Diaphorina citri psyllid: psy16824


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MYSLALAKFDLPGEAGFPLNSVYAKPQSQNEADLMKNYLTQVRQETGLRVCERVFNTPDGKPSKWWLCFSKKRFMDKSLTALGQS
ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEECcccccccccccccccc
*YSLALAKFDLPGEAGFPLNSVYAKP*******LMKNYLTQVRQETGLRVCERVFNTPDGKPSKWWLCFSKKRFMD*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSLALAKFDLPGEAGFPLNSVYAKPQSQNEADLMKNYLTQVRQETGLRVCERVFNTPDGKPSKWWLCFSKKRFMDKSLTALGQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-related protein 2/3 complex subunit 3 Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.confidentQ9Y7J4
Actin-related protein 2/3 complex subunit 3 Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.confidentQ05933
Actin-related protein 2/3 complex subunit 3 Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.confidentO15145

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032432 [CC]actin filament bundleprobableGO:0005856, GO:0005575, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0051286 [CC]cell tipprobableGO:0005575, GO:0044464, GO:0005623, GO:0060187
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0034314 [BP]Arp2/3 complex-mediated actin nucleationprobableGO:0033043, GO:0043933, GO:0030036, GO:0051128, GO:0008064, GO:0071840, GO:0050789, GO:0044699, GO:0030832, GO:0030833, GO:0071822, GO:0030838, GO:0051495, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032273, GO:0048518, GO:0065008, GO:0051130, GO:0032970, GO:0030029, GO:0009987, GO:0031334, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0006996, GO:0007015, GO:0007010, GO:0045010, GO:0010638, GO:0044087, GO:0008150, GO:0032535, GO:0048522
GO:0030479 [CC]actin cortical patchprobableGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0030864, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0051234 [BP]establishment of localizationprobableGO:0008150, GO:0051179
GO:0005826 [CC]actomyosin contractile ringprobableGO:0015629, GO:0043229, GO:0043228, GO:0070938, GO:0043226, GO:0005856, GO:0005575, GO:0044430, GO:0005737, GO:0032153, GO:0032155, GO:0005938, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0071944, GO:0044448, GO:0044424, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0005885 [CC]Arp2/3 protein complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8K, chain E
Confidence level:very confident
Coverage over the Query: 1-81
View the alignment between query and template
View the model in PyMOL