Diaphorina citri psyllid: psy16796


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MIASQERQQRSYFIPSSIMIQLFCNKTIEEEEEEEEEEEEEKEEEEEEEEENTRTEEMNERKENINKKKEEEKKNGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQSDCKYYVAKEEEEGEDEEEEEEGEEEAKEQEQKQVGVIEKEKNKE
cccccHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccHHHHcccccHHHHHcccHHHcccHHHHHHHHHHcccccccccccc
*********************************************************************************RTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQSDCKYYV**************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIASQERQQRSYFIPSSIMIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQSDCKYYxxxxxxxxxxxxxxxxxxxxxxxxxxxxVGVIEKEKNKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeotic protein proboscipedia Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Controls development of mouthparts, and labial and maxillary palps.confidentP31264

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L7Z, chain A
Confidence level:confident
Coverage over the Query: 75-136
View the alignment between query and template
View the model in PyMOL