLLSDMGEDPLGIIAFLRSQCLYGLRSIEEQSKERKHRIFVAY 271


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.327    0.138    0.459 

Gapped
Lambda     K      H
   0.267   0.0773    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,471,340
Number of extensions: 547004
Number of successful extensions: 565
Number of sequences better than 10.0: 1
Number of HSP's gapped: 565
Number of HSP's successfully gapped: 9
Length of query: 126
Length of database: 10,937,602
Length adjustment: 85
Effective length of query: 41
Effective length of database: 7,167,512
Effective search space: 293867992
Effective search space used: 293867992
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (24.1 bits)