Query         psy16822
Match_columns 97
No_of_seqs    104 out of 185
Neff          4.7 
Searched_HMMs 46136
Date          Fri Aug 16 22:57:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16822.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16822hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0396|consensus              100.0   1E-32 2.2E-37  223.2  -0.7   86    5-97    276-361 (389)
  2 KOG2817|consensus               98.6 1.2E-08 2.7E-13   83.8   1.3   41   56-96    324-364 (394)
  3 PF13445 zf-RING_UBOX:  RING-ty  98.4 5.4E-08 1.2E-12   57.6  -0.1   28   69-96      1-28  (43)
  4 COG5109 Uncharacterized conser  98.2 3.9E-07 8.4E-12   74.3   1.2   41   56-96    326-366 (396)
  5 smart00504 Ubox Modified RING   98.0 1.4E-06   3E-11   52.6   0.3   27   67-96      2-28  (63)
  6 PF04564 U-box:  U-box domain;   97.5 1.7E-05 3.6E-10   50.6  -0.8   28   66-96      4-31  (73)
  7 PF04641 Rtf2:  Rtf2 RING-finge  96.8 0.00048   1E-08   53.1   1.2   35   63-97    110-145 (260)
  8 KOG3113|consensus               96.0  0.0022 4.7E-08   51.2   0.3   35   63-97    108-143 (293)
  9 PF15227 zf-C3HC4_4:  zinc fing  91.3    0.12 2.6E-06   29.8   1.3   15   80-94      9-23  (42)
 10 PF11789 zf-Nse:  Zinc-finger o  85.6    0.23 5.1E-06   30.6  -0.1   28   66-96     11-39  (57)
 11 PF05605 zf-Di19:  Drought indu  76.7       1 2.2E-05   26.9   0.4   31   42-72      4-37  (54)
 12 COG2835 Uncharacterized conser  76.6     1.4 3.1E-05   28.0   1.1   39   41-87      9-48  (60)
 13 PRK11827 hypothetical protein;  75.5     1.3 2.9E-05   27.9   0.8   39   41-87      9-48  (60)
 14 PF13639 zf-RING_2:  Ring finge  66.5     4.3 9.3E-05   22.7   1.5   26   69-94      3-28  (44)
 15 PF10367 Vps39_2:  Vacuolar sor  61.7       6 0.00013   25.3   1.7   12   39-50     77-88  (109)
 16 PF08271 TF_Zn_Ribbon:  TFIIB z  61.2     3.7   8E-05   23.4   0.6   32   42-80      2-33  (43)
 17 PF04641 Rtf2:  Rtf2 RING-finge  59.1     4.4 9.5E-05   31.2   0.8   26   68-96     36-62  (260)
 18 PF08274 PhnA_Zn_Ribbon:  PhnA   58.3     6.3 0.00014   21.6   1.2   24   41-73      3-26  (30)
 19 PF07282 OrfB_Zn_ribbon:  Putat  53.1     8.8 0.00019   23.4   1.3   33   39-79     27-59  (69)
 20 PLN03208 E3 ubiquitin-protein   52.0     6.2 0.00013   30.1   0.6   15   80-94     29-43  (193)
 21 KOG2177|consensus               50.8     3.5 7.6E-05   29.0  -0.8   12   39-50     12-23  (386)
 22 PF09538 FYDLN_acid:  Protein o  50.2     9.6 0.00021   26.3   1.3   32   39-79      8-39  (108)
 23 PRK00420 hypothetical protein;  45.4      14 0.00029   25.9   1.5   31   39-78     22-52  (112)
 24 PF04423 Rad50_zn_hook:  Rad50   45.3     7.1 0.00015   23.1   0.0   12   41-52     21-32  (54)
 25 PF10571 UPF0547:  Uncharacteri  43.3      13 0.00028   19.6   0.9   17   42-58      2-18  (26)
 26 PF14634 zf-RING_5:  zinc-RING   42.4      15 0.00032   20.7   1.1   18   77-94     10-27  (44)
 27 smart00734 ZnF_Rad18 Rad18-lik  41.6      13 0.00027   19.5   0.6   10   41-50      2-11  (26)
 28 TIGR02300 FYDLN_acid conserved  38.5      15 0.00033   26.5   0.8   31   39-78      8-38  (129)
 29 TIGR01206 lysW lysine biosynth  38.1      25 0.00054   21.6   1.7   31   41-77      3-33  (54)
 30 smart00184 RING Ring finger. E  38.0      20 0.00043   17.8   1.1   16   79-94      8-23  (39)
 31 PF09986 DUF2225:  Uncharacteri  37.0      13 0.00028   28.0   0.3   13   39-51      4-16  (214)
 32 TIGR03831 YgiT_finger YgiT-typ  36.9     8.5 0.00019   21.2  -0.5   26   43-68      1-27  (46)
 33 PF09866 DUF2093:  Uncharacteri  35.3      24 0.00053   21.0   1.2   14   64-77      5-18  (42)
 34 TIGR00599 rad18 DNA repair pro  34.4      13 0.00029   31.0   0.0   11   40-50     26-36  (397)
 35 PF13923 zf-C3HC4_2:  Zinc fing  34.3      35 0.00077   18.5   1.8   13   82-94     11-24  (39)
 36 COG0675 Transposase and inacti  33.2      33 0.00071   25.4   2.0   29   38-79    307-335 (364)
 37 KOG3039|consensus               32.1      15 0.00033   29.7   0.0   17   80-96     54-70  (303)
 38 PF10588 NADH-G_4Fe-4S_3:  NADH  31.2      28 0.00062   19.8   1.1   18   39-56     12-33  (41)
 39 KOG0883|consensus               30.8      25 0.00055   30.2   1.1   32   55-96     36-67  (518)
 40 PF13824 zf-Mss51:  Zinc-finger  29.9      23 0.00049   22.1   0.5   11   63-73     11-21  (55)
 41 PF05237 MoeZ_MoeB:  MoeZ/MoeB   29.7      23  0.0005   22.6   0.6   11   38-48     72-82  (84)
 42 PHA02446 hypothetical protein   28.6      13 0.00029   27.2  -0.8   39   39-77     61-99  (166)
 43 smart00531 TFIIE Transcription  28.0      25 0.00054   24.8   0.5   40   40-81     99-138 (147)
 44 PF05191 ADK_lid:  Adenylate ki  27.7      34 0.00073   19.2   0.9   17   66-82      1-18  (36)
 45 PF13894 zf-C2H2_4:  C2H2-type   27.6      18 0.00039   16.7  -0.2   11   42-52      2-12  (24)
 46 PRK10220 hypothetical protein;  27.6      47   0.001   23.5   1.8   11   41-51     21-31  (111)
 47 cd00714 GFAT Glutamine amidotr  27.1      18 0.00039   26.7  -0.3   31   63-95     69-107 (215)
 48 COG0482 TrmU Predicted tRNA(5-  26.9      64  0.0014   26.8   2.8   46   48-93    172-227 (356)
 49 PRK01343 zinc-binding protein;  26.8      30 0.00064   21.7   0.6   12   39-50      8-19  (57)
 50 PF00412 LIM:  LIM domain;  Int  26.1      15 0.00032   21.1  -0.8   26   65-92     25-50  (58)
 51 PF12230 PRP21_like_P:  Pre-mRN  25.9      23 0.00049   26.6   0.0   15   65-79    167-181 (229)
 52 COG3908 Uncharacterized protei  25.9      41 0.00088   22.2   1.2   16   63-78     27-42  (77)
 53 PF13522 GATase_6:  Glutamine a  24.9      48   0.001   22.7   1.5   44   49-94      2-54  (133)
 54 COG1998 RPS31 Ribosomal protei  24.7      54  0.0012   20.3   1.5   23   39-70     18-41  (51)
 55 PRK11088 rrmA 23S rRNA methylt  24.4      46   0.001   25.1   1.4    9   42-50      4-12  (272)
 56 PF14803 Nudix_N_2:  Nudix N-te  24.4      40 0.00086   18.8   0.8   29   43-75      3-31  (34)
 57 PF13913 zf-C2HC_2:  zinc-finge  24.3      28 0.00061   17.8   0.2   12   41-52      3-14  (25)
 58 PRK00807 50S ribosomal protein  24.2      61  0.0013   19.5   1.7   24   68-91      3-27  (52)
 59 PF03119 DNA_ligase_ZBD:  NAD-d  24.2      24 0.00051   18.7  -0.1   10   42-51      1-10  (28)
 60 PF10915 DUF2709:  Protein of u  23.7      54  0.0012   25.8   1.7   20   61-80     82-101 (238)
 61 KOG4265|consensus               22.6      39 0.00084   28.1   0.8   17   39-55    324-340 (349)
 62 PRK07758 hypothetical protein;  22.6      37 0.00081   23.3   0.6   17   30-46      9-25  (95)
 63 PF13395 HNH_4:  HNH endonuclea  22.5      34 0.00073   20.2   0.3   12   69-80      1-12  (54)
 64 PF13920 zf-C3HC4_3:  Zinc fing  22.4      28 0.00061   19.9  -0.1   13   39-51     36-48  (50)
 65 cd00162 RING RING-finger (Real  21.9      35 0.00075   17.6   0.3    9   42-50      1-9   (45)
 66 PF05477 SURF2:  Surfeit locus   21.9      46   0.001   26.2   1.0   19   60-78     73-91  (244)
 67 TIGR02194 GlrX_NrdH Glutaredox  21.8      35 0.00077   20.5   0.3   24   39-62      5-29  (72)
 68 TIGR00686 phnA alkylphosphonat  21.8      70  0.0015   22.5   1.8   12   41-52     20-31  (109)
 69 PF13186 SPASM:  Iron-sulfur cl  21.3      50  0.0011   18.7   0.9   10   83-92      9-18  (64)
 70 PF14169 YdjO:  Cold-inducible   20.6      46   0.001   21.0   0.6   21   38-58     37-57  (59)
 71 cd02970 PRX_like2 Peroxiredoxi  20.4      35 0.00076   22.3   0.1   18   39-56     32-49  (149)
 72 PF12792 CSS-motif:  CSS motif   20.3      57  0.0012   22.5   1.2   30   44-73     38-75  (208)

No 1  
>KOG0396|consensus
Probab=99.97  E-value=1e-32  Score=223.16  Aligned_cols=86  Identities=45%  Similarity=0.860  Sum_probs=79.5

Q ss_pred             ccccCcccceeeEEecCccccccCccccccccccCCCCCCCCChhHHHhhhhCCCceecccEEEeccccccccCCCCcee
Q psy16822          5 QPLAHGLDLIKVVSSPPGLSALKTPQCSSEVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQPMV   84 (97)
Q Consensus         5 ~pll~~~~~~~~~~l~aGlsaLKTp~C~~~~~~~~~~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmde~N~P~~   84 (97)
                      .|+|+       ++++||||++|||.|+.+.+.....+||+|++.|+++|++||||||.||+|||+||||.||++|+|++
T Consensus       276 ~~~L~-------~~l~~GLsalKTp~c~~~~~~~~~~~CpvC~~~f~~ia~~LPfah~~~S~Lvc~isge~md~~N~P~l  348 (389)
T KOG0396|consen  276 NPALT-------IYLQAGLSALKTPRCLNDESDNNPNNCPVCCEAFKPIAQALPFAHHAQSRLVCSISGELMDDDNPPHL  348 (389)
T ss_pred             CcHHH-------HHHHhhhhhcccccccccccCCCCCCCCCcccccchhhhcCCchhhhhhHHHhhccccccCCCCCccc
Confidence            56677       99999999999999998865545568999999999999999999999999999999999999999999


Q ss_pred             cCCCceecccCCC
Q psy16822         85 LPNGYVYGEQEGK   97 (97)
Q Consensus        85 lPNG~VYs~~aL~   97 (97)
                      ||||+|||.++|+
T Consensus       349 fpnG~Vyg~~~L~  361 (389)
T KOG0396|consen  349 FPNGYVYGTKALE  361 (389)
T ss_pred             ccCceeehhHHHH
Confidence            9999999999874


No 2  
>KOG2817|consensus
Probab=98.61  E-value=1.2e-08  Score=83.85  Aligned_cols=41  Identities=24%  Similarity=0.271  Sum_probs=39.1

Q ss_pred             hCCCceecccEEEeccccccccCCCCceecCCCceecccCC
Q psy16822         56 SLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVYGEQEG   96 (97)
Q Consensus        56 ~LP~ah~~~S~LvC~iSg~vmde~N~P~~lPNG~VYs~~aL   96 (97)
                      .||...|.||.++|+|+.|+.+|+||||+|..|||.|++||
T Consensus       324 eL~~~~~fHSvF~CPVlKeqtsdeNPPm~L~CGHVISkdAl  364 (394)
T KOG2817|consen  324 ELGKEYHFHSVFICPVLKEQTSDENPPMMLICGHVISKDAL  364 (394)
T ss_pred             eccccccccceeecccchhhccCCCCCeeeeccceecHHHH
Confidence            67888899999999999999999999999999999999886


No 3  
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=98.39  E-value=5.4e-08  Score=57.62  Aligned_cols=28  Identities=39%  Similarity=0.506  Sum_probs=18.3

Q ss_pred             eccccccccCCCCceecCCCceecccCC
Q psy16822         69 CSISGLQFNEYNQPMVLPNGYVYGEQEG   96 (97)
Q Consensus        69 C~iSg~vmde~N~P~~lPNG~VYs~~aL   96 (97)
                      |+|+.|..+++|+||+||.||||++++|
T Consensus         1 CpIc~e~~~~~n~P~~L~CGH~~c~~cl   28 (43)
T PF13445_consen    1 CPICKEFSTEENPPMVLPCGHVFCKDCL   28 (43)
T ss_dssp             -TTT----TTSS-EEE-SSS-EEEHHHH
T ss_pred             CCccccccCCCCCCEEEeCccHHHHHHH
Confidence            7899996679999999999999999876


No 4  
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=98.23  E-value=3.9e-07  Score=74.29  Aligned_cols=41  Identities=24%  Similarity=0.374  Sum_probs=39.3

Q ss_pred             hCCCceecccEEEeccccccccCCCCceecCCCceecccCC
Q psy16822         56 SLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVYGEQEG   96 (97)
Q Consensus        56 ~LP~ah~~~S~LvC~iSg~vmde~N~P~~lPNG~VYs~~aL   96 (97)
                      .||-..|.||.++|+++.|...++||||||..|||.+++||
T Consensus       326 klp~~~hfHs~FiCPVlKe~~t~ENpP~ml~CgHVIskeal  366 (396)
T COG5109         326 KLPKGRHFHSLFICPVLKELCTDENPPVMLECGHVISKEAL  366 (396)
T ss_pred             ecCCcccccceeeccccHhhhcccCCCeeeeccceeeHHHH
Confidence            68889999999999999999999999999999999999886


No 5  
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=98.01  E-value=1.4e-06  Score=52.60  Aligned_cols=27  Identities=30%  Similarity=0.647  Sum_probs=24.4

Q ss_pred             EEeccccccccCCCCceecCCCceecccCC
Q psy16822         67 LVCSISGLQFNEYNQPMVLPNGYVYGEQEG   96 (97)
Q Consensus        67 LvC~iSg~vmde~N~P~~lPNG~VYs~~aL   96 (97)
                      |+|+||+++|++   |+++|+||||.+++|
T Consensus         2 ~~Cpi~~~~~~~---Pv~~~~G~v~~~~~i   28 (63)
T smart00504        2 FLCPISLEVMKD---PVILPSGQTYERRAI   28 (63)
T ss_pred             cCCcCCCCcCCC---CEECCCCCEEeHHHH
Confidence            689999999986   899999999998765


No 6  
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=97.49  E-value=1.7e-05  Score=50.59  Aligned_cols=28  Identities=29%  Similarity=0.701  Sum_probs=22.8

Q ss_pred             EEEeccccccccCCCCceecCCCceecccCC
Q psy16822         66 RLVCSISGLQFNEYNQPMVLPNGYVYGEQEG   96 (97)
Q Consensus        66 ~LvC~iSg~vmde~N~P~~lPNG~VYs~~aL   96 (97)
                      .|+|+|||++|.   .|+.+|.|++|.+.+|
T Consensus         4 ~f~CpIt~~lM~---dPVi~~~G~tyer~~I   31 (73)
T PF04564_consen    4 EFLCPITGELMR---DPVILPSGHTYERSAI   31 (73)
T ss_dssp             GGB-TTTSSB-S---SEEEETTSEEEEHHHH
T ss_pred             ccCCcCcCcHhh---CceeCCcCCEEcHHHH
Confidence            468999999995   5999999999998765


No 7  
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=96.81  E-value=0.00048  Score=53.10  Aligned_cols=35  Identities=31%  Similarity=0.681  Sum_probs=30.0

Q ss_pred             cccEEEeccccccccCCCCceec-CCCceecccCCC
Q psy16822         63 NQSRLVCSISGLQFNEYNQPMVL-PNGYVYGEQEGK   97 (97)
Q Consensus        63 ~~S~LvC~iSg~vmde~N~P~~l-PNG~VYs~~aL~   97 (97)
                      ..+.++|+||++.|+....-+.| |.|+||++++|+
T Consensus       110 ~~~~~~CPvt~~~~~~~~~fv~l~~cG~V~s~~alk  145 (260)
T PF04641_consen  110 SEGRFICPVTGKEFNGKHKFVYLRPCGCVFSEKALK  145 (260)
T ss_pred             CCceeECCCCCcccCCceeEEEEcCCCCEeeHHHHH
Confidence            57899999999999877666666 999999999874


No 8  
>KOG3113|consensus
Probab=95.96  E-value=0.0022  Score=51.24  Aligned_cols=35  Identities=26%  Similarity=0.493  Sum_probs=29.2

Q ss_pred             cccEEEeccccccccCCCCcee-cCCCceecccCCC
Q psy16822         63 NQSRLVCSISGLQFNEYNQPMV-LPNGYVYGEQEGK   97 (97)
Q Consensus        63 ~~S~LvC~iSg~vmde~N~P~~-lPNG~VYs~~aL~   97 (97)
                      .+++++|+|||-.||.--.=++ -+.|+|||++||+
T Consensus       108 ~~a~fiCPvtgleMng~~~F~~l~~CGcV~SerAlK  143 (293)
T KOG3113|consen  108 QRARFICPVTGLEMNGKYRFCALRCCGCVFSERALK  143 (293)
T ss_pred             ccceeecccccceecceEEEEEEeccceeccHHHHH
Confidence            3789999999999997655444 4999999999874


No 9  
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=91.28  E-value=0.12  Score=29.78  Aligned_cols=15  Identities=27%  Similarity=0.596  Sum_probs=11.8

Q ss_pred             CCceecCCCceeccc
Q psy16822         80 NQPMVLPNGYVYGEQ   94 (97)
Q Consensus        80 N~P~~lPNG~VYs~~   94 (97)
                      ..|+.|+-||+|-+.
T Consensus         9 ~~Pv~l~CGH~FC~~   23 (42)
T PF15227_consen    9 KDPVSLPCGHSFCRS   23 (42)
T ss_dssp             SSEEE-SSSSEEEHH
T ss_pred             CCccccCCcCHHHHH
Confidence            889999999999543


No 10 
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=85.55  E-value=0.23  Score=30.60  Aligned_cols=28  Identities=21%  Similarity=0.385  Sum_probs=17.7

Q ss_pred             EEEeccccccccCCCCceec-CCCceecccCC
Q psy16822         66 RLVCSISGLQFNEYNQPMVL-PNGYVYGEQEG   96 (97)
Q Consensus        66 ~LvC~iSg~vmde~N~P~~l-PNG~VYs~~aL   96 (97)
                      .+.|+||+.++.   .|+.- -.||||++++|
T Consensus        11 ~~~CPiT~~~~~---~PV~s~~C~H~fek~aI   39 (57)
T PF11789_consen   11 SLKCPITLQPFE---DPVKSKKCGHTFEKEAI   39 (57)
T ss_dssp             -SB-TTTSSB-S---SEEEESSS--EEEHHHH
T ss_pred             ccCCCCcCChhh---CCcCcCCCCCeecHHHH
Confidence            367888888875   57765 67999999876


No 11 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=76.74  E-value=1  Score=26.85  Aligned_cols=31  Identities=26%  Similarity=0.570  Sum_probs=15.4

Q ss_pred             CCCCCChh--HHHhhhhCCCceecccE-EEeccc
Q psy16822         42 SCPVCMEP--FNTLAKSLPYARCNQSR-LVCSIS   72 (97)
Q Consensus        42 ~CPvC~~~--~~~La~~LP~ah~~~S~-LvC~iS   72 (97)
                      .||.|.+.  ...|.+.+-..|...+. .+|+|=
T Consensus         4 ~CP~C~~~~~~~~L~~H~~~~H~~~~~~v~CPiC   37 (54)
T PF05605_consen    4 TCPYCGKGFSESSLVEHCEDEHRSESKNVVCPIC   37 (54)
T ss_pred             CCCCCCCccCHHHHHHHHHhHCcCCCCCccCCCc
Confidence            45555554  23455555555555432 555553


No 12 
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=76.61  E-value=1.4  Score=27.99  Aligned_cols=39  Identities=28%  Similarity=0.688  Sum_probs=29.8

Q ss_pred             CCCCCCChhHHHhhhhCCCceecccEEEecccccccc-CCCCceecCC
Q psy16822         41 KSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFN-EYNQPMVLPN   87 (97)
Q Consensus        41 ~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmd-e~N~P~~lPN   87 (97)
                      --||+|.-.+.-        ...+..|||+.-|.--. ++..|+|||+
T Consensus         9 LaCP~~kg~L~~--------~~~~~~L~c~~~~~aYpI~dGIPvlL~~   48 (60)
T COG2835           9 LACPVCKGPLVY--------DEEKQELICPRCKLAYPIRDGIPVLLPD   48 (60)
T ss_pred             eeccCcCCcceE--------eccCCEEEecccCceeecccCccccCch
Confidence            358888766432        33445899999999988 8899999986


No 13 
>PRK11827 hypothetical protein; Provisional
Probab=75.53  E-value=1.3  Score=27.91  Aligned_cols=39  Identities=26%  Similarity=0.572  Sum_probs=29.5

Q ss_pred             CCCCCCChhHHHhhhhCCCceecccEEEecccccccc-CCCCceecCC
Q psy16822         41 KSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFN-EYNQPMVLPN   87 (97)
Q Consensus        41 ~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmd-e~N~P~~lPN   87 (97)
                      -.||+|...+.--        .....|+|...|..-. .|+.|+||++
T Consensus         9 LaCP~ckg~L~~~--------~~~~~Lic~~~~laYPI~dgIPVlL~d   48 (60)
T PRK11827          9 IACPVCNGKLWYN--------QEKQELICKLDNLAFPLRDGIPVLLET   48 (60)
T ss_pred             eECCCCCCcCeEc--------CCCCeEECCccCeeccccCCccccCHH
Confidence            4699997765321        1345799999999888 8999999976


No 14 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=66.50  E-value=4.3  Score=22.71  Aligned_cols=26  Identities=27%  Similarity=0.507  Sum_probs=17.4

Q ss_pred             eccccccccCCCCceecCCCceeccc
Q psy16822         69 CSISGLQFNEYNQPMVLPNGYVYGEQ   94 (97)
Q Consensus        69 C~iSg~vmde~N~P~~lPNG~VYs~~   94 (97)
                      |+|--+.+++++..+.+|.|++|-.+
T Consensus         3 C~IC~~~~~~~~~~~~l~C~H~fh~~   28 (44)
T PF13639_consen    3 CPICLEEFEDGEKVVKLPCGHVFHRS   28 (44)
T ss_dssp             ETTTTCBHHTTSCEEEETTSEEEEHH
T ss_pred             CcCCChhhcCCCeEEEccCCCeeCHH
Confidence            33334444556778889999998654


No 15 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=61.73  E-value=6  Score=25.30  Aligned_cols=12  Identities=33%  Similarity=0.988  Sum_probs=9.2

Q ss_pred             CCCCCCCCChhH
Q psy16822         39 RNKSCPVCMEPF   50 (97)
Q Consensus        39 ~~~~CPvC~~~~   50 (97)
                      ....|++|.+.|
T Consensus        77 ~~~~C~vC~k~l   88 (109)
T PF10367_consen   77 ESTKCSVCGKPL   88 (109)
T ss_pred             CCCCccCcCCcC
Confidence            457799998876


No 16 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=61.15  E-value=3.7  Score=23.38  Aligned_cols=32  Identities=28%  Similarity=0.500  Sum_probs=21.3

Q ss_pred             CCCCCChhHHHhhhhCCCceecccEEEeccccccccCCC
Q psy16822         42 SCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYN   80 (97)
Q Consensus        42 ~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmde~N   80 (97)
                      .||.|....  +     .....+..+||+--|.|++|+.
T Consensus         2 ~Cp~Cg~~~--~-----~~D~~~g~~vC~~CG~Vl~e~~   33 (43)
T PF08271_consen    2 KCPNCGSKE--I-----VFDPERGELVCPNCGLVLEENI   33 (43)
T ss_dssp             SBTTTSSSE--E-----EEETTTTEEEETTT-BBEE-TT
T ss_pred             CCcCCcCCc--e-----EEcCCCCeEECCCCCCEeeccc
Confidence            488887642  2     2235677889999999999875


No 17 
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=59.07  E-value=4.4  Score=31.23  Aligned_cols=26  Identities=23%  Similarity=0.478  Sum_probs=21.5

Q ss_pred             EeccccccccCCCCcee-cCCCceecccCC
Q psy16822         68 VCSISGLQFNEYNQPMV-LPNGYVYGEQEG   96 (97)
Q Consensus        68 vC~iSg~vmde~N~P~~-lPNG~VYs~~aL   96 (97)
                      .|++|++++..   |+| =.-|++|..++|
T Consensus        36 ~CaLS~~pL~~---PiV~d~~G~LynKeai   62 (260)
T PF04641_consen   36 HCALSQQPLED---PIVSDRLGRLYNKEAI   62 (260)
T ss_pred             cccCcCCccCC---CeeeCCCCeeEcHHHH
Confidence            48899999987   775 589999998765


No 18 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=58.29  E-value=6.3  Score=21.61  Aligned_cols=24  Identities=33%  Similarity=0.753  Sum_probs=11.0

Q ss_pred             CCCCCCChhHHHhhhhCCCceecccEEEecccc
Q psy16822         41 KSCPVCMEPFNTLAKSLPYARCNQSRLVCSISG   73 (97)
Q Consensus        41 ~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg   73 (97)
                      ++||.|..+         |+.+.++.+||+--|
T Consensus         3 p~Cp~C~se---------~~y~D~~~~vCp~C~   26 (30)
T PF08274_consen    3 PKCPLCGSE---------YTYEDGELLVCPECG   26 (30)
T ss_dssp             ---TTT--------------EE-SSSEEETTTT
T ss_pred             CCCCCCCCc---------ceeccCCEEeCCccc
Confidence            578888766         344778888887544


No 19 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=53.06  E-value=8.8  Score=23.35  Aligned_cols=33  Identities=18%  Similarity=0.498  Sum_probs=25.0

Q ss_pred             CCCCCCCCChhHHHhhhhCCCceecccEEEeccccccccCC
Q psy16822         39 RNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEY   79 (97)
Q Consensus        39 ~~~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmde~   79 (97)
                      .+..||.|.....+        ....-.++|+--|..+|-|
T Consensus        27 TSq~C~~CG~~~~~--------~~~~r~~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   27 TSQTCPRCGHRNKK--------RRSGRVFTCPNCGFEMDRD   59 (69)
T ss_pred             CccCccCccccccc--------ccccceEEcCCCCCEECcH
Confidence            56789999877655        4456678999989888854


No 20 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=52.00  E-value=6.2  Score=30.13  Aligned_cols=15  Identities=20%  Similarity=0.295  Sum_probs=11.6

Q ss_pred             CCceecCCCceeccc
Q psy16822         80 NQPMVLPNGYVYGEQ   94 (97)
Q Consensus        80 N~P~~lPNG~VYs~~   94 (97)
                      ..|++.+.||+|-..
T Consensus        29 ~dPVvT~CGH~FC~~   43 (193)
T PLN03208         29 RDPVVTLCGHLFCWP   43 (193)
T ss_pred             CCcEEcCCCchhHHH
Confidence            567888999988654


No 21 
>KOG2177|consensus
Probab=50.82  E-value=3.5  Score=28.95  Aligned_cols=12  Identities=42%  Similarity=1.240  Sum_probs=8.9

Q ss_pred             CCCCCCCCChhH
Q psy16822         39 RNKSCPVCMEPF   50 (97)
Q Consensus        39 ~~~~CPvC~~~~   50 (97)
                      ....||+|...|
T Consensus        12 ~~~~C~iC~~~~   23 (386)
T KOG2177|consen   12 EELTCPICLEYF   23 (386)
T ss_pred             ccccChhhHHHh
Confidence            346799997776


No 22 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=50.25  E-value=9.6  Score=26.35  Aligned_cols=32  Identities=31%  Similarity=0.713  Sum_probs=25.1

Q ss_pred             CCCCCCCCChhHHHhhhhCCCceecccEEEeccccccccCC
Q psy16822         39 RNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEY   79 (97)
Q Consensus        39 ~~~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmde~   79 (97)
                      ....||.|..=|..|-+         .-+||+.+|+...-.
T Consensus         8 tKR~Cp~CG~kFYDLnk---------~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    8 TKRTCPSCGAKFYDLNK---------DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CcccCCCCcchhccCCC---------CCccCCCCCCccCcc
Confidence            45789999999988854         447899999887755


No 23 
>PRK00420 hypothetical protein; Validated
Probab=45.42  E-value=14  Score=25.95  Aligned_cols=31  Identities=32%  Similarity=0.707  Sum_probs=21.6

Q ss_pred             CCCCCCCCChhHHHhhhhCCCceecccEEEeccccccccC
Q psy16822         39 RNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNE   78 (97)
Q Consensus        39 ~~~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmde   78 (97)
                      ....||+|.-.|-++         -+...+|+.-|++...
T Consensus        22 l~~~CP~Cg~pLf~l---------k~g~~~Cp~Cg~~~~v   52 (112)
T PRK00420         22 LSKHCPVCGLPLFEL---------KDGEVVCPVHGKVYIV   52 (112)
T ss_pred             ccCCCCCCCCcceec---------CCCceECCCCCCeeee
Confidence            347799997665333         4677888888887663


No 24 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=45.30  E-value=7.1  Score=23.13  Aligned_cols=12  Identities=33%  Similarity=1.110  Sum_probs=6.0

Q ss_pred             CCCCCCChhHHH
Q psy16822         41 KSCPVCMEPFNT   52 (97)
Q Consensus        41 ~~CPvC~~~~~~   52 (97)
                      ..||+|...|.+
T Consensus        21 ~~CPlC~r~l~~   32 (54)
T PF04423_consen   21 GCCPLCGRPLDE   32 (54)
T ss_dssp             EE-TTT--EE-H
T ss_pred             CcCCCCCCCCCH
Confidence            389999987643


No 25 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=43.35  E-value=13  Score=19.57  Aligned_cols=17  Identities=35%  Similarity=0.630  Sum_probs=8.3

Q ss_pred             CCCCCChhHHHhhhhCC
Q psy16822         42 SCPVCMEPFNTLAKSLP   58 (97)
Q Consensus        42 ~CPvC~~~~~~La~~LP   58 (97)
                      +||.|...+..-++.-|
T Consensus         2 ~CP~C~~~V~~~~~~Cp   18 (26)
T PF10571_consen    2 TCPECGAEVPESAKFCP   18 (26)
T ss_pred             cCCCCcCCchhhcCcCC
Confidence            45555555544444333


No 26 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=42.37  E-value=15  Score=20.69  Aligned_cols=18  Identities=22%  Similarity=0.451  Sum_probs=14.2

Q ss_pred             cCCCCceecCCCceeccc
Q psy16822         77 NEYNQPMVLPNGYVYGEQ   94 (97)
Q Consensus        77 de~N~P~~lPNG~VYs~~   94 (97)
                      +++.+|++++-||+|-++
T Consensus        10 ~~~~~~~l~~CgH~~C~~   27 (44)
T PF14634_consen   10 SEERRPRLTSCGHIFCEK   27 (44)
T ss_pred             cCCCCeEEcccCCHHHHH
Confidence            566789999999998543


No 27 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=41.59  E-value=13  Score=19.47  Aligned_cols=10  Identities=40%  Similarity=1.135  Sum_probs=7.8

Q ss_pred             CCCCCCChhH
Q psy16822         41 KSCPVCMEPF   50 (97)
Q Consensus        41 ~~CPvC~~~~   50 (97)
                      ..||+|...+
T Consensus         2 v~CPiC~~~v   11 (26)
T smart00734        2 VQCPVCFREV   11 (26)
T ss_pred             CcCCCCcCcc
Confidence            4699998775


No 28 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=38.55  E-value=15  Score=26.54  Aligned_cols=31  Identities=26%  Similarity=0.436  Sum_probs=22.6

Q ss_pred             CCCCCCCCChhHHHhhhhCCCceecccEEEeccccccccC
Q psy16822         39 RNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNE   78 (97)
Q Consensus        39 ~~~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmde   78 (97)
                      ....||.|..-|..|-+         +-+||+.+|+....
T Consensus         8 tKr~Cp~cg~kFYDLnk---------~p~vcP~cg~~~~~   38 (129)
T TIGR02300         8 TKRICPNTGSKFYDLNR---------RPAVSPYTGEQFPP   38 (129)
T ss_pred             ccccCCCcCccccccCC---------CCccCCCcCCccCc
Confidence            45779999888888844         44678888887653


No 29 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=38.06  E-value=25  Score=21.58  Aligned_cols=31  Identities=19%  Similarity=0.478  Sum_probs=20.8

Q ss_pred             CCCCCCChhHHHhhhhCCCceecccEEEecccccccc
Q psy16822         41 KSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFN   77 (97)
Q Consensus        41 ~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmd   77 (97)
                      .+||.|...+     .+|-... .-++.|+..|...-
T Consensus         3 ~~CP~CG~~i-----ev~~~~~-GeiV~Cp~CGaele   33 (54)
T TIGR01206         3 FECPDCGAEI-----ELENPEL-GELVICDECGAELE   33 (54)
T ss_pred             cCCCCCCCEE-----ecCCCcc-CCEEeCCCCCCEEE
Confidence            4788888766     4565555 66778887775443


No 30 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=38.00  E-value=20  Score=17.82  Aligned_cols=16  Identities=31%  Similarity=0.671  Sum_probs=12.4

Q ss_pred             CCCceecCCCceeccc
Q psy16822         79 YNQPMVLPNGYVYGEQ   94 (97)
Q Consensus        79 ~N~P~~lPNG~VYs~~   94 (97)
                      ...++.+|.|++|-.+
T Consensus         8 ~~~~~~~~C~H~~c~~   23 (39)
T smart00184        8 LKDPVVLPCGHTFCRS   23 (39)
T ss_pred             CCCcEEecCCChHHHH
Confidence            4678889999998543


No 31 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=36.98  E-value=13  Score=28.01  Aligned_cols=13  Identities=38%  Similarity=1.073  Sum_probs=10.8

Q ss_pred             CCCCCCCCChhHH
Q psy16822         39 RNKSCPVCMEPFN   51 (97)
Q Consensus        39 ~~~~CPvC~~~~~   51 (97)
                      +...||+|...|.
T Consensus         4 k~~~CPvC~~~F~   16 (214)
T PF09986_consen    4 KKITCPVCGKEFK   16 (214)
T ss_pred             CceECCCCCCeee
Confidence            5688999999873


No 32 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=36.90  E-value=8.5  Score=21.23  Aligned_cols=26  Identities=19%  Similarity=0.501  Sum_probs=16.0

Q ss_pred             CCCC-ChhHHHhhhhCCCceecccEEE
Q psy16822         43 CPVC-MEPFNTLAKSLPYARCNQSRLV   68 (97)
Q Consensus        43 CPvC-~~~~~~La~~LP~ah~~~S~Lv   68 (97)
                      ||+| ...+....+..+|....+++++
T Consensus         1 C~~C~~~~~~~~~~~~~~~~~~~~~~i   27 (46)
T TIGR03831         1 CPICGGEELEGKTTTETYEYGGELIVI   27 (46)
T ss_pred             CCCCCCceecceEEEEEEEeCCEEEEE
Confidence            7777 3556566666666665555555


No 33 
>PF09866 DUF2093:  Uncharacterized protein conserved in bacteria (DUF2093);  InterPro: IPR018661  This family of various hypothetical prokaryotic proteins has no known function. 
Probab=35.33  E-value=24  Score=20.96  Aligned_cols=14  Identities=21%  Similarity=0.475  Sum_probs=11.9

Q ss_pred             ccEEEecccccccc
Q psy16822         64 QSRLVCSISGLQFN   77 (97)
Q Consensus        64 ~S~LvC~iSg~vmd   77 (97)
                      .+..+|.+||+.+.
T Consensus         5 G~~V~CAVTg~~Ip   18 (42)
T PF09866_consen    5 GSFVRCAVTGQPIP   18 (42)
T ss_pred             CCEEEEEeeCCccc
Confidence            46789999999876


No 34 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=34.40  E-value=13  Score=31.02  Aligned_cols=11  Identities=27%  Similarity=0.851  Sum_probs=7.6

Q ss_pred             CCCCCCCChhH
Q psy16822         40 NKSCPVCMEPF   50 (97)
Q Consensus        40 ~~~CPvC~~~~   50 (97)
                      .-.||+|...|
T Consensus        26 ~l~C~IC~d~~   36 (397)
T TIGR00599        26 SLRCHICKDFF   36 (397)
T ss_pred             ccCCCcCchhh
Confidence            46788887665


No 35 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=34.31  E-value=35  Score=18.48  Aligned_cols=13  Identities=31%  Similarity=0.680  Sum_probs=10.3

Q ss_pred             c-eecCCCceeccc
Q psy16822         82 P-MVLPNGYVYGEQ   94 (97)
Q Consensus        82 P-~~lPNG~VYs~~   94 (97)
                      | ++++.||+|-++
T Consensus        11 ~~~~~~CGH~fC~~   24 (39)
T PF13923_consen   11 PVVVTPCGHSFCKE   24 (39)
T ss_dssp             EEEECTTSEEEEHH
T ss_pred             cCEECCCCCchhHH
Confidence            6 689999999543


No 36 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=33.21  E-value=33  Score=25.39  Aligned_cols=29  Identities=21%  Similarity=0.503  Sum_probs=22.7

Q ss_pred             cCCCCCCCCChhHHHhhhhCCCceecccEEEeccccccccCC
Q psy16822         38 TRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEY   79 (97)
Q Consensus        38 ~~~~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmde~   79 (97)
                      ..+..||.|..             -....+.|+-.|.++|-|
T Consensus       307 ~tS~~C~~cg~-------------~~~r~~~C~~cg~~~~rD  335 (364)
T COG0675         307 YTSKTCPCCGH-------------LSGRLFKCPRCGFVHDRD  335 (364)
T ss_pred             CCcccccccCC-------------ccceeEECCCCCCeehhh
Confidence            36688999987             235668999999998855


No 37 
>KOG3039|consensus
Probab=32.15  E-value=15  Score=29.72  Aligned_cols=17  Identities=24%  Similarity=0.804  Sum_probs=15.1

Q ss_pred             CCceecCCCceecccCC
Q psy16822         80 NQPMVLPNGYVYGEQEG   96 (97)
Q Consensus        80 N~P~~lPNG~VYs~~aL   96 (97)
                      -.||+-|.||+|.+++|
T Consensus        54 ~dPvit~~GylfdrEaI   70 (303)
T KOG3039|consen   54 RDPVITPDGYLFDREAI   70 (303)
T ss_pred             cCCccCCCCeeeeHHHH
Confidence            57899999999998875


No 38 
>PF10588 NADH-G_4Fe-4S_3:  NADH-ubiquinone oxidoreductase-G iron-sulfur binding region;  InterPro: IPR019574  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This family does not contain related subunits from formate dehydrogenase complexes.  This entry represents the iron-sulphur binding domain of the G subunit.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 3I9V_3.
Probab=31.22  E-value=28  Score=19.80  Aligned_cols=18  Identities=28%  Similarity=0.615  Sum_probs=10.1

Q ss_pred             CCCCCCCCChh----HHHhhhh
Q psy16822         39 RNKSCPVCMEP----FNTLAKS   56 (97)
Q Consensus        39 ~~~~CPvC~~~----~~~La~~   56 (97)
                      .+.+|++|...    |+++|..
T Consensus        12 H~~dC~~C~~~G~CeLQ~~~~~   33 (41)
T PF10588_consen   12 HPLDCPTCDKNGNCELQDLAYE   33 (41)
T ss_dssp             ----TTT-TTGGG-HHHHHHHH
T ss_pred             CCCcCcCCCCCCCCHHHHHHHH
Confidence            56789999876    7777764


No 39 
>KOG0883|consensus
Probab=30.77  E-value=25  Score=30.24  Aligned_cols=32  Identities=25%  Similarity=0.563  Sum_probs=25.2

Q ss_pred             hhCCCceecccEEEeccccccccCCCCceecCCCceecccCC
Q psy16822         55 KSLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVYGEQEG   96 (97)
Q Consensus        55 ~~LP~ah~~~S~LvC~iSg~vmde~N~P~~lPNG~VYs~~aL   96 (97)
                      +.|||.|+.-+.+=          -+.|+..+.|.||...+|
T Consensus        36 krLP~~hC~lt~~P----------fe~PvC~~dg~vFd~~~I   67 (518)
T KOG0883|consen   36 KRLPFNHCSLTMLP----------FEDPVCTVDGTVFDLTAI   67 (518)
T ss_pred             ccCChhhceecccc----------ccCcccccCCcEEeeehh
Confidence            58999999988863          477888888888876654


No 40 
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=29.86  E-value=23  Score=22.08  Aligned_cols=11  Identities=18%  Similarity=0.459  Sum_probs=5.2

Q ss_pred             cccEEEecccc
Q psy16822         63 NQSRLVCSISG   73 (97)
Q Consensus        63 ~~S~LvC~iSg   73 (97)
                      .+..+.|+.+|
T Consensus        11 ~~v~~~Cp~cG   21 (55)
T PF13824_consen   11 AHVNFECPDCG   21 (55)
T ss_pred             cccCCcCCCCC
Confidence            34444555544


No 41 
>PF05237 MoeZ_MoeB:  MoeZ/MoeB domain;  InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein. The domain has two CXXC motifs that are only partly conserved. MoeZ is necessary for the synthesis of pyridine-2,6-bis(thiocarboxylic acid), a small secreted metabolite that has a high affinity for transition metals, increases iron uptake efficiency by 20% in Pseudomonas stutzeri, has the ability to reduce both soluble and mineral forms of iron, and has antimicrobial activity towards several species of bacteria. MoeB is the molybdopterin synthase activating enzyme in the molybdopterin cofactor biosynthesis pathway. Both these enzymes are members of a superfamily consisting of related but structurally distinct proteins that are members of pathways involved in the transfer of sulphur-containing moieties to metabolites [] and both also contain the UBA/THIF-type NAD/FAD binding fold (IPR000594 from INTERPRO). ; PDB: 1JWA_B 1JW9_B 1JWB_B 1ZKM_D 1ZUD_3 1ZFN_D.
Probab=29.74  E-value=23  Score=22.58  Aligned_cols=11  Identities=45%  Similarity=1.105  Sum_probs=4.8

Q ss_pred             cCCCCCCCCCh
Q psy16822         38 TRNKSCPVCME   48 (97)
Q Consensus        38 ~~~~~CPvC~~   48 (97)
                      .++.+||+|.+
T Consensus        72 ~k~~~C~~C~~   82 (84)
T PF05237_consen   72 KKNPDCPVCGP   82 (84)
T ss_dssp             ---TT-TTT--
T ss_pred             CCCccCcCcCc
Confidence            37899999975


No 42 
>PHA02446 hypothetical protein
Probab=28.58  E-value=13  Score=27.20  Aligned_cols=39  Identities=18%  Similarity=0.388  Sum_probs=31.0

Q ss_pred             CCCCCCCCChhHHHhhhhCCCceecccEEEecccccccc
Q psy16822         39 RNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFN   77 (97)
Q Consensus        39 ~~~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmd   77 (97)
                      +...||+|..+-+-.....=-||-..-.--|++||+-..
T Consensus        61 ~~q~cp~cg~dawv~~~g~~eahpd~l~qecplsgqsv~   99 (166)
T PHA02446         61 EQQQCPLCGQDAWVIHTGIVEAHPDKLLQECPLSGQSVA   99 (166)
T ss_pred             hhhcCCCcccceeEeecCccccCcHHHHHhCCCCCCccc
Confidence            457899999998888777777887777777899887654


No 43 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=28.05  E-value=25  Score=24.80  Aligned_cols=40  Identities=18%  Similarity=0.428  Sum_probs=24.7

Q ss_pred             CCCCCCCChhHHHhhhhCCCceecccEEEeccccccccCCCC
Q psy16822         40 NKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQ   81 (97)
Q Consensus        40 ~~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmde~N~   81 (97)
                      .-.||.|...+.-+ +.+=..+ ....+.|+..|+.+-+++.
T Consensus        99 ~Y~Cp~C~~~y~~~-ea~~~~d-~~~~f~Cp~Cg~~l~~~dn  138 (147)
T smart00531       99 YYKCPNCQSKYTFL-EANQLLD-MDGTFTCPRCGEELEEDDN  138 (147)
T ss_pred             EEECcCCCCEeeHH-HHHHhcC-CCCcEECCCCCCEEEEcCc
Confidence            35699998775433 2111111 2455999999999875543


No 44 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=27.69  E-value=34  Score=19.19  Aligned_cols=17  Identities=29%  Similarity=0.743  Sum_probs=11.3

Q ss_pred             EEEeccccccccC-CCCc
Q psy16822         66 RLVCSISGLQFNE-YNQP   82 (97)
Q Consensus        66 ~LvC~iSg~vmde-~N~P   82 (97)
                      |.+|+-.|++-+. .|||
T Consensus         1 Rr~C~~Cg~~Yh~~~~pP   18 (36)
T PF05191_consen    1 RRICPKCGRIYHIEFNPP   18 (36)
T ss_dssp             EEEETTTTEEEETTTB--
T ss_pred             CcCcCCCCCccccccCCC
Confidence            5688888888884 4544


No 45 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=27.58  E-value=18  Score=16.66  Aligned_cols=11  Identities=36%  Similarity=1.234  Sum_probs=5.9

Q ss_pred             CCCCCChhHHH
Q psy16822         42 SCPVCMEPFNT   52 (97)
Q Consensus        42 ~CPvC~~~~~~   52 (97)
                      .|+.|...+..
T Consensus         2 ~C~~C~~~~~~   12 (24)
T PF13894_consen    2 QCPICGKSFRS   12 (24)
T ss_dssp             E-SSTS-EESS
T ss_pred             CCcCCCCcCCc
Confidence            48888776543


No 46 
>PRK10220 hypothetical protein; Provisional
Probab=27.57  E-value=47  Score=23.49  Aligned_cols=11  Identities=36%  Similarity=0.951  Sum_probs=5.1

Q ss_pred             CCCCCCChhHH
Q psy16822         41 KSCPVCMEPFN   51 (97)
Q Consensus        41 ~~CPvC~~~~~   51 (97)
                      -.||-|.-+|+
T Consensus        21 ~vCpeC~hEW~   31 (111)
T PRK10220         21 YICPECAHEWN   31 (111)
T ss_pred             EECCcccCcCC
Confidence            34555544443


No 47 
>cd00714 GFAT Glutamine amidotransferases class-II (Gn-AT)_GFAT-type. This domain is found at the N-terminus of glucosamine-6P synthase (GlmS, or GFAT in humans).  The glutaminase domain catalyzes amide nitrogen transfer from glutamine to the appropriate substrate. In this process, glutamine is hydrolyzed to glutamic acid and ammonia. In humans, GFAT catalyzes the first and rate-limiting step of hexosamine metabolism, the conversion of D-fructose-6P (Fru6P) into D-glucosamine-6P using L-glutamine as a nitrogen source.  The end product of this pathway, UDP-N-acetyl glucosamine, is a major building block of the bacterial peptidoglycan and fungal chitin.
Probab=27.09  E-value=18  Score=26.73  Aligned_cols=31  Identities=19%  Similarity=0.205  Sum_probs=22.3

Q ss_pred             cccEEEeccccccccCCCCceecC--------CCceecccC
Q psy16822         63 NQSRLVCSISGLQFNEYNQPMVLP--------NGYVYGEQE   95 (97)
Q Consensus        63 ~~S~LvC~iSg~vmde~N~P~~lP--------NG~VYs~~a   95 (97)
                      .|.|+  ++.|.+.+++.+|+...        ||.+|..+.
T Consensus        69 gH~R~--at~g~~~~~n~qPf~~~~~~~~~vhNG~I~N~~~  107 (215)
T cd00714          69 GHTRW--ATHGEPTDVNAHPHRSCDGEIAVVHNGIIENYAE  107 (215)
T ss_pred             EEEEc--cCCCCCCccCCCCCCcCCCCEEEEEeEEEcCHHH
Confidence            35555  67787778899999887        677776543


No 48 
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]
Probab=26.92  E-value=64  Score=26.75  Aligned_cols=46  Identities=24%  Similarity=0.319  Sum_probs=33.1

Q ss_pred             hhHHHhhh--hCCCceecccEEEeccc-cc---c----ccCCCCceecCCCceecc
Q psy16822         48 EPFNTLAK--SLPYARCNQSRLVCSIS-GL---Q----FNEYNQPMVLPNGYVYGE   93 (97)
Q Consensus        48 ~~~~~La~--~LP~ah~~~S~LvC~iS-g~---v----mde~N~P~~lPNG~VYs~   93 (97)
                      ++++++|+  .||.|..-.|.-||.|- |.   .    .....--|+=.+|.||++
T Consensus       172 ~evR~iA~~~gL~~a~KkdS~~ICFi~~~~~~~fl~~~~p~~~G~ii~~~G~v~g~  227 (356)
T COG0482         172 LEVRPIAAEKGLPTAKKKDSQGICFIGERKFKDFLGRYLPAKPGEIIDKDGKVLGE  227 (356)
T ss_pred             HHHHHHHHHcCCCccCcccCCcceecCCCCHHHHHHhhCCCCCceEEecCCcEeee
Confidence            56899998  89999999999999998 21   1    222233456677777765


No 49 
>PRK01343 zinc-binding protein; Provisional
Probab=26.81  E-value=30  Score=21.69  Aligned_cols=12  Identities=33%  Similarity=0.941  Sum_probs=8.8

Q ss_pred             CCCCCCCCChhH
Q psy16822         39 RNKSCPVCMEPF   50 (97)
Q Consensus        39 ~~~~CPvC~~~~   50 (97)
                      ....||+|.+.+
T Consensus         8 p~~~CP~C~k~~   19 (57)
T PRK01343          8 PTRPCPECGKPS   19 (57)
T ss_pred             CCCcCCCCCCcC
Confidence            346799998765


No 50 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=26.11  E-value=15  Score=21.08  Aligned_cols=26  Identities=23%  Similarity=0.370  Sum_probs=18.4

Q ss_pred             cEEEeccccccccCCCCceecCCCceec
Q psy16822         65 SRLVCSISGLQFNEYNQPMVLPNGYVYG   92 (97)
Q Consensus        65 S~LvC~iSg~vmde~N~P~~lPNG~VYs   92 (97)
                      .-+.|..=++.+++..  +..-+|.+|-
T Consensus        25 ~Cf~C~~C~~~l~~~~--~~~~~~~~~C   50 (58)
T PF00412_consen   25 ECFKCSKCGKPLNDGD--FYEKDGKPYC   50 (58)
T ss_dssp             TTSBETTTTCBTTTSS--EEEETTEEEE
T ss_pred             cccccCCCCCccCCCe--eEeECCEEEC
Confidence            3467777777777666  7777778774


No 51 
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=25.91  E-value=23  Score=26.58  Aligned_cols=15  Identities=20%  Similarity=0.485  Sum_probs=0.0

Q ss_pred             cEEEeccccccccCC
Q psy16822         65 SRLVCSISGLQFNEY   79 (97)
Q Consensus        65 S~LvC~iSg~vmde~   79 (97)
                      -.++|+|||+.+..+
T Consensus       167 ~~~~cPitGe~IP~~  181 (229)
T PF12230_consen  167 KMIICPITGEMIPAD  181 (229)
T ss_dssp             ---------------
T ss_pred             ccccccccccccccc
Confidence            358999999987654


No 52 
>COG3908 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.87  E-value=41  Score=22.24  Aligned_cols=16  Identities=19%  Similarity=0.407  Sum_probs=13.2

Q ss_pred             cccEEEeccccccccC
Q psy16822         63 NQSRLVCSISGLQFNE   78 (97)
Q Consensus        63 ~~S~LvC~iSg~vmde   78 (97)
                      ..|..+|.+||+.+.-
T Consensus        27 ~GsfV~CAVtgk~IPl   42 (77)
T COG3908          27 PGSFVLCAVTGKPIPL   42 (77)
T ss_pred             CCcEEEEEecCCcccH
Confidence            4688999999998763


No 53 
>PF13522 GATase_6:  Glutamine amidotransferase domain
Probab=24.89  E-value=48  Score=22.67  Aligned_cols=44  Identities=25%  Similarity=0.314  Sum_probs=24.7

Q ss_pred             hHHHhhhhCCCce-ecccEEEeccccccccCCCCce--------ecCCCceeccc
Q psy16822         49 PFNTLAKSLPYAR-CNQSRLVCSISGLQFNEYNQPM--------VLPNGYVYGEQ   94 (97)
Q Consensus        49 ~~~~La~~LP~ah-~~~S~LvC~iSg~vmde~N~P~--------~lPNG~VYs~~   94 (97)
                      ++..+++.+.-.. ..|.|+  ...|..-.++|.|+        +.=||.|+..+
T Consensus         2 d~~~~~~~~~~~~~lgH~R~--AT~G~~~~~~~hPf~~~~g~~~~~HNG~i~n~~   54 (133)
T PF13522_consen    2 DFEGLASWLDGEAALGHTRY--ATVGSPTEENNHPFSNRDGRIALAHNGNIDNYK   54 (133)
T ss_pred             ChHHHHHhcCCCEEEEEeec--CCCCCCCCcCCCCCcCCCCCEEEEECCeecCHH
Confidence            4555555443321 124444  46788877777998        34566666554


No 54 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=24.69  E-value=54  Score=20.25  Aligned_cols=23  Identities=35%  Similarity=0.790  Sum_probs=15.2

Q ss_pred             CCCCCCCCCh-hHHHhhhhCCCceecccEEEec
Q psy16822         39 RNKSCPVCME-PFNTLAKSLPYARCNQSRLVCS   70 (97)
Q Consensus        39 ~~~~CPvC~~-~~~~La~~LP~ah~~~S~LvC~   70 (97)
                      .+..||-|.+ .|        +|+|-. |+.|-
T Consensus        18 k~~~CPrCG~gvf--------mA~H~d-R~~CG   41 (51)
T COG1998          18 KNRFCPRCGPGVF--------MADHKD-RWACG   41 (51)
T ss_pred             ccccCCCCCCcch--------hhhcCc-eeEec
Confidence            6789999986 33        344544 66664


No 55 
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=24.38  E-value=46  Score=25.12  Aligned_cols=9  Identities=44%  Similarity=1.575  Sum_probs=6.7

Q ss_pred             CCCCCChhH
Q psy16822         42 SCPVCMEPF   50 (97)
Q Consensus        42 ~CPvC~~~~   50 (97)
                      .||+|...+
T Consensus         4 ~CP~C~~~l   12 (272)
T PRK11088          4 QCPLCHQPL   12 (272)
T ss_pred             cCCCCCcch
Confidence            588887765


No 56 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=24.36  E-value=40  Score=18.79  Aligned_cols=29  Identities=38%  Similarity=0.907  Sum_probs=13.5

Q ss_pred             CCCCChhHHHhhhhCCCceecccEEEecccccc
Q psy16822         43 CPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQ   75 (97)
Q Consensus        43 CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~v   75 (97)
                      ||.|...   |...+| +--.+.|+||+--|.|
T Consensus         3 C~~CG~~---l~~~ip-~gd~r~R~vC~~Cg~I   31 (34)
T PF14803_consen    3 CPQCGGP---LERRIP-EGDDRERLVCPACGFI   31 (34)
T ss_dssp             -TTT--B----EEE---TT-SS-EEEETTTTEE
T ss_pred             cccccCh---hhhhcC-CCCCccceECCCCCCE
Confidence            7778665   344555 4456778888766544


No 57 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=24.28  E-value=28  Score=17.81  Aligned_cols=12  Identities=42%  Similarity=1.099  Sum_probs=9.4

Q ss_pred             CCCCCCChhHHH
Q psy16822         41 KSCPVCMEPFNT   52 (97)
Q Consensus        41 ~~CPvC~~~~~~   52 (97)
                      ..||.|...|+.
T Consensus         3 ~~C~~CgR~F~~   14 (25)
T PF13913_consen    3 VPCPICGRKFNP   14 (25)
T ss_pred             CcCCCCCCEECH
Confidence            469999988754


No 58 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=24.22  E-value=61  Score=19.49  Aligned_cols=24  Identities=21%  Similarity=0.397  Sum_probs=18.4

Q ss_pred             EeccccccccCCC-CceecCCCcee
Q psy16822         68 VCSISGLQFNEYN-QPMVLPNGYVY   91 (97)
Q Consensus        68 vC~iSg~vmde~N-~P~~lPNG~VY   91 (97)
                      .|.++|..+.... .-++--+|.||
T Consensus         3 ~C~fcG~~I~pg~G~~~vr~Dgkv~   27 (52)
T PRK00807          3 TCSFCGKEIEPGTGKMYVKKDGTIL   27 (52)
T ss_pred             ccCCCCCeEcCCCCeEEEEeCCcEE
Confidence            5899999999444 44477899998


No 59 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=24.18  E-value=24  Score=18.75  Aligned_cols=10  Identities=40%  Similarity=1.045  Sum_probs=4.7

Q ss_pred             CCCCCChhHH
Q psy16822         42 SCPVCMEPFN   51 (97)
Q Consensus        42 ~CPvC~~~~~   51 (97)
                      .||+|...+.
T Consensus         1 ~CP~C~s~l~   10 (28)
T PF03119_consen    1 TCPVCGSKLV   10 (28)
T ss_dssp             B-TTT--BEE
T ss_pred             CcCCCCCEeE
Confidence            4899976653


No 60 
>PF10915 DUF2709:  Protein of unknown function (DUF2709);  InterPro: IPR024484 Members of this family appear restricted to Chlamydiales. Their function is unknown.
Probab=23.72  E-value=54  Score=25.75  Aligned_cols=20  Identities=15%  Similarity=0.458  Sum_probs=16.0

Q ss_pred             eecccEEEeccccccccCCC
Q psy16822         61 RCNQSRLVCSISGLQFNEYN   80 (97)
Q Consensus        61 h~~~S~LvC~iSg~vmde~N   80 (97)
                      ..+.-+-||++||+|.-+|-
T Consensus        82 E~TkkIYICPFTGKVF~DNt  101 (238)
T PF10915_consen   82 EQTKKIYICPFTGKVFGDNT  101 (238)
T ss_pred             cccceEEEcCCcCccccCCC
Confidence            34566789999999998874


No 61 
>KOG4265|consensus
Probab=22.64  E-value=39  Score=28.09  Aligned_cols=17  Identities=29%  Similarity=0.995  Sum_probs=14.1

Q ss_pred             CCCCCCCCChhHHHhhh
Q psy16822         39 RNKSCPVCMEPFNTLAK   55 (97)
Q Consensus        39 ~~~~CPvC~~~~~~La~   55 (97)
                      ..++||+|...+.+|.+
T Consensus       324 q~n~CPICRqpi~~ll~  340 (349)
T KOG4265|consen  324 QTNNCPICRQPIEELLE  340 (349)
T ss_pred             hhcCCCccccchHhhhe
Confidence            47899999999888754


No 62 
>PRK07758 hypothetical protein; Provisional
Probab=22.59  E-value=37  Score=23.31  Aligned_cols=17  Identities=24%  Similarity=0.729  Sum_probs=9.9

Q ss_pred             cccccccccCCCCCCCC
Q psy16822         30 QCSSEVMETRNKSCPVC   46 (97)
Q Consensus        30 ~C~~~~~~~~~~~CPvC   46 (97)
                      .|.....+.++.+||.|
T Consensus         9 ~~~~~~~~~~~~~~~~~   25 (95)
T PRK07758          9 TCEKGHEYYKSSDCPTC   25 (95)
T ss_pred             HHhcccceeccCCCCCC
Confidence            46555444566666666


No 63 
>PF13395 HNH_4:  HNH endonuclease
Probab=22.46  E-value=34  Score=20.23  Aligned_cols=12  Identities=25%  Similarity=0.443  Sum_probs=10.1

Q ss_pred             eccccccccCCC
Q psy16822         69 CSISGLQFNEYN   80 (97)
Q Consensus        69 C~iSg~vmde~N   80 (97)
                      |.+||+.|+.++
T Consensus         1 C~Y~g~~i~~~~   12 (54)
T PF13395_consen    1 CPYCGKPISIEN   12 (54)
T ss_pred             CCCCCCCCChhh
Confidence            889999999665


No 64 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=22.37  E-value=28  Score=19.86  Aligned_cols=13  Identities=46%  Similarity=1.331  Sum_probs=9.6

Q ss_pred             CCCCCCCCChhHH
Q psy16822         39 RNKSCPVCMEPFN   51 (97)
Q Consensus        39 ~~~~CPvC~~~~~   51 (97)
                      ....||+|...+.
T Consensus        36 ~~~~CP~Cr~~i~   48 (50)
T PF13920_consen   36 RKKKCPICRQPIE   48 (50)
T ss_dssp             TTSBBTTTTBB-S
T ss_pred             cCCCCCcCChhhc
Confidence            5688999987764


No 65 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=21.95  E-value=35  Score=17.60  Aligned_cols=9  Identities=56%  Similarity=1.730  Sum_probs=5.0

Q ss_pred             CCCCCChhH
Q psy16822         42 SCPVCMEPF   50 (97)
Q Consensus        42 ~CPvC~~~~   50 (97)
                      +|++|...+
T Consensus         1 ~C~iC~~~~    9 (45)
T cd00162           1 ECPICLEEF    9 (45)
T ss_pred             CCCcCchhh
Confidence            366665554


No 66 
>PF05477 SURF2:  Surfeit locus protein 2 (SURF2);  InterPro: IPR008833 Surfeit locus protein 2 is part of a group of at least six sequence unrelated genes (Surf-1 to Surf-6). The six Surfeit genes have been classified as housekeeping genes, being expressed in all tissue types tested and not containing a TATA box in their promoter region. The exact function of SURF2 is unknown [].
Probab=21.94  E-value=46  Score=26.19  Aligned_cols=19  Identities=26%  Similarity=0.628  Sum_probs=15.4

Q ss_pred             ceecccEEEeccccccccC
Q psy16822         60 ARCNQSRLVCSISGLQFNE   78 (97)
Q Consensus        60 ah~~~S~LvC~iSg~vmde   78 (97)
                      +....+.|+|.|||..+|-
T Consensus        73 s~~~~~~LfCkLT~~~iNk   91 (244)
T PF05477_consen   73 STKNPHKLFCKLTGRHINK   91 (244)
T ss_pred             ccCCCceeEEechHhHhcc
Confidence            3445788999999999984


No 67 
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-redoxin is a representative of a class of small redox proteins that contain a conserved CXXC motif and are characterized by a glutaredoxin-like amino acid sequence and thioredoxin-like activity profile. Unlike other the glutaredoxins to which it is most closely related, NrdH aparrently does not interact with glutathione/glutathione reductase, but rather with thioredoxin reductase to catalyze the reduction of ribonucleotide reductase.
Probab=21.83  E-value=35  Score=20.47  Aligned_cols=24  Identities=13%  Similarity=0.416  Sum_probs=18.1

Q ss_pred             CCCCCCCCChhHHHhhh-hCCCcee
Q psy16822         39 RNKSCPVCMEPFNTLAK-SLPYARC   62 (97)
Q Consensus        39 ~~~~CPvC~~~~~~La~-~LP~ah~   62 (97)
                      ....||-|....+-|.+ ++||.-+
T Consensus         5 ~~~~Cp~C~~ak~~L~~~~i~~~~~   29 (72)
T TIGR02194         5 SKNNCVQCKMTKKALEEHGIAFEEI   29 (72)
T ss_pred             eCCCCHHHHHHHHHHHHCCCceEEE
Confidence            45789999888877877 6777543


No 68 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=21.83  E-value=70  Score=22.52  Aligned_cols=12  Identities=33%  Similarity=0.905  Sum_probs=6.0

Q ss_pred             CCCCCCChhHHH
Q psy16822         41 KSCPVCMEPFNT   52 (97)
Q Consensus        41 ~~CPvC~~~~~~   52 (97)
                      --||-|.-+|.+
T Consensus        20 ~iCpeC~~EW~~   31 (109)
T TIGR00686        20 LICPSCLYEWNE   31 (109)
T ss_pred             eECccccccccc
Confidence            445555555443


No 69 
>PF13186 SPASM:  Iron-sulfur cluster-binding domain
Probab=21.26  E-value=50  Score=18.71  Aligned_cols=10  Identities=40%  Similarity=0.737  Sum_probs=7.9

Q ss_pred             eecCCCceec
Q psy16822         83 MVLPNGYVYG   92 (97)
Q Consensus        83 ~~lPNG~VYs   92 (97)
                      .+.|+|.||.
T Consensus         9 ~I~~dG~v~p   18 (64)
T PF13186_consen    9 YIDPDGDVYP   18 (64)
T ss_pred             EEeeCccEEe
Confidence            4689999984


No 70 
>PF14169 YdjO:  Cold-inducible protein YdjO
Probab=20.61  E-value=46  Score=20.96  Aligned_cols=21  Identities=29%  Similarity=0.768  Sum_probs=14.3

Q ss_pred             cCCCCCCCCChhHHHhhhhCC
Q psy16822         38 TRNKSCPVCMEPFNTLAKSLP   58 (97)
Q Consensus        38 ~~~~~CPvC~~~~~~La~~LP   58 (97)
                      ...+.||.|...+.+=.+.||
T Consensus        37 ~~~p~CPlC~s~M~~~~r~Lp   57 (59)
T PF14169_consen   37 EEEPVCPLCKSPMVSGTRMLP   57 (59)
T ss_pred             CCCccCCCcCCccccceeecc
Confidence            356899999887655444444


No 71 
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins.
Probab=20.41  E-value=35  Score=22.35  Aligned_cols=18  Identities=39%  Similarity=0.755  Sum_probs=13.8

Q ss_pred             CCCCCCCCChhHHHhhhh
Q psy16822         39 RNKSCPVCMEPFNTLAKS   56 (97)
Q Consensus        39 ~~~~CPvC~~~~~~La~~   56 (97)
                      ...-||.|..++..|++-
T Consensus        32 ~~~~Cp~C~~~~~~l~~~   49 (149)
T cd02970          32 RGFGCPFCREYLRALSKL   49 (149)
T ss_pred             CCCCChhHHHHHHHHHHH
Confidence            457899999887776653


No 72 
>PF12792 CSS-motif:  CSS motif domain associated with EAL ;  InterPro: IPR024744 This domain, with its characteristic highly conserved CSS sequence motif, is found N-terminal to the EAL domain (PF00563 from PFAM), found in many putative cyclic diguanylate phosphodiesterases.
Probab=20.28  E-value=57  Score=22.52  Aligned_cols=30  Identities=20%  Similarity=0.311  Sum_probs=18.2

Q ss_pred             CCCChh-HHHhhhhCCCceec-------ccEEEecccc
Q psy16822         44 PVCMEP-FNTLAKSLPYARCN-------QSRLVCSISG   73 (97)
Q Consensus        44 PvC~~~-~~~La~~LP~ah~~-------~S~LvC~iSg   73 (97)
                      .-|++. +.+|.+.+=++.+.       +.+++|+--+
T Consensus        38 ~~Cs~~~~~~Lr~~~~~~~~ir~i~~~~~g~i~CSS~~   75 (208)
T PF12792_consen   38 QPCSPAHLNALRQIVARSPYIRDIGLVRNGRIYCSSLW   75 (208)
T ss_pred             CCCCHHHHHHHHHHHHhchhhhheeEEeCCeEEecCCC
Confidence            347777 66666655444444       5667787644


Done!