Diaphorina citri psyllid: psy16794


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MIDHKIQGSIVNVSSIAGKTALEGHTIYSASKAALDSITRTMALELGPYNIRVNSVQPTVVMTQMGRTGWSDPAKAGPMLAKTPLGRFAANANIKFFFKEMGRTGWSDPAKAGPMLAKTPLGRFAGECLKV
ccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccCEEECcccccccccccEECc
*****IQGSIVNVSSIAGKTALEGHTIYSASKAALDSITRTMALELGPYNIRVNSVQPTVVMTQMGRTGWSDPAKAGPMLAKTPLGRFAANANIKFFFKEMGRTGWSDPAKAGPMLAKTPLGRFAGECLKV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDHKIQGSIVNVSSIAGKTALEGHTIYSASKAALDSITRTMALELGPYNIRVNSVQPTVVMTQMGRTGWSDPAKAGPMLAKTPLGRFAANANIKFFFKEMGRTGWSDPAKAGPMLAKTPLGRFAGECLKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable L-xylulose reductase Catalyzes the NADPH-dependent reduction of L-xylulose, D-xylulose, D-fructose, and L-sorbose, with the highest affinity for L-xylulose.confidentQ21929
L-xylulose reductase Catalyzes the NADPH-dependent reduction of several pentoses, tetroses, trioses, alpha-dicarbonyl compounds and L-xylulose. Participates in the uronate cycle of glucose metabolism. May play a role in the water absorption and cellular osmoregulation in the proximal renal tubules by producing xylitol, an osmolyte, thereby preventing osmolytic stress from occurring in the renal tubules.confidentQ7Z4W1
L-xylulose reductase Catalyzes the NADPH-dependent reduction of several pentoses, tetroses, trioses, alpha-dicarbonyl compounds and L-xylulose. Participates in the uronate cycle of glucose metabolism. May play a role in the water absorption and cellular osmoregulation in the proximal renal tubules by producing xylitol, an osmolyte, thereby preventing osmolytic stress from occurring in the renal tubules.confidentQ920N9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050038 [MF]L-xylulose reductase (NADP+) activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0006006 [BP]glucose metabolic processprobableGO:0044238, GO:0005975, GO:0005996, GO:0019318, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0006739 [BP]NADP metabolic processprobableGO:0006732, GO:0006733, GO:0034641, GO:0006807, GO:0044281, GO:0072524, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0019362, GO:0071704, GO:0009987, GO:0006725, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0046496
GO:0005998 [BP]xylulose catabolic processprobableGO:0019321, GO:0044238, GO:0019323, GO:0005975, GO:0071704, GO:0005997, GO:0005996, GO:0016052, GO:1901575, GO:0046365, GO:0008150, GO:0008152, GO:0044723, GO:0009056, GO:0044724
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016655 [MF]oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptorprobableGO:0003824, GO:0003674, GO:0016651, GO:0016491
GO:0005902 [CC]microvillusprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0033764 [MF]steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptorprobableGO:0016229, GO:0016614, GO:0016616, GO:0003824, GO:0003674, GO:0016491
GO:0005903 [CC]brush borderprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0008202 [BP]steroid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D3W, chain A
Confidence level:very confident
Coverage over the Query: 7-116
View the alignment between query and template
View the model in PyMOL