RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy16791
(126 letters)
>gnl|CDD|202894 pfam04117, Mpv17_PMP22, Mpv17 / PMP22 family. The 22-kDa
peroxisomal membrane protein (PMP22) is a major
component of peroxisomal membranes. PMP22 seems to be
involved in pore forming activity and may contribute to
the unspecific permeability of the organelle membrane.
PMP22 is synthesised on free cytosolic ribosomes and
then directed to the peroxisome membrane by specific
targeting information. Mpv17 is a closely related
peroxisomal protein. In mouse, the Mpv17 protein is
involved in the development of early-onset
glomerulosclerosis. More recently a homolog of Mpv17 in
S. cerevisiae has been been found to be an integral
membrane protein of the inner mitochondrial membrane
where it has been proposed to have a role in ethanol
metabolism and tolerance during heat-shock. Defects in
MPV17 is associated with mitochondrial DNA depletion
syndrome (MDDS) and Navajo neurohepatopathy (NNH). MDDS
is a clinically heterogeneous group of disorders
characterized by a reduction in mitochondrial DNA
(mtDNA) copy number. Primary mtDNA depletion is
inherited as an autosomal recessive trait and may affect
single organs, typically muscle or liver, or multiple
tissues. Individuals with the hepatocerebral form of
mitochondrial DNA depletion syndrome have early
progressive liver failure and neurologic abnormalities,
hypoglycemia, and increased lactate in body fluids. NNH
is an autosomal recessive disease that is prevalent
among Navajo children in the South Western states of
America. The major clinical features are hepatopathy,
peripheral neuropathy, corneal anesthesia and scarring,
acral mutilation, cerebral leukoencephalopathy, failure
to thrive, and recurrent metabolic acidosis with
intercurrent infections. Infantile, childhood, and
classic forms of NNH have been described. Mitochondrial
DNA depletion was detected in the livers of patients,
suggesting a primary defect in mtDNA maintenance.
Length = 68
Score = 78.8 bits (195), Expect = 9e-21
Identities = 24/68 (35%), Positives = 40/68 (58%)
Query: 53 MTLLEGKTVDDGLHEVSHKFWPTYRIGVMVWPFAQLINYTLVSEKNRVPYVSVCSLLWTS 112
M LLEGK++++ ++ KFWPT + VWP Q IN+ V RV +V++ + W +
Sbjct: 1 MGLLEGKSLEEIKEKLKEKFWPTLKANWKVWPPVQFINFAFVPVHYRVLFVNLVGIGWNT 60
Query: 113 FLAYMKYN 120
+L+Y+
Sbjct: 61 YLSYVNNK 68
>gnl|CDD|235643 PRK05907, PRK05907, hypothetical protein; Provisional.
Length = 311
Score = 27.9 bits (62), Expect = 1.7
Identities = 11/52 (21%), Positives = 24/52 (46%)
Query: 25 PTLSHSLKKALVEQVTYTPFAMISFYFGMTLLEGKTVDDGLHEVSHKFWPTY 76
HSL ++L+ + P +I+F L +++++ E H+ + Y
Sbjct: 220 RVEGHSLLRSLLSDMGEDPLGIIAFLRSQCLYGLRSIEEQSKERKHRIFVAY 271
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.327 0.138 0.459
Gapped
Lambda K H
0.267 0.0773 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,471,340
Number of extensions: 547004
Number of successful extensions: 565
Number of sequences better than 10.0: 1
Number of HSP's gapped: 565
Number of HSP's successfully gapped: 9
Length of query: 126
Length of database: 10,937,602
Length adjustment: 85
Effective length of query: 41
Effective length of database: 7,167,512
Effective search space: 293867992
Effective search space used: 293867992
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (24.1 bits)