Query         psy16828
Match_columns 372
No_of_seqs    213 out of 2670
Neff          11.2
Searched_HMMs 46136
Date          Fri Aug 16 23:04:25 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16828.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16828hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1074|consensus              100.0   1E-29 2.2E-34  226.6   2.0  164  208-372   606-931 (958)
  2 KOG1074|consensus              100.0 5.3E-29 1.2E-33  222.1   5.3  109  149-259   604-732 (958)
  3 KOG2462|consensus               99.9 1.1E-27 2.4E-32  188.6   5.3  135  177-314   128-265 (279)
  4 KOG2462|consensus               99.9 5.3E-28 1.2E-32  190.3   2.9  133  205-340   128-263 (279)
  5 KOG3608|consensus               99.9 4.7E-26   1E-30  184.0  13.2  274   82-360    69-398 (467)
  6 KOG3608|consensus               99.9 2.5E-25 5.4E-30  179.8  11.2  224   81-319   133-379 (467)
  7 KOG3623|consensus               99.9 3.1E-24 6.8E-29  188.8   4.9  119   82-201   210-331 (1007)
  8 KOG3623|consensus               99.8 6.5E-21 1.4E-25  168.1   5.4   77  264-341   894-971 (1007)
  9 KOG3576|consensus               99.7 1.3E-18 2.8E-23  130.3   2.4  124  232-372   113-236 (267)
 10 KOG3576|consensus               99.6 1.1E-16 2.4E-21  120.0   2.1  127  176-320   114-240 (267)
 11 PLN03086 PRLI-interacting fact  99.3 1.6E-12 3.4E-17  116.5   6.8  142  207-369   407-561 (567)
 12 PLN03086 PRLI-interacting fact  99.3 1.7E-12 3.7E-17  116.2   7.0  146  178-343   406-563 (567)
 13 PHA00733 hypothetical protein   99.1 5.4E-11 1.2E-15   86.8   4.4   82  234-317    38-124 (128)
 14 KOG3993|consensus               99.0 1.7E-10 3.7E-15   96.9   2.8  162  208-370   268-480 (500)
 15 PHA00733 hypothetical protein   99.0 6.1E-10 1.3E-14   81.3   4.3   83  205-289    38-124 (128)
 16 PHA02768 hypothetical protein;  98.9 8.1E-10 1.8E-14   65.6   2.0   38  293-333     6-43  (55)
 17 KOG3993|consensus               98.8 8.1E-10 1.7E-14   92.9   1.3  197   81-286   266-480 (500)
 18 PHA02768 hypothetical protein;  98.8 4.8E-09   1E-13   62.4   2.6   44  264-309     5-48  (55)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.7 1.1E-08 2.4E-13   51.9   1.9   25  279-303     1-25  (26)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.5   1E-08 2.2E-13   52.0  -0.8   24  336-359     2-25  (26)
 21 PHA00616 hypothetical protein   98.4 1.5E-07 3.3E-12   53.1   1.6   29  292-320     1-29  (44)
 22 PHA00616 hypothetical protein   98.4 1.9E-07 4.2E-12   52.7   1.6   34  264-297     1-34  (44)
 23 PHA00732 hypothetical protein   98.3 6.7E-07 1.5E-11   58.9   3.1   50  264-319     1-51  (79)
 24 PF05605 zf-Di19:  Drought indu  98.2 1.6E-06 3.5E-11   53.0   3.7   52   21-106     2-53  (54)
 25 PHA00732 hypothetical protein   98.2 1.2E-06 2.5E-11   57.8   3.0   48  292-344     1-48  (79)
 26 KOG1146|consensus               98.1   4E-06 8.8E-11   81.3   5.5  125    6-138   449-617 (1406)
 27 PF05605 zf-Di19:  Drought indu  98.0 6.8E-06 1.5E-10   50.3   3.8   49   83-134     3-53  (54)
 28 PF00096 zf-C2H2:  Zinc finger,  98.0 2.6E-06 5.5E-11   42.0   1.4   23  349-371     1-23  (23)
 29 PF12756 zf-C2H2_2:  C2H2 type   98.0 3.1E-06 6.6E-11   60.0   2.4   73  294-371     1-73  (100)
 30 PF00096 zf-C2H2:  Zinc finger,  98.0   4E-06 8.8E-11   41.2   1.5   22  293-314     1-22  (23)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.4E-05 3.1E-10   39.7   2.0   24  349-372     1-24  (24)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.9E-05 4.1E-10   55.9   2.7   73   23-105     1-73  (100)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.7 2.1E-05 4.6E-10   39.1   1.7   24  293-316     1-24  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.6 2.8E-05 6.1E-10   39.9   1.5   26  292-317     1-26  (27)
 35 PF13912 zf-C2H2_6:  C2H2-type   97.6 3.6E-05 7.9E-10   39.5   1.4   25  348-372     1-25  (27)
 36 COG5189 SFP1 Putative transcri  97.2 0.00014 3.1E-09   59.6   1.5   71   18-102   346-418 (423)
 37 COG5236 Uncharacterized conser  97.1 0.00047   1E-08   57.4   3.8   29   21-49    151-181 (493)
 38 PF09237 GAGA:  GAGA factor;  I  97.1 0.00029 6.4E-09   40.7   1.5   40  225-264    13-52  (54)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00051 1.1E-08   33.9   1.6   23  293-316     1-23  (24)
 40 smart00355 ZnF_C2H2 zinc finge  97.0 0.00054 1.2E-08   34.5   1.8   23  349-371     1-23  (26)
 41 KOG2231|consensus               97.0  0.0014 3.1E-08   60.7   5.5   14   33-46    126-139 (669)
 42 PF09237 GAGA:  GAGA factor;  I  97.0 0.00097 2.1E-08   38.7   2.8   41  167-207    12-52  (54)
 43 COG5189 SFP1 Putative transcri  96.9 0.00033   7E-09   57.6   1.2   26  145-170   393-418 (423)
 44 smart00355 ZnF_C2H2 zinc finge  96.9 0.00089 1.9E-08   33.6   2.1   23  293-315     1-23  (26)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.8 0.00062 1.3E-08   33.6   1.2   22  349-371     1-22  (24)
 46 KOG2482|consensus               96.8  0.0034 7.4E-08   52.4   5.7   53   81-133   143-218 (423)
 47 PF12874 zf-met:  Zinc-finger o  96.7 0.00087 1.9E-08   33.5   1.3   23  349-371     1-23  (25)
 48 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6  0.0013 2.8E-08   33.6   1.7   22   22-43      2-23  (27)
 49 PF12874 zf-met:  Zinc-finger o  96.6 0.00098 2.1E-08   33.3   1.2   22   22-43      1-22  (25)
 50 KOG2785|consensus               96.3  0.0059 1.3E-07   52.1   4.5   80   21-104     3-90  (390)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  96.3  0.0011 2.5E-08   33.7   0.1   22  349-370     2-23  (27)
 52 COG5236 Uncharacterized conser  96.2  0.0052 1.1E-07   51.4   3.7  133   82-233   151-307 (493)
 53 PRK04860 hypothetical protein;  96.1  0.0026 5.7E-08   48.4   1.4   37  264-304   119-155 (160)
 54 KOG2893|consensus               96.1  0.0018 3.8E-08   51.1   0.5   53   19-108     8-60  (341)
 55 PF13913 zf-C2HC_2:  zinc-finge  95.8  0.0077 1.7E-07   29.9   1.8   21  349-370     3-23  (25)
 56 KOG1146|consensus               95.8  0.0051 1.1E-07   60.8   2.0   76  210-285   439-539 (1406)
 57 KOG2482|consensus               95.7   0.025 5.3E-07   47.5   5.5   51  265-315   280-357 (423)
 58 KOG2785|consensus               95.6   0.037   8E-07   47.4   6.2   52   82-133     3-91  (390)
 59 PF13913 zf-C2HC_2:  zinc-finge  95.5   0.011 2.3E-07   29.4   1.7   21  293-314     3-23  (25)
 60 PRK04860 hypothetical protein;  95.1   0.015 3.3E-07   44.3   2.2   35  292-331   119-153 (160)
 61 KOG2231|consensus               94.9   0.038 8.2E-07   51.7   4.6  100  181-288   117-236 (669)
 62 TIGR00622 ssl1 transcription f  94.7    0.14   3E-06   36.1   5.9   24  348-371    81-104 (112)
 63 smart00451 ZnF_U1 U1-like zinc  94.3   0.027 5.9E-07   30.6   1.5   24   20-43      2-25  (35)
 64 smart00451 ZnF_U1 U1-like zinc  94.1   0.044 9.6E-07   29.8   2.0   24  347-370     2-25  (35)
 65 PF10571 UPF0547:  Uncharacteri  94.0   0.045 9.7E-07   27.4   1.7   24  323-359     2-25  (26)
 66 COG5048 FOG: Zn-finger [Genera  93.4    0.05 1.1E-06   49.9   2.3  152  206-357   288-455 (467)
 67 COG5048 FOG: Zn-finger [Genera  92.3   0.054 1.2E-06   49.7   1.0  107  264-371   289-441 (467)
 68 cd00350 rubredoxin_like Rubred  92.2    0.11 2.3E-06   27.9   1.6   10  347-356    16-25  (33)
 69 PF12013 DUF3505:  Protein of u  91.8    0.21 4.5E-06   35.7   3.2   89   17-107     7-109 (109)
 70 COG4049 Uncharacterized protei  90.9    0.14   3E-06   30.4   1.2   31   78-108    13-43  (65)
 71 PRK14890 putative Zn-ribbon RN  90.7    0.15 3.3E-06   31.0   1.3   31  322-357    26-57  (59)
 72 KOG4173|consensus               89.7    0.23   5E-06   38.6   2.0   73  156-232    87-171 (253)
 73 KOG2893|consensus               89.2    0.16 3.6E-06   40.4   0.9   41  153-198    13-53  (341)
 74 KOG4173|consensus               89.1    0.25 5.3E-06   38.5   1.7   88  208-317    80-171 (253)
 75 cd00729 rubredoxin_SM Rubredox  88.7    0.29 6.2E-06   26.4   1.3   24  322-356     3-26  (34)
 76 COG4049 Uncharacterized protei  88.2    0.24 5.2E-06   29.4   0.9   30  341-370    10-39  (65)
 77 PF12013 DUF3505:  Protein of u  86.9     1.3 2.7E-05   31.7   4.2   26   81-107    10-35  (109)
 78 TIGR00622 ssl1 transcription f  86.6     1.3 2.9E-05   31.3   4.0   48  152-202    57-104 (112)
 79 PF06524 NOA36:  NOA36 protein;  86.4    0.24 5.3E-06   40.1   0.3   92  202-316   137-233 (314)
 80 PF09538 FYDLN_acid:  Protein o  85.3    0.55 1.2E-05   33.2   1.6   13  291-303    25-37  (108)
 81 PHA00626 hypothetical protein   84.9    0.31 6.7E-06   29.1   0.2   11  292-302    23-33  (59)
 82 COG2888 Predicted Zn-ribbon RN  84.5     0.8 1.7E-05   27.8   1.8   10  291-300    49-58  (61)
 83 PRK00398 rpoP DNA-directed RNA  84.1    0.64 1.4E-05   27.1   1.3   11  322-332     4-14  (46)
 84 PF02176 zf-TRAF:  TRAF-type zi  83.9    0.26 5.6E-06   30.7  -0.5   33  292-326     9-43  (60)
 85 TIGR02098 MJ0042_CXXC MJ0042 f  83.4    0.58 1.2E-05   25.9   0.9   11  348-358    25-35  (38)
 86 PF09538 FYDLN_acid:  Protein o  83.2    0.85 1.8E-05   32.3   1.8   29  294-334    11-39  (108)
 87 KOG2186|consensus               82.8       1 2.2E-05   36.6   2.3   47   82-131     3-49  (276)
 88 COG1592 Rubrerythrin [Energy p  82.6     1.2 2.7E-05   34.1   2.6   23  264-299   134-156 (166)
 89 PF09986 DUF2225:  Uncharacteri  82.4    0.66 1.4E-05   37.7   1.2   25   19-43      3-27  (214)
 90 PF06524 NOA36:  NOA36 protein;  82.3    0.55 1.2E-05   38.2   0.7   17  347-363   208-224 (314)
 91 smart00659 RPOLCX RNA polymera  82.3    0.89 1.9E-05   26.2   1.4   11  293-303     3-13  (44)
 92 TIGR00373 conserved hypothetic  81.7     1.3 2.9E-05   33.9   2.6   37  285-331   102-138 (158)
 93 PF13719 zinc_ribbon_5:  zinc-r  81.4    0.87 1.9E-05   25.1   1.1    6  294-299    27-32  (37)
 94 PF04959 ARS2:  Arsenite-resist  81.1    0.33 7.2E-06   39.0  -0.9   32   16-47     72-103 (214)
 95 PF07754 DUF1610:  Domain of un  80.9     1.9 4.1E-05   21.1   2.0   10  347-356    15-24  (24)
 96 COG1592 Rubrerythrin [Energy p  79.6     1.2 2.5E-05   34.2   1.6   24  321-356   134-157 (166)
 97 PRK00464 nrdR transcriptional   79.4    0.39 8.4E-06   36.4  -1.0   12  293-304    29-40  (154)
 98 PF13717 zinc_ribbon_4:  zinc-r  79.3     2.2 4.8E-05   23.3   2.2   32  152-189     4-35  (36)
 99 PRK06266 transcription initiat  79.0     1.6 3.6E-05   34.2   2.3   34  288-331   113-146 (178)
100 PF09986 DUF2225:  Uncharacteri  78.9    0.61 1.3E-05   37.9  -0.1   13  237-249    49-61  (214)
101 PF02176 zf-TRAF:  TRAF-type zi  77.7     1.8 3.8E-05   26.8   1.8   40   81-121     8-53  (60)
102 PF13453 zf-TFIIB:  Transcripti  77.6     1.9 4.1E-05   24.3   1.7   37  323-366     1-37  (41)
103 KOG2272|consensus               77.0     1.2 2.6E-05   36.0   1.1   15  348-362   221-235 (332)
104 PF15269 zf-C2H2_7:  Zinc-finge  76.9     2.2 4.7E-05   24.1   1.7   28   16-43     15-42  (54)
105 TIGR02300 FYDLN_acid conserved  75.8     1.9 4.1E-05   31.1   1.6   17  289-305    23-39  (129)
106 PF15269 zf-C2H2_7:  Zinc-finge  75.5     2.1 4.5E-05   24.2   1.4   22  349-370    21-42  (54)
107 smart00531 TFIIE Transcription  75.5     3.2 6.9E-05   31.5   3.0   39  288-331    95-133 (147)
108 smart00834 CxxC_CXXC_SSSS Puta  75.1     1.1 2.3E-05   25.3   0.2   10  322-331     6-15  (41)
109 smart00734 ZnF_Rad18 Rad18-lik  75.1       2 4.4E-05   21.5   1.2   21   22-43      2-22  (26)
110 PF03604 DNA_RNApol_7kD:  DNA d  74.7       2 4.3E-05   22.7   1.2   10  348-357    17-26  (32)
111 COG1996 RPC10 DNA-directed RNA  74.7     1.8 3.9E-05   25.4   1.1   10  293-302     7-16  (49)
112 COG5151 SSL1 RNA polymerase II  73.9     5.9 0.00013   33.3   4.2   80  291-371   321-411 (421)
113 PF02892 zf-BED:  BED zinc fing  73.7     1.9 4.1E-05   24.9   1.1   29   17-45     12-44  (45)
114 cd00730 rubredoxin Rubredoxin;  73.5     4.1 8.9E-05   24.2   2.4    9  348-356    34-42  (50)
115 smart00531 TFIIE Transcription  73.2     2.7 5.9E-05   31.8   2.1   23   15-37     93-115 (147)
116 PF12907 zf-met2:  Zinc-binding  72.2     1.8   4E-05   24.2   0.7   32   22-53      2-36  (40)
117 KOG2807|consensus               72.2      10 0.00022   32.3   5.2   23  207-229   345-367 (378)
118 TIGR02605 CxxC_CxxC_SSSS putat  72.1     1.3 2.9E-05   26.5   0.2   11  293-303     6-16  (52)
119 COG5151 SSL1 RNA polymerase II  71.7     3.5 7.6E-05   34.6   2.5   90  110-202   322-411 (421)
120 PF13240 zinc_ribbon_2:  zinc-r  71.3     3.5 7.5E-05   19.9   1.5    7  351-357    16-22  (23)
121 TIGR02300 FYDLN_acid conserved  71.2     3.1 6.7E-05   30.0   1.8   29  294-334    11-39  (129)
122 PF09723 Zn-ribbon_8:  Zinc rib  70.6     2.2 4.7E-05   24.3   0.8   11  322-332     6-16  (42)
123 PF00301 Rubredoxin:  Rubredoxi  68.0     3.4 7.3E-05   24.2   1.2   10  348-357    34-43  (47)
124 PF14353 CpXC:  CpXC protein     67.3     1.9 4.1E-05   31.8   0.1   10  349-358    39-48  (128)
125 smart00614 ZnF_BED BED zinc fi  66.3     4.4 9.6E-05   24.0   1.6   24  348-371    18-47  (50)
126 KOG2186|consensus               64.4     2.4 5.2E-05   34.5   0.2   45  265-312     4-48  (276)
127 TIGR01206 lysW lysine biosynth  63.1     6.6 0.00014   23.8   1.9   30  322-358     3-32  (54)
128 COG4530 Uncharacterized protei  63.0       6 0.00013   27.5   1.9   27  266-303    11-37  (129)
129 TIGR00373 conserved hypothetic  62.8       7 0.00015   30.0   2.5   17  264-280   109-125 (158)
130 PRK04023 DNA polymerase II lar  60.9     8.8 0.00019   38.3   3.2   12  348-359   663-674 (1121)
131 PF13248 zf-ribbon_3:  zinc-rib  60.9     7.6 0.00016   19.3   1.6    9  322-330     3-11  (26)
132 COG5188 PRP9 Splicing factor 3  60.4      16 0.00034   31.6   4.2   21   82-102   238-258 (470)
133 KOG2593|consensus               59.4     7.7 0.00017   34.6   2.4   43  285-331   121-163 (436)
134 COG1997 RPL43A Ribosomal prote  59.1     5.9 0.00013   26.4   1.3    7  208-214    36-42  (89)
135 PF05443 ROS_MUCR:  ROS/MUCR tr  58.7       5 0.00011   29.6   1.0   26  291-319    71-96  (132)
136 PF12760 Zn_Tnp_IS1595:  Transp  58.4      24 0.00053   20.4   3.7   11  346-356    35-45  (46)
137 COG1198 PriA Primosomal protei  58.1     6.5 0.00014   38.3   1.9   19  339-357   466-484 (730)
138 PF01286 XPA_N:  XPA protein N-  57.8     5.3 0.00012   21.5   0.7   17  322-338     4-20  (34)
139 PRK06266 transcription initiat  57.6     7.9 0.00017   30.4   2.0   15  236-250   117-131 (178)
140 COG1198 PriA Primosomal protei  57.3     7.4 0.00016   37.9   2.1   28  287-330   457-484 (730)
141 PF04959 ARS2:  Arsenite-resist  57.1       7 0.00015   31.6   1.7   26  345-370    74-99  (214)
142 PRK09678 DNA-binding transcrip  56.3     2.5 5.5E-05   27.3  -0.7    7  297-303    34-40  (72)
143 PF08274 PhnA_Zn_Ribbon:  PhnA   56.3     4.3 9.4E-05   21.1   0.2    6  322-327    20-25  (30)
144 COG4896 Uncharacterized protei  55.1     5.8 0.00013   24.2   0.7   37  294-331     4-41  (68)
145 KOG1280|consensus               54.8      12 0.00027   32.1   2.8   35   15-49     73-107 (381)
146 smart00661 RPOL9 RNA polymeras  53.7      14  0.0003   21.9   2.3   10  322-331    21-30  (52)
147 PF08790 zf-LYAR:  LYAR-type C2  52.8     5.1 0.00011   20.4   0.2   20   22-42      1-20  (28)
148 KOG0717|consensus               52.3     5.6 0.00012   35.7   0.5   20   83-102   293-312 (508)
149 TIGR00595 priA primosomal prot  51.2      11 0.00023   35.5   2.1   13  290-302   238-250 (505)
150 TIGR01562 FdhE formate dehydro  51.0      16 0.00034   31.5   2.9   15  288-302   206-220 (305)
151 KOG2272|consensus               50.9      10 0.00023   30.9   1.7   19   20-38     98-116 (332)
152 PRK04023 DNA polymerase II lar  50.3      15 0.00033   36.7   3.0    9  237-245   627-635 (1121)
153 KOG1701|consensus               50.1     6.2 0.00013   35.0   0.4   40  181-220   276-315 (468)
154 COG3357 Predicted transcriptio  48.7      12 0.00027   25.1   1.5   14  291-304    57-70  (97)
155 PRK00432 30S ribosomal protein  48.7      14  0.0003   22.0   1.6   12  347-358    36-47  (50)
156 PF15135 UPF0515:  Uncharacteri  48.2      30 0.00066   28.4   3.9   13  348-360   155-167 (278)
157 PRK14714 DNA polymerase II lar  48.2      23  0.0005   36.6   3.9   53  265-359   668-720 (1337)
158 PRK03564 formate dehydrogenase  48.1      14 0.00029   31.9   2.1   15  288-302   208-222 (309)
159 KOG3408|consensus               47.6      11 0.00023   27.0   1.1   25  290-314    55-79  (129)
160 KOG3408|consensus               47.2     9.8 0.00021   27.2   0.9   26   18-43     54-79  (129)
161 smart00249 PHD PHD zinc finger  46.4      28  0.0006   19.6   2.8   13  322-334    15-27  (47)
162 PF14446 Prok-RING_1:  Prokaryo  45.1      14  0.0003   22.3   1.2    9  294-302     7-15  (54)
163 PF09963 DUF2197:  Uncharacteri  44.7     8.9 0.00019   23.3   0.4    7  322-328    32-38  (56)
164 PF05290 Baculo_IE-1:  Baculovi  44.0      12 0.00026   27.3   1.0   12  235-246    79-90  (140)
165 PRK14714 DNA polymerase II lar  43.4      24 0.00051   36.5   3.2   12  292-303   692-703 (1337)
166 PF05191 ADK_lid:  Adenylate ki  43.2      11 0.00025   20.5   0.6    8  210-217     4-11  (36)
167 PF13824 zf-Mss51:  Zinc-finger  43.2      21 0.00046   21.6   1.8   14  347-360    13-26  (55)
168 PF13451 zf-trcl:  Probable zin  42.9      11 0.00024   22.3   0.5   10  180-189     5-14  (49)
169 PF13878 zf-C2H2_3:  zinc-finge  42.8      22 0.00047   20.1   1.8   11   83-93     14-24  (41)
170 PF03811 Zn_Tnp_IS1:  InsA N-te  42.6      26 0.00056   19.2   1.9   30  322-354     6-35  (36)
171 PF08209 Sgf11:  Sgf11 (transcr  42.3      26 0.00056   18.7   1.8   24  293-317     5-28  (33)
172 KOG2807|consensus               42.1      29 0.00062   29.8   3.0   23  292-314   345-367 (378)
173 PF06220 zf-U1:  U1 zinc finger  41.6      19 0.00041   19.9   1.3   23   20-42      2-26  (38)
174 PF05443 ROS_MUCR:  ROS/MUCR tr  41.6      25 0.00053   26.0   2.3   26   80-108    70-95  (132)
175 smart00132 LIM Zinc-binding do  41.5      25 0.00053   18.9   1.9   11  349-359    28-38  (39)
176 PF08271 TF_Zn_Ribbon:  TFIIB z  41.0      20 0.00044   20.3   1.5   12  347-358    18-29  (43)
177 PRK14873 primosome assembly pr  41.0      18 0.00038   35.2   1.9   12  289-300   407-418 (665)
178 COG3364 Zn-ribbon containing p  40.5      19 0.00041   24.8   1.5   17  292-308     2-18  (112)
179 KOG1280|consensus               40.2      27 0.00059   30.2   2.6   36   82-117    79-116 (381)
180 PF01363 FYVE:  FYVE zinc finge  40.1      18 0.00039   23.0   1.3   29  293-334    10-38  (69)
181 PF07282 OrfB_Zn_ribbon:  Putat  39.6      24 0.00052   22.5   1.9   13  347-359    45-57  (69)
182 COG3024 Uncharacterized protei  39.4      22 0.00048   22.2   1.5   31  319-356     5-35  (65)
183 smart00154 ZnF_AN1 AN1-like Zi  39.3      17 0.00037   20.3   0.9   15  348-362    12-26  (39)
184 KOG2593|consensus               38.4      16 0.00034   32.7   1.0   37  147-187   125-161 (436)
185 PF09845 DUF2072:  Zn-ribbon co  38.2      23  0.0005   26.0   1.7   15  292-306     1-15  (131)
186 PF10013 DUF2256:  Uncharacteri  38.1      21 0.00044   20.2   1.1   13  350-362    10-22  (42)
187 COG4888 Uncharacterized Zn rib  37.9     7.9 0.00017   26.6  -0.6   18   18-35     19-36  (104)
188 KOG2071|consensus               37.9      25 0.00055   32.9   2.3   24  264-287   418-441 (579)
189 COG0068 HypF Hydrogenase matur  37.7     5.4 0.00012   38.0  -1.9   81  208-302   102-183 (750)
190 PF07649 C1_3:  C1-like domain;  37.7      22 0.00047   18.3   1.2   12  347-358    14-25  (30)
191 PF14445 Prok-RING_2:  Prokaryo  37.5       5 0.00011   23.4  -1.4   12  292-303     7-18  (57)
192 smart00440 ZnF_C2C2 C2C2 Zinc   37.4      27 0.00059   19.5   1.6   11  349-359    29-39  (40)
193 PF01780 Ribosomal_L37ae:  Ribo  37.4      13 0.00027   25.3   0.3    7  208-214    36-42  (90)
194 PF11789 zf-Nse:  Zinc-finger o  37.1      30 0.00064   21.2   1.8   21  291-312    23-43  (57)
195 PF07975 C1_4:  TFIIH C1-like d  37.0     8.7 0.00019   22.9  -0.5   10  322-331    22-31  (51)
196 KOG0801|consensus               36.8      11 0.00023   28.4  -0.1   32  305-340   126-157 (205)
197 PF10083 DUF2321:  Uncharacteri  35.7      27 0.00059   26.4   1.8   41  322-362    40-82  (158)
198 COG4306 Uncharacterized protei  35.6      38 0.00082   24.3   2.4   41  322-362    40-82  (160)
199 PF12230 PRP21_like_P:  Pre-mRN  35.2      13 0.00027   30.7   0.0   25  322-346   169-193 (229)
200 PF09416 UPF1_Zn_bind:  RNA hel  35.0      34 0.00073   25.9   2.2   38  292-329    14-68  (152)
201 COG4957 Predicted transcriptio  34.3      26 0.00057   25.6   1.4   21  349-372    77-97  (148)
202 KOG4167|consensus               34.2     8.8 0.00019   36.6  -1.1   24  348-371   792-815 (907)
203 TIGR00100 hypA hydrogenase nic  34.1      19 0.00042   25.9   0.8   24  293-329    71-94  (115)
204 PRK12380 hydrogenase nickel in  33.9      19 0.00042   25.8   0.8   12  293-304    71-82  (113)
205 PRK05580 primosome assembly pr  33.8      28  0.0006   34.2   2.0   13  290-302   406-418 (679)
206 PF10276 zf-CHCC:  Zinc-finger   33.7      19 0.00042   20.2   0.6   12  347-358    28-39  (40)
207 PF04780 DUF629:  Protein of un  33.6      23 0.00049   32.5   1.3   30   20-49     56-85  (466)
208 KOG1994|consensus               33.6      23 0.00049   28.6   1.1   21  347-367   238-258 (268)
209 PRK03824 hypA hydrogenase nick  33.5      16 0.00035   27.2   0.3   10  180-189    71-80  (135)
210 PF04423 Rad50_zn_hook:  Rad50   33.3      16 0.00034   22.1   0.2   13  350-362    22-34  (54)
211 PRK14559 putative protein seri  33.2      51  0.0011   32.0   3.6    9  294-302    17-25  (645)
212 KOG4167|consensus               32.8      17 0.00036   34.9   0.4   27   80-106   790-816 (907)
213 TIGR00686 phnA alkylphosphonat  32.8      23 0.00051   24.8   1.0   13  235-247    18-30  (109)
214 PRK00564 hypA hydrogenase nick  32.6      23 0.00049   25.6   1.0   11  293-303    72-82  (117)
215 KOG2636|consensus               31.6      30 0.00064   31.1   1.7   29  341-369   394-423 (497)
216 PTZ00255 60S ribosomal protein  31.6      21 0.00046   24.2   0.6    7  208-214    37-43  (90)
217 TIGR00244 transcriptional regu  31.6      10 0.00022   28.4  -1.0   12  294-305    30-41  (147)
218 COG5216 Uncharacterized conser  31.3      21 0.00045   21.7   0.5   12  345-356    41-52  (67)
219 PRK00420 hypothetical protein;  31.1      43 0.00092   24.0   2.1   28  322-359    24-51  (112)
220 KOG1842|consensus               31.0      24 0.00052   31.7   1.0   32   19-50     13-44  (505)
221 COG1773 Rubredoxin [Energy pro  30.8      21 0.00045   21.7   0.4   12  348-359     3-14  (55)
222 PF04810 zf-Sec23_Sec24:  Sec23  30.8      45 0.00098   18.6   1.8   32  322-358     3-34  (40)
223 COG1998 RPS31 Ribosomal protei  30.6      36 0.00077   20.0   1.3   10  348-357    37-46  (51)
224 PF01428 zf-AN1:  AN1-like Zinc  30.4      21 0.00045   20.3   0.4   16  347-362    12-27  (43)
225 COG1655 Uncharacterized protei  29.9      11 0.00025   30.3  -1.0   40  262-301    17-71  (267)
226 COG1594 RPB9 DNA-directed RNA   29.9      17 0.00037   26.0  -0.0   40   82-121    72-111 (113)
227 COG1571 Predicted DNA-binding   29.6      31 0.00068   31.0   1.5   16  289-304   364-379 (421)
228 PTZ00448 hypothetical protein;  29.6      35 0.00075   30.0   1.7   23  348-370   314-336 (373)
229 KOG0717|consensus               29.3      28  0.0006   31.6   1.1   22  349-370   461-482 (508)
230 PRK10220 hypothetical protein;  29.2      32 0.00069   24.2   1.1   12  236-247    20-31  (111)
231 PRK03681 hypA hydrogenase nick  29.1      26 0.00057   25.2   0.8   11  293-303    71-81  (114)
232 PRK14892 putative transcriptio  29.0      41 0.00089   23.4   1.7   11  349-359    43-53  (99)
233 PF04780 DUF629:  Protein of un  29.0      40 0.00088   30.9   2.1   31   79-109    54-84  (466)
234 PF07503 zf-HYPF:  HypF finger;  28.8      22 0.00048   19.3   0.3   13  210-222     2-14  (35)
235 PF14205 Cys_rich_KTR:  Cystein  28.7      27 0.00058   21.1   0.6   36   81-120     3-38  (55)
236 TIGR00280 L37a ribosomal prote  28.7      23  0.0005   24.1   0.4    7  208-214    36-42  (91)
237 cd00065 FYVE FYVE domain; Zinc  28.3      44 0.00096   20.1   1.6   28  294-334     4-31  (57)
238 KOG2071|consensus               28.0      34 0.00074   32.1   1.5   26  346-371   416-441 (579)
239 PF14803 Nudix_N_2:  Nudix N-te  27.6      33 0.00073   18.4   0.8   10  348-357    22-31  (34)
240 COG3677 Transposase and inacti  27.6      41 0.00088   24.8   1.6   14  321-334    53-66  (129)
241 CHL00174 accD acetyl-CoA carbo  27.2      19  0.0004   30.9  -0.3   11  322-332    58-68  (296)
242 COG1571 Predicted DNA-binding   27.2      39 0.00086   30.4   1.7   29  294-334   352-380 (421)
243 COG1327 Predicted transcriptio  27.0      15 0.00032   27.6  -0.8   11  294-304    30-40  (156)
244 TIGR03831 YgiT_finger YgiT-typ  26.9      47   0.001   18.8   1.5   15  346-360    30-44  (46)
245 smart00064 FYVE Protein presen  26.9      45 0.00097   21.1   1.5   29  293-334    11-39  (68)
246 COG1326 Uncharacterized archae  26.7      41 0.00088   26.5   1.5   17  317-333    26-42  (201)
247 smart00504 Ubox Modified RING   26.3 1.1E+02  0.0024   18.7   3.3   30  298-334    19-48  (63)
248 PF11781 RRN7:  RNA polymerase   25.9      43 0.00093   18.3   1.1   25  322-356     9-33  (36)
249 cd00924 Cyt_c_Oxidase_Vb Cytoc  25.7      36 0.00079   23.6   1.0   19  341-360    73-91  (97)
250 KOG4124|consensus               25.7      21 0.00046   30.8  -0.2   71   18-102   346-418 (442)
251 COG5112 UFD2 U1-like Zn-finger  25.4      29 0.00062   24.1   0.4   26   18-43     52-77  (126)
252 TIGR00515 accD acetyl-CoA carb  25.2      22 0.00048   30.4  -0.2   31  293-333    27-57  (285)
253 PF13821 DUF4187:  Domain of un  24.8      39 0.00085   20.5   0.9   20  347-366    26-45  (55)
254 KOG1842|consensus               24.5      41 0.00088   30.3   1.3   29   81-109    14-42  (505)
255 COG1779 C4-type Zn-finger prot  24.5      46   0.001   26.4   1.4   15  348-362    43-57  (201)
256 PF10263 SprT-like:  SprT-like   24.5      39 0.00085   25.7   1.1   10  349-358   144-153 (157)
257 PRK03976 rpl37ae 50S ribosomal  24.5      30 0.00065   23.5   0.4    6  208-213    37-42  (90)
258 COG2331 Uncharacterized protei  24.1      32 0.00069   22.3   0.4   30  293-330    13-42  (82)
259 PTZ00448 hypothetical protein;  24.0      45 0.00098   29.4   1.4   23   21-43    314-336 (373)
260 PRK05978 hypothetical protein;  23.8      31 0.00066   26.1   0.4   10  322-331    53-62  (148)
261 KOG4727|consensus               23.7      46   0.001   25.6   1.2   23   80-102    73-95  (193)
262 COG3091 SprT Zn-dependent meta  23.7      45 0.00097   25.2   1.2   10  348-357   140-149 (156)
263 COG5188 PRP9 Splicing factor 3  23.3      48   0.001   28.8   1.4   29  341-369   367-396 (470)
264 KOG3214|consensus               22.7      32 0.00069   23.7   0.2   16   81-96     46-61  (109)
265 KOG1994|consensus               22.2      44 0.00095   27.0   0.9   21  109-129   238-258 (268)
266 TIGR01384 TFS_arch transcripti  21.9      75  0.0016   22.2   2.0   11  322-332    17-27  (104)
267 PF11931 DUF3449:  Domain of un  21.9      30 0.00065   27.5   0.0   28  342-369    95-123 (196)
268 PF07800 DUF1644:  Protein of u  21.8      85  0.0018   24.0   2.3   51  265-317    81-133 (162)
269 KOG0782|consensus               21.8      14 0.00031   34.1  -2.0   26  279-304   240-265 (1004)
270 PF01155 HypA:  Hydrogenase exp  21.3      38 0.00081   24.3   0.4   11  293-303    71-81  (113)
271 TIGR03830 CxxCG_CxxCG_HTH puta  21.1      87  0.0019   22.7   2.3   20  346-365    29-48  (127)
272 PF05129 Elf1:  Transcription e  21.1      29 0.00062   23.2  -0.2   15  347-361    45-59  (81)
273 PF15227 zf-C3HC4_4:  zinc fing  21.0      44 0.00095   18.9   0.6   11  324-334     1-11  (42)
274 PF14311 DUF4379:  Domain of un  20.9      66  0.0014   19.4   1.4   17   81-97     27-43  (55)
275 COG1675 TFA1 Transcription ini  20.9 1.2E+02  0.0027   23.7   3.1   17  288-304   109-125 (176)
276 PRK05654 acetyl-CoA carboxylas  20.6      30 0.00065   29.7  -0.2   11  322-332    47-57  (292)
277 KOG4377|consensus               20.6      38 0.00081   30.1   0.3   76  111-190   272-360 (480)
278 PF06827 zf-FPG_IleRS:  Zinc fi  20.3      35 0.00075   17.5   0.0   26  323-355     3-28  (30)
279 PF09332 Mcm10:  Mcm10 replicat  20.3      28  0.0006   30.6  -0.6   56  264-330   252-312 (344)

No 1  
>KOG1074|consensus
Probab=99.95  E-value=1e-29  Score=226.65  Aligned_cols=164  Identities=24%  Similarity=0.561  Sum_probs=131.3

Q ss_pred             cccccchhhhcChhhhHhhhhhhccCCCCcccccccccccccchHHhHHhhhhcc----Cccccc---ccccccCChHHH
Q psy16828        208 YHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLA----QRFECK---LCHKTIVSEKTF  280 (372)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~----~~~~C~---~C~~~f~~~~~l  280 (372)
                      ..|-+|.+...-++.|+.|++. |+||+||+|.+|++.|.++.+|+.|+..|-..    -++.|+   +|-+.|...-.|
T Consensus       606 NqCiiC~rVlSC~saLqmHyrt-HtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRT-HTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             cceeeeeecccchhhhhhhhhc-ccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            6788888888888888888888 88888888888888888888888888776543    347788   888888888888


Q ss_pred             HHHHhhhcCC-C------------CcccCcccccccchhhHHHHHhhhcCCCC---------------------------
Q psy16828        281 KKHMALHSDA-K------------PFVCNICGKDFKLKYYVNLHMRTHTRIRP---------------------------  320 (372)
Q Consensus       281 ~~H~~~h~~~-~------------~~~C~~C~~~f~~~~~l~~H~~~h~~~~~---------------------------  320 (372)
                      ..|++.|.+. .            .-+|..|.+.|.....+..++..+.+...                           
T Consensus       685 pQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~  764 (958)
T KOG1074|consen  685 PQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCG  764 (958)
T ss_pred             cceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCccccccc
Confidence            8888887632 1            13578888888777777777655511100                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy16828        321 --------------------------------------------------------------------------------  320 (372)
Q Consensus       321 --------------------------------------------------------------------------------  320 (372)
                                                                                                      
T Consensus       765 ~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~  844 (958)
T KOG1074|consen  765 RELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATK  844 (958)
T ss_pred             cccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccccccccc
Confidence                                                                                            


Q ss_pred             ----------------------------------CccCCCCCCcCCCC-ccccccccccCCCceeCcccCCcccChhhHH
Q psy16828        321 ----------------------------------TFECDVCHQIFPTD-FRTKHMLVHDVEKSHLCFVCGAGFVNDAGLK  365 (372)
Q Consensus       321 ----------------------------------~~~C~~C~~~f~~~-~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~  365 (372)
                                                        ...|.+|++.|... .|..|+|+|+|+|||.|.+|++.|..+.+|+
T Consensus       845 ~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLK  924 (958)
T KOG1074|consen  845 TNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLK  924 (958)
T ss_pred             cccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhh
Confidence                                              26799999999877 9999999999999999999999999999999


Q ss_pred             HHHhhcC
Q psy16828        366 VHMRKHQ  372 (372)
Q Consensus       366 ~H~~~h~  372 (372)
                      .||.+|.
T Consensus       925 vHMgtH~  931 (958)
T KOG1074|consen  925 VHMGTHM  931 (958)
T ss_pred             hhhcccc
Confidence            9999884


No 2  
>KOG1074|consensus
Probab=99.95  E-value=5.3e-29  Score=222.06  Aligned_cols=109  Identities=23%  Similarity=0.444  Sum_probs=84.8

Q ss_pred             CcccCCCCccccCChhhHHHHHhhhcCCCceeecCCCCCcccChHHHHHHHHHhcCC----CCcccc---cchhhhcChh
Q psy16828        149 KKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGA----EPYHCK---YCDKTFTKRM  221 (372)
Q Consensus       149 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~----~~~~C~---~C~~~f~~~~  221 (372)
                      .+..|-+|-++...+++|+-|. +.|+++++|+|.+|++.|.++.+|+.|+..|...    ..+.|+   +|.+.|....
T Consensus       604 dPNqCiiC~rVlSC~saLqmHy-rtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V  682 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHY-RTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAV  682 (958)
T ss_pred             Cccceeeeeecccchhhhhhhh-hcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccc
Confidence            3567888888888888888886 7888888888888888888888888888877644    347788   8888888888


Q ss_pred             hhHhhhhhhcc-CCCC------------cccccccccccccchHHhHHhhh
Q psy16828        222 NVKTHERMKHE-NHKP------------YECYICNKILVSRGRLNEHLNQV  259 (372)
Q Consensus       222 ~l~~H~~~~h~-~~~~------------~~C~~C~~~f~~~~~l~~H~~~~  259 (372)
                      .|..|+++ |. +..+            -.|+.|.+.|.....+..++..+
T Consensus       683 ~lpQhIri-H~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~  732 (958)
T KOG1074|consen  683 TLPQHIRI-HLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQ  732 (958)
T ss_pred             cccceEEe-ecCCCCCCCcccccccchhcccchhhhcccccccchhhhhcc
Confidence            88888888 44 2222            45888888887777776666544


No 3  
>KOG2462|consensus
Probab=99.94  E-value=1.1e-27  Score=188.55  Aligned_cols=135  Identities=32%  Similarity=0.618  Sum_probs=107.5

Q ss_pred             CceeecCCCCCcccChHHHHHHHHHhcC---CCCcccccchhhhcChhhhHhhhhhhccCCCCcccccccccccccchHH
Q psy16828        177 EYSVLCTQCGFGCYTNRELEEHQILTHG---AEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLN  253 (372)
Q Consensus       177 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~---~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~  253 (372)
                      ...|+|+.|++.+.+..+|.+|...|-.   .+.+.|++|++.|.+...|..|+++ |.  .+..|.+||+.|..+..|+
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirT-H~--l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRT-HT--LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhc-cC--CCcccccccccccchHHhh
Confidence            3456777777777777777777665543   4567888888888888888888887 54  5678888888888888888


Q ss_pred             hHHhhhhccCcccccccccccCChHHHHHHHhhhcCCCCcccCcccccccchhhHHHHHhh
Q psy16828        254 EHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRT  314 (372)
Q Consensus       254 ~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  314 (372)
                      .|+++|+|++||.|+.|+++|.++++|+.|+++|.+.++|+|..|+++|...+.|.+|...
T Consensus       205 GHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  205 GHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            8888888888888888888888888888888888888888888888888888888888654


No 4  
>KOG2462|consensus
Probab=99.94  E-value=5.3e-28  Score=190.30  Aligned_cols=133  Identities=28%  Similarity=0.631  Sum_probs=116.6

Q ss_pred             CCCcccccchhhhcChhhhHhhhhhhcc--CCCCcccccccccccccchHHhHHhhhhccCcccccccccccCChHHHHH
Q psy16828        205 AEPYHCKYCDKTFTKRMNVKTHERMKHE--NHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKK  282 (372)
Q Consensus       205 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~  282 (372)
                      ...|+|+.|++.+.+.++|.+|.+.|..  ..+.+.|.+|++.+.+...|+.|+++|.  -+.+|.+||+.|...+-|+.
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            3459999999999999999999998433  2466889999999999999999999887  67899999999999999999


Q ss_pred             HHhhhcCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC-cccccc
Q psy16828        283 HMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD-FRTKHM  340 (372)
Q Consensus       283 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~-~l~~h~  340 (372)
                      |+|+|+||+||.|+.|++.|.+++.|+.|+.+|.+.++ |.|+.|++.|... .|++|.
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-HQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc-ccCcchhhHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999887 8888877777665 555554


No 5  
>KOG3608|consensus
Probab=99.94  E-value=4.7e-26  Score=183.96  Aligned_cols=274  Identities=23%  Similarity=0.445  Sum_probs=217.3

Q ss_pred             Ceeccc--ccccccC-hhHHHHHHHhhccC----------------------------------ceeecc--cccccccC
Q psy16828         82 PVECSY--CGKVLSR-KDKLTRHIAAVHSG----------------------------------KEYPCE--QCDRKFTN  122 (372)
Q Consensus        82 ~~~C~~--C~~~~~~-~~~l~~H~~~~h~~----------------------------------~~~~C~--~C~~~f~~  122 (372)
                      .++|.+  |++...+ ...|.+|...|--.                                  ..|.|.  .|+..|.+
T Consensus        69 e~qC~w~~C~f~~~~~s~~l~RHvy~H~y~~~l~q~G~~al~~~~dig~c~~~f~~~~~ip~~g~~f~C~WedCe~~F~s  148 (467)
T KOG3608|consen   69 EHQCTWNSCDFRTENSSADLIRHVYFHCYHTKLKQQGKLALDLHPDIGACTAPFRLMEKIPALGQNFRCGWEDCEREFVS  148 (467)
T ss_pred             ceeEEeccCCccccchHHHHHhhhhhhhhHHHHHHHHHHHHhcCCCcCcccCCcchhhccccchhhhccChhhcCCcccC
Confidence            466766  7777666 47888997544310                                  126675  59999999


Q ss_pred             chhHHHHHHhhcccCCCCccccccccCc-ccC--CCCccccCChhhHHHHHhhhcCCCceeecCCCCCcccChHHHHHHH
Q psy16828        123 GYKLKQHMLTHMQKDTSISIDVISEIKK-FKC--DQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQ  199 (372)
Q Consensus       123 ~~~l~~H~~~~~~~~~~~~~~~~~~~~~-~~C--~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  199 (372)
                      ..++.+|+..|.-.-.+....+..+.++ +.|  ..|...+.++..|+.|+ +.|.+++...|+.|+.-|.++..|..|.
T Consensus       149 ~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~-r~Hs~eKvvACp~Cg~~F~~~tkl~DH~  227 (467)
T KOG3608|consen  149 IVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHI-RTHSNEKVVACPHCGELFRTKTKLFDHL  227 (467)
T ss_pred             HHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHH-HhcCCCeEEecchHHHHhccccHHHHHH
Confidence            9999999988764422211122222222 344  56899999999999998 7899999999999999999999999998


Q ss_pred             HHhc--CCCCcccccchhhhcChhhhHhhhhhhccCCCCcccccccccccccchHHhHHhhhh-ccCcccccccccccCC
Q psy16828        200 ILTH--GAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVH-LAQRFECKLCHKTIVS  276 (372)
Q Consensus       200 ~~~~--~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~-~~~~~~C~~C~~~f~~  276 (372)
                      +...  ...+|.|..|.+.|.+...|..|+.. |..  .|+|+.|.......++|..|++.-| ..+||+|..|++.|.+
T Consensus       228 rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~r-Hvn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~  304 (467)
T KOG3608|consen  228 RRQTELNTNSFQCAQCFKRFATEKLLKSHVVR-HVN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVR  304 (467)
T ss_pred             HhhhhhcCCchHHHHHHHHHhHHHHHHHHHHH-hhh--cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhcc
Confidence            7665  35689999999999999999999988 654  4899999999999999999998644 5789999999999999


Q ss_pred             hHHHHHHHhhhcCCCCcccCc--ccccccchhhHHHHHhhhc-C-CCCCccCCCCCCcCCCC-cccccccc------ccC
Q psy16828        277 EKTFKKHMALHSDAKPFVCNI--CGKDFKLKYYVNLHMRTHT-R-IRPTFECDVCHQIFPTD-FRTKHMLV------HDV  345 (372)
Q Consensus       277 ~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-~-~~~~~~C~~C~~~f~~~-~l~~h~~~------h~~  345 (372)
                      .++|..|+.+|+ +-.|+|..  |.++|++...|++|.+.++ + ..++|+|-.|.+.|.+. .|.+|++.      ..|
T Consensus       305 esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~~PsG  383 (467)
T KOG3608|consen  305 ESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFRLPSG  383 (467)
T ss_pred             HHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcccCCCC
Confidence            999999999998 66799988  9999999999999998887 3 33469999999999877 77666643      345


Q ss_pred             CCceeCcccCCcccC
Q psy16828        346 EKSHLCFVCGAGFVN  360 (372)
Q Consensus       346 ~~~~~C~~C~~~f~~  360 (372)
                      -+.|.=.+|.-+|.+
T Consensus       384 h~RFtYk~~edG~mR  398 (467)
T KOG3608|consen  384 HKRFTYKVDEDGFMR  398 (467)
T ss_pred             CCceeeeeccCceee
Confidence            555665666655544


No 6  
>KOG3608|consensus
Probab=99.93  E-value=2.5e-25  Score=179.80  Aligned_cols=224  Identities=22%  Similarity=0.487  Sum_probs=196.7

Q ss_pred             CCeeccc--ccccccChhHHHHHHHhhccC-----------c--eeecc--cccccccCchhHHHHHHhhcccCCCCccc
Q psy16828         81 APVECSY--CGKVLSRKDKLTRHIAAVHSG-----------K--EYPCE--QCDRKFTNGYKLKQHMLTHMQKDTSISID  143 (372)
Q Consensus        81 ~~~~C~~--C~~~~~~~~~l~~H~~~~h~~-----------~--~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~~~~  143 (372)
                      ..|.|.+  |+..|.+..++..|+..|...           +  .+.|.  .|...|.++..|+.|++.|.++       
T Consensus       133 ~~f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~e-------  205 (467)
T KOG3608|consen  133 QNFRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNE-------  205 (467)
T ss_pred             hhhccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCC-------
Confidence            4577877  999999999999998555321           1  35665  4999999999999999999755       


Q ss_pred             cccccCcccCCCCccccCChhhHHHHHhhh-cCCCceeecCCCCCcccChHHHHHHHHHhcCCCCcccccchhhhcChhh
Q psy16828        144 VISEIKKFKCDQCDYATKDKYNLGTHIKRR-HTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMN  222 (372)
Q Consensus       144 ~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~  222 (372)
                           +...|+.|+..|.+...|-.|+++. -....+|+|..|.+-|.++..|..|+..|-  .-|+|+.|+......++
T Consensus       206 -----KvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ss  278 (467)
T KOG3608|consen  206 -----KVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASS  278 (467)
T ss_pred             -----eEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHH
Confidence                 6678999999999999999998543 445679999999999999999999999884  46999999999999999


Q ss_pred             hHhhhhhhccCCCCcccccccccccccchHHhHHhhhhccCcccccc--cccccCChHHHHHHHhhhc-CC--CCcccCc
Q psy16828        223 VKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKL--CHKTIVSEKTFKKHMALHS-DA--KPFVCNI  297 (372)
Q Consensus       223 l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-~~--~~~~C~~  297 (372)
                      |..|++..|...+|++|..|...|.+.+.|.+|+..|. +--|+|..  |.++|.+..+|..|++.++ |.  .+|.|-.
T Consensus       279 L~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~  357 (467)
T KOG3608|consen  279 LTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHC  357 (467)
T ss_pred             HHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeec
Confidence            99999999999999999999999999999999999655 77899999  9999999999999998765 44  4699999


Q ss_pred             ccccccchhhHHHHHhhhcCCC
Q psy16828        298 CGKDFKLKYYVNLHMRTHTRIR  319 (372)
Q Consensus       298 C~~~f~~~~~l~~H~~~h~~~~  319 (372)
                      |++.|++..+|-.|+..-|+.+
T Consensus       358 Cdr~ft~G~~L~~HL~kkH~f~  379 (467)
T KOG3608|consen  358 CDRFFTSGKSLSAHLMKKHGFR  379 (467)
T ss_pred             chhhhccchhHHHHHHHhhccc
Confidence            9999999999999998877655


No 7  
>KOG3623|consensus
Probab=99.89  E-value=3.1e-24  Score=188.77  Aligned_cols=119  Identities=28%  Similarity=0.502  Sum_probs=104.3

Q ss_pred             CeecccccccccChhHHHHHHHhhccCc--eeecccccccccCchhHHHHHHhhcccCCC-CccccccccCcccCCCCcc
Q psy16828         82 PVECSYCGKVLSRKDKLTRHIAAVHSGK--EYPCEQCDRKFTNGYKLKQHMLTHMQKDTS-ISIDVISEIKKFKCDQCDY  158 (372)
Q Consensus        82 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~--~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~-~~~~~~~~~~~~~C~~C~~  158 (372)
                      ...|++|++.+.....|..|++..|...  .|.|.+|.+.|..+..|.+|+..|...... .........+.|+|..|++
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccch
Confidence            4679999999999999999987766543  799999999999999999999998765444 4455566678899999999


Q ss_pred             ccCChhhHHHHHhhhcCCCceeecCCCCCcccChHHHHHHHHH
Q psy16828        159 ATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQIL  201 (372)
Q Consensus       159 ~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  201 (372)
                      .|...-.|+.|+ ++|.++++|.|+.|.+.|....++..||..
T Consensus       290 AFKfKHHLKEHl-RIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  290 AFKFKHHLKEHL-RIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             hhhhHHHHHhhh-eeecCCCCcCCcccccccccCCcccccccc
Confidence            999999999998 799999999999999999999999999843


No 8  
>KOG3623|consensus
Probab=99.82  E-value=6.5e-21  Score=168.13  Aligned_cols=77  Identities=32%  Similarity=0.685  Sum_probs=71.9

Q ss_pred             cccccccccccCChHHHHHHHhhhcCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC-ccccccc
Q psy16828        264 RFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD-FRTKHML  341 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~-~l~~h~~  341 (372)
                      .|.|..|++.|...+.|.+|...|+|.+||+|.+|.+.|..+-.|..|+|.|.+++| |.|+.|++.|.-. ....||.
T Consensus       894 myaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  894 MYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             cchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccccchHhhhc
Confidence            499999999999999999999999999999999999999999999999999999999 9999999999655 6666664


No 9  
>KOG3576|consensus
Probab=99.72  E-value=1.3e-18  Score=130.29  Aligned_cols=124  Identities=21%  Similarity=0.472  Sum_probs=103.1

Q ss_pred             cCCCCcccccccccccccchHHhHHhhhhccCcccccccccccCChHHHHHHHhhhcCCCCcccCcccccccchhhHHHH
Q psy16828        232 ENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLH  311 (372)
Q Consensus       232 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  311 (372)
                      .+...+.|.+|++.|.-...|.+|++-|...+++-|..||+.|.+.-+|++|+++|+|.+||+|..|++.|+++-.|..|
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            44566889999999988888999999888889999999999999999999999999999999999999999999999999


Q ss_pred             HhhhcCCCCCccCCCCCCcCCCCccccccccccCCCceeCcccCCcccChhhHHHHHhhcC
Q psy16828        312 MRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRKHQ  372 (372)
Q Consensus       312 ~~~h~~~~~~~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  372 (372)
                      ++..|+....|.=                 ..-.+|.|.|..||+....+..+..|++.|+
T Consensus       193 l~kvhgv~~~yay-----------------kerr~kl~vcedcg~t~~~~e~~~~h~~~~h  236 (267)
T KOG3576|consen  193 LKKVHGVQHQYAY-----------------KERRAKLYVCEDCGYTSERPEVYYLHLKLHH  236 (267)
T ss_pred             HHHHcCchHHHHH-----------------HHhhhheeeecccCCCCCChhHHHHHHHhcC
Confidence            9888876542210                 1113578899999999888888888888764


No 10 
>KOG3576|consensus
Probab=99.62  E-value=1.1e-16  Score=120.01  Aligned_cols=127  Identities=29%  Similarity=0.552  Sum_probs=92.6

Q ss_pred             CCceeecCCCCCcccChHHHHHHHHHhcCCCCcccccchhhhcChhhhHhhhhhhccCCCCcccccccccccccchHHhH
Q psy16828        176 KEYSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEH  255 (372)
Q Consensus       176 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H  255 (372)
                      +...+.|..|++.|.-...|.+|++-|...+.+.|..||+.|.+.-+|.+|+++ |+|.+||+|..|++.|..+-+|..|
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rt-htgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRT-HTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhcc-ccCccccchhhhhHHHHhhccHHHH
Confidence            455677888888887777788888777777777788888888777778888777 7777778777777777777777777


Q ss_pred             HhhhhccCcccccccccccCChHHHHHHHhhhcCCCCcccCcccccccchhhHHHHHhhhcCCCC
Q psy16828        256 LNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRP  320 (372)
Q Consensus       256 ~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  320 (372)
                      ++..|+...            ...     ......+.|.|..||++-.....+..|++.|+...+
T Consensus       193 l~kvhgv~~------------~ya-----ykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  193 LKKVHGVQH------------QYA-----YKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHHHcCchH------------HHH-----HHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            776665421            000     001234668888888888888888888888887654


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.34  E-value=1.6e-12  Score=116.50  Aligned_cols=142  Identities=19%  Similarity=0.439  Sum_probs=94.8

Q ss_pred             CcccccchhhhcChhhhHhhhhhhccCCCCccccc--ccccccccchHHhHHhhhhccCcccccccccccCChHHHHHHH
Q psy16828        207 PYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYI--CNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHM  284 (372)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  284 (372)
                      ...|+.|..... ..+|..|... ..- ....|+.  |+..|. +..+..|         +.|+.|++.|. ...|..|+
T Consensus       407 ~V~C~NC~~~i~-l~~l~lHe~~-C~r-~~V~Cp~~~Cg~v~~-r~el~~H---------~~C~~Cgk~f~-~s~LekH~  472 (567)
T PLN03086        407 TVECRNCKHYIP-SRSIALHEAY-CSR-HNVVCPHDGCGIVLR-VEEAKNH---------VHCEKCGQAFQ-QGEMEKHM  472 (567)
T ss_pred             eEECCCCCCccc-hhHHHHHHhh-CCC-cceeCCcccccceee-ccccccC---------ccCCCCCCccc-hHHHHHHH
Confidence            356777775543 4445566543 222 3345764  777773 3334444         47888888875 57788888


Q ss_pred             hhhcCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC-----------ccccccccccCCCceeCcc
Q psy16828        285 ALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD-----------FRTKHMLVHDVEKSHLCFV  353 (372)
Q Consensus       285 ~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~-----------~l~~h~~~h~~~~~~~C~~  353 (372)
                      ..++  .++.|+ ||+.+ .+..|..|+.+|.+.++ +.|..|++.|...           .|..|.... |.+++.|..
T Consensus       473 ~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~  546 (567)
T PLN03086        473 KVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDS  546 (567)
T ss_pred             HhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccc
Confidence            8775  778888 88654 56788888888888777 8888888877522           466677764 888888888


Q ss_pred             cCCcccChhhHHHHHh
Q psy16828        354 CGAGFVNDAGLKVHMR  369 (372)
Q Consensus       354 C~~~f~~~~~l~~H~~  369 (372)
                      ||+.+. ..++..|+-
T Consensus       547 Cgk~Vr-lrdm~~H~~  561 (567)
T PLN03086        547 CGRSVM-LKEMDIHQI  561 (567)
T ss_pred             cCCeee-ehhHHHHHH
Confidence            887764 445666654


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.34  E-value=1.7e-12  Score=116.25  Aligned_cols=146  Identities=18%  Similarity=0.378  Sum_probs=111.1

Q ss_pred             ceeecCCCCCcccChHHHHHHHHHhcCCCCccccc--chhhhcChhhhHhhhhhhccCCCCcccccccccccccchHHhH
Q psy16828        178 YSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKY--CDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEH  255 (372)
Q Consensus       178 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H  255 (372)
                      ....|+.|.+.... ..|..|...- ......|+.  |+..|. ...+.          ..+.|+.|++.|. ...|..|
T Consensus       406 ~~V~C~NC~~~i~l-~~l~lHe~~C-~r~~V~Cp~~~Cg~v~~-r~el~----------~H~~C~~Cgk~f~-~s~LekH  471 (567)
T PLN03086        406 DTVECRNCKHYIPS-RSIALHEAYC-SRHNVVCPHDGCGIVLR-VEEAK----------NHVHCEKCGQAFQ-QGEMEKH  471 (567)
T ss_pred             CeEECCCCCCccch-hHHHHHHhhC-CCcceeCCcccccceee-ccccc----------cCccCCCCCCccc-hHHHHHH
Confidence            34579999887553 4566776332 234456874  888773 23333          3358999999995 6789999


Q ss_pred             HhhhhccCcccccccccccCChHHHHHHHhhhcCCCCcccCccccccc----------chhhHHHHHhhhcCCCCCccCC
Q psy16828        256 LNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFK----------LKYYVNLHMRTHTRIRPTFECD  325 (372)
Q Consensus       256 ~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~l~~H~~~h~~~~~~~~C~  325 (372)
                      +..+|  .++.|+ |++.+ .+..|..|+.+|.+.+++.|+.|++.|.          ..+.|..|.... +.++ +.|.
T Consensus       472 ~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt-~~C~  545 (567)
T PLN03086        472 MKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRT-APCD  545 (567)
T ss_pred             HHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcc-eEcc
Confidence            99876  789999 99755 6789999999999999999999999985          245899998885 7777 9999


Q ss_pred             CCCCcCCCCccccccccc
Q psy16828        326 VCHQIFPTDFRTKHMLVH  343 (372)
Q Consensus       326 ~C~~~f~~~~l~~h~~~h  343 (372)
                      .|++.|....|..|+...
T Consensus       546 ~Cgk~Vrlrdm~~H~~~~  563 (567)
T PLN03086        546 SCGRSVMLKEMDIHQIAV  563 (567)
T ss_pred             ccCCeeeehhHHHHHHHh
Confidence            999999888887777543


No 13 
>PHA00733 hypothetical protein
Probab=99.13  E-value=5.4e-11  Score=86.83  Aligned_cols=82  Identities=21%  Similarity=0.379  Sum_probs=54.0

Q ss_pred             CCCcccccccccccccchHHhH--H---hhhhccCcccccccccccCChHHHHHHHhhhcCCCCcccCcccccccchhhH
Q psy16828        234 HKPYECYICNKILVSRGRLNEH--L---NQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYV  308 (372)
Q Consensus       234 ~~~~~C~~C~~~f~~~~~l~~H--~---~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  308 (372)
                      .+++.|.+|...|.....|..+  +   ..+++.++|.|+.|++.|.+...|..|++.+  ..+|.|+.|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            3445555555555444443333  1   1234466778888888888888888887765  3467888888888888888


Q ss_pred             HHHHhhhcC
Q psy16828        309 NLHMRTHTR  317 (372)
Q Consensus       309 ~~H~~~h~~  317 (372)
                      ..|+...|+
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            888777665


No 14 
>KOG3993|consensus
Probab=99.00  E-value=1.7e-10  Score=96.91  Aligned_cols=162  Identities=20%  Similarity=0.311  Sum_probs=90.6

Q ss_pred             cccccchhhhcChhhhHhhhhhhccCCCCcccccccccccccchHHhHHhhhhccCccc--ccccc-cccCChHHHHHHH
Q psy16828        208 YHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFE--CKLCH-KTIVSEKTFKKHM  284 (372)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~--C~~C~-~~f~~~~~l~~H~  284 (372)
                      |.|..|...|.+.-.|.+|... ......|+|+.|++.|.-..+|..|.+.|-...--.  =.-=. +...+....+.--
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~-RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCP-RIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCC-eeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            7777777777777777777654 444445777777777777777777766554211000  00000 0000000000000


Q ss_pred             hh--hcCCCCcccCcccccccchhhHHHHHhhhcCC--------------------------------------------
Q psy16828        285 AL--HSDAKPFVCNICGKDFKLKYYVNLHMRTHTRI--------------------------------------------  318 (372)
Q Consensus       285 ~~--h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~--------------------------------------------  318 (372)
                      +.  -..+..|.|.+|++.|+....|++|+.+|+..                                            
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~  426 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAG  426 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeec
Confidence            00  00111356666666666666666665555421                                            


Q ss_pred             -CCCccCCCCCCcCCCC-ccccccccccCCCceeCcccCCcccChhhHHHHHhh
Q psy16828        319 -RPTFECDVCHQIFPTD-FRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRK  370 (372)
Q Consensus       319 -~~~~~C~~C~~~f~~~-~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  370 (372)
                       .....|+.|+..+.+. .-..+.+....+..|.|.+|.-.|...-.|.+|+..
T Consensus       427 sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  427 SAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             cccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhh
Confidence             1124567777666554 334466666677789999999999999999999864


No 15 
>PHA00733 hypothetical protein
Probab=98.97  E-value=6.1e-10  Score=81.30  Aligned_cols=83  Identities=13%  Similarity=0.237  Sum_probs=57.5

Q ss_pred             CCCcccccchhhhcChhhhHhh--hh--hhccCCCCcccccccccccccchHHhHHhhhhccCcccccccccccCChHHH
Q psy16828        205 AEPYHCKYCDKTFTKRMNVKTH--ER--MKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTF  280 (372)
Q Consensus       205 ~~~~~C~~C~~~f~~~~~l~~H--~~--~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l  280 (372)
                      .+++.|.+|.+.|..+..|..+  +.  ..+.+++||.|+.|++.|.+...|..|++.+  ..++.|+.|+++|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            3456666666666555555444  11  1234467888888888888888888888764  3468888888888888888


Q ss_pred             HHHHhhhcC
Q psy16828        281 KKHMALHSD  289 (372)
Q Consensus       281 ~~H~~~h~~  289 (372)
                      ..|+...++
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            888877654


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.89  E-value=8.1e-10  Score=65.63  Aligned_cols=38  Identities=24%  Similarity=0.542  Sum_probs=20.3

Q ss_pred             cccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCC
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPT  333 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~  333 (372)
                      |.|+.||+.|...++|..|+++|.  ++ |+|..|++.|..
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~   43 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLR   43 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceecc
Confidence            455555555555555555555555  23 555555555543


No 17 
>KOG3993|consensus
Probab=98.84  E-value=8.1e-10  Score=92.94  Aligned_cols=197  Identities=16%  Similarity=0.158  Sum_probs=109.6

Q ss_pred             CCeecccccccccChhHHHHHHHhhccCceeecccccccccCchhHHHHHHhhcccCCCCccccccccCcccCCCCcccc
Q psy16828         81 APVECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKCDQCDYAT  160 (372)
Q Consensus        81 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~  160 (372)
                      +.|.|..|...|.+...|.+|.-...-...|+|+.|++.|.-..+|..|.++|........    .+..+-+     ...
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~----a~~~P~k-----~~~  336 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAK----AGSPPPK-----QAV  336 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhh----cCCCChh-----hhh
Confidence            4589999999999999999996444444589999999999999999999999865422110    0000000     000


Q ss_pred             CChhhHHHHHh-hhcCCCceeecCCCCCcccChHHHHHHHHHhcCCCC-----------------cccccchhhhcChhh
Q psy16828        161 KDKYNLGTHIK-RRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEP-----------------YHCKYCDKTFTKRMN  222 (372)
Q Consensus       161 ~~~~~l~~H~~-~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~-----------------~~C~~C~~~f~~~~~  222 (372)
                      .+....+.--+ -.-..+..|.|.+|++.|.....|+.|+..|+....                 +.+..+...+.....
T Consensus       337 ~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~  416 (500)
T KOG3993|consen  337 ETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDS  416 (500)
T ss_pred             hhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccc
Confidence            01110100000 000223468888888888888888888777663211                 223333333322221


Q ss_pred             hHhhhhhhccCCCCcccccccccccccchHHhHHhhhhccCcccccccccccCChHHHHHHHhh
Q psy16828        223 VKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMAL  286 (372)
Q Consensus       223 l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  286 (372)
                      -..+....-....-..|+.|+..+.++..--.+.+.-+..+.|.|.+|..+|.+...|.+|++.
T Consensus       417 ~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  417 HGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             cccceeeeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhh
Confidence            1111111011112234666666666555544444444555566666666666666666666543


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.77  E-value=4.8e-09  Score=62.36  Aligned_cols=44  Identities=16%  Similarity=0.305  Sum_probs=38.9

Q ss_pred             cccccccccccCChHHHHHHHhhhcCCCCcccCcccccccchhhHH
Q psy16828        264 RFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVN  309 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  309 (372)
                      .|.|+.|++.|...+.|..|+++|+  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4789999999999999999999998  7899999999998877664


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.68  E-value=1.1e-08  Score=51.90  Aligned_cols=25  Identities=40%  Similarity=1.024  Sum_probs=19.8

Q ss_pred             HHHHHHhhhcCCCCcccCccccccc
Q psy16828        279 TFKKHMALHSDAKPFVCNICGKDFK  303 (372)
Q Consensus       279 ~l~~H~~~h~~~~~~~C~~C~~~f~  303 (372)
                      +|..|+++|+|++||.|+.|+++|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4677888888888888888888775


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.53  E-value=1e-08  Score=52.00  Aligned_cols=24  Identities=38%  Similarity=0.621  Sum_probs=15.5

Q ss_pred             cccccccccCCCceeCcccCCccc
Q psy16828        336 RTKHMLVHDVEKSHLCFVCGAGFV  359 (372)
Q Consensus       336 l~~h~~~h~~~~~~~C~~C~~~f~  359 (372)
                      |..|++.|+|++||.|++|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            445666666666666766766664


No 21 
>PHA00616 hypothetical protein
Probab=98.38  E-value=1.5e-07  Score=53.10  Aligned_cols=29  Identities=24%  Similarity=0.353  Sum_probs=14.6

Q ss_pred             CcccCcccccccchhhHHHHHhhhcCCCC
Q psy16828        292 PFVCNICGKDFKLKYYVNLHMRTHTRIRP  320 (372)
Q Consensus       292 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  320 (372)
                      ||+|+.||+.|...+.|.+|++.|++.++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            34455555555555555555555554444


No 22 
>PHA00616 hypothetical protein
Probab=98.36  E-value=1.9e-07  Score=52.70  Aligned_cols=34  Identities=12%  Similarity=0.274  Sum_probs=25.9

Q ss_pred             cccccccccccCChHHHHHHHhhhcCCCCcccCc
Q psy16828        264 RFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNI  297 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  297 (372)
                      ||+|+.||+.|...++|..|++.|+|++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            4677888888888888888888888887777653


No 23 
>PHA00732 hypothetical protein
Probab=98.28  E-value=6.7e-07  Score=58.93  Aligned_cols=50  Identities=28%  Similarity=0.592  Sum_probs=33.8

Q ss_pred             cccccccccccCChHHHHHHHhh-hcCCCCcccCcccccccchhhHHHHHhhhcCCC
Q psy16828        264 RFECKLCHKTIVSEKTFKKHMAL-HSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIR  319 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  319 (372)
                      ||.|+.|++.|.+.+.|..|++. |.   ++.|+.||+.|.   .|..|..+..+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~~~~   51 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQYDIE   51 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccCCcc
Confidence            46677777777777777777764 44   246777777776   4777776655543


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.23  E-value=1.6e-06  Score=53.02  Aligned_cols=52  Identities=37%  Similarity=0.682  Sum_probs=38.0

Q ss_pred             ccccCcccccccchhHHhhhhhccCcCCCCccCCCCCCCCcchhhHHHhhhhccCCCCCCCCeecccccccccChhHHHH
Q psy16828         21 KVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRKDKLTR  100 (372)
Q Consensus        21 ~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~  100 (372)
                      .|.||.|++. .+...|..|+...|..+.                               +.+.|++|...+.  ..|..
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~-------------------------------~~v~CPiC~~~~~--~~l~~   47 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSES-------------------------------KNVVCPICSSRVT--DNLIR   47 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCC-------------------------------CCccCCCchhhhh--hHHHH
Confidence            5889999984 467788899888776421                               4578999887644  37888


Q ss_pred             HHHhhc
Q psy16828        101 HIAAVH  106 (372)
Q Consensus       101 H~~~~h  106 (372)
                      |+...|
T Consensus        48 Hl~~~H   53 (54)
T PF05605_consen   48 HLNSQH   53 (54)
T ss_pred             HHHHhc
Confidence            886665


No 25 
>PHA00732 hypothetical protein
Probab=98.21  E-value=1.2e-06  Score=57.81  Aligned_cols=48  Identities=23%  Similarity=0.476  Sum_probs=38.2

Q ss_pred             CcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCCcccccccccc
Q psy16828        292 PFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHD  344 (372)
Q Consensus       292 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~l~~h~~~h~  344 (372)
                      ||.|..|++.|.+.+.|..|++.++.  + +.|+.|++.|.  .+..|.+...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~-~~C~~CgKsF~--~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--L-TKCPVCNKSYR--RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--C-CccCCCCCEeC--ChhhhhcccC
Confidence            68999999999999999999985333  2 68999999998  4566665443


No 26 
>KOG1146|consensus
Probab=98.10  E-value=4e-06  Score=81.33  Aligned_cols=125  Identities=19%  Similarity=0.254  Sum_probs=86.2

Q ss_pred             cCcccccC-CCCCCCCccccCcccccccchhHHhhhhhccCcCCCCccCCCCCCCCcchhhHHHhhhhccCCCCCCCCee
Q psy16828          6 LSDTEAIE-PKPSKYIKVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVE   84 (372)
Q Consensus         6 ~~~~~~~~-~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   84 (372)
                      +..+..+. ..++..+.|.|+.|++.|.....|..||+.+|..-....|.        +...............+.++|.
T Consensus       449 ~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~--------~gq~~~~~arg~~~~~~~~p~~  520 (1406)
T KOG1146|consen  449 KRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCK--------AGQNHPRLARGEVYRCPGKPYP  520 (1406)
T ss_pred             hcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhH--------hccccccccccccccCCCCccc
Confidence            33444433 46677799999999999999999999999988765442220        0000000011122334558899


Q ss_pred             cccccccccChhHHHHHHHhhccC-------------------------------------------ceeeccccccccc
Q psy16828         85 CSYCGKVLSRKDKLTRHIAAVHSG-------------------------------------------KEYPCEQCDRKFT  121 (372)
Q Consensus        85 C~~C~~~~~~~~~l~~H~~~~h~~-------------------------------------------~~~~C~~C~~~f~  121 (372)
                      |..|.+.+.+...|.+|+...-..                                           -.+.|.+|++...
T Consensus       521 C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetn  600 (1406)
T KOG1146|consen  521 CRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETN  600 (1406)
T ss_pred             ceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhh
Confidence            999999999999999998543200                                           1388999999998


Q ss_pred             CchhHHHHHHhhcccCC
Q psy16828        122 NGYKLKQHMLTHMQKDT  138 (372)
Q Consensus       122 ~~~~l~~H~~~~~~~~~  138 (372)
                      ....|+.|+...+...+
T Consensus       601 iarnlrihmtss~~s~~  617 (1406)
T KOG1146|consen  601 IARNLRIHMTASPSSSP  617 (1406)
T ss_pred             hhhccccccccCCCCCC
Confidence            88999999876544443


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.04  E-value=6.8e-06  Score=50.27  Aligned_cols=49  Identities=27%  Similarity=0.563  Sum_probs=31.9

Q ss_pred             eecccccccccChhHHHHHHHhhccCc--eeecccccccccCchhHHHHHHhhc
Q psy16828         83 VECSYCGKVLSRKDKLTRHIAAVHSGK--EYPCEQCDRKFTNGYKLKQHMLTHM  134 (372)
Q Consensus        83 ~~C~~C~~~~~~~~~l~~H~~~~h~~~--~~~C~~C~~~f~~~~~l~~H~~~~~  134 (372)
                      |.|++|++ .-+...|..|....|...  .+.|++|...+.  .+|..|+...|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            66777777 345667777776666643  577777776543  37777776554


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.02  E-value=2.6e-06  Score=41.96  Aligned_cols=23  Identities=43%  Similarity=0.904  Sum_probs=21.6

Q ss_pred             eeCcccCCcccChhhHHHHHhhc
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRKH  371 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~h  371 (372)
                      |.|+.|++.|..+..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            78999999999999999999975


No 29 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.02  E-value=3.1e-06  Score=59.97  Aligned_cols=73  Identities=19%  Similarity=0.292  Sum_probs=21.6

Q ss_pred             ccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCCccccccccccCCCceeCcccCCcccChhhHHHHHhhc
Q psy16828        294 VCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRKH  371 (372)
Q Consensus       294 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  371 (372)
                      +|..|+..|.+...|..|+...|+...    +..........+..+.+.- ....+.|.+|++.|.+...|..||+.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~----~~~~~l~~~~~~~~~~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI----PDQKYLVDPNRLLNYLRKK-VKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Ccccccccccccccccccccccccccc----ccccccccccccccccccc-cCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            588999999999999999988776542    1111111112333333221 223699999999999999999999964


No 30 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.97  E-value=4e-06  Score=41.23  Aligned_cols=22  Identities=45%  Similarity=0.907  Sum_probs=14.3

Q ss_pred             cccCcccccccchhhHHHHHhh
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRT  314 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~  314 (372)
                      |.|+.|++.|.+++.|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666655


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.81  E-value=1.4e-05  Score=39.68  Aligned_cols=24  Identities=38%  Similarity=0.852  Sum_probs=20.4

Q ss_pred             eeCcccCCcccChhhHHHHHhhcC
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRKHQ  372 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~h~  372 (372)
                      |.|++|++.|.+...|..|+++|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999999875


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.76  E-value=1.9e-05  Score=55.86  Aligned_cols=73  Identities=21%  Similarity=0.440  Sum_probs=15.4

Q ss_pred             ccCcccccccchhHHhhhhhccCcCCCCccCCCCCCCCcchhhHHHhhhhccCCCCCCCCeecccccccccChhHHHHHH
Q psy16828         23 ECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRKDKLTRHI  102 (372)
Q Consensus        23 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~  102 (372)
                      +|..|+..|.+...|..||...|....+....-.  ....+.      ...  .......+.|.+|++.|.+...|..|+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~--~~~~~~------~~~--~~~~~~~~~C~~C~~~f~s~~~l~~Hm   70 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLV--DPNRLL------NYL--RKKVKESFRCPYCNKTFRSREALQEHM   70 (100)
T ss_dssp             ----------------------------------------------------------SSEEBSSSS-EESSHHHHHHHH
T ss_pred             Cccccccccccccccccccccccccccccccccc--cccccc------ccc--ccccCCCCCCCccCCCCcCHHHHHHHH
Confidence            5999999999999999999988875443111000  000000      000  000012466777777777777777776


Q ss_pred             Hhh
Q psy16828        103 AAV  105 (372)
Q Consensus       103 ~~~  105 (372)
                      ...
T Consensus        71 ~~~   73 (100)
T PF12756_consen   71 RSK   73 (100)
T ss_dssp             HHT
T ss_pred             cCc
Confidence            543


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.72  E-value=2.1e-05  Score=39.06  Aligned_cols=24  Identities=54%  Similarity=0.996  Sum_probs=14.2

Q ss_pred             cccCcccccccchhhHHHHHhhhc
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRTHT  316 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~h~  316 (372)
                      |.|++|++.|.+...|..|+.+++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666553


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.64  E-value=2.8e-05  Score=39.90  Aligned_cols=26  Identities=38%  Similarity=0.759  Sum_probs=18.5

Q ss_pred             CcccCcccccccchhhHHHHHhhhcC
Q psy16828        292 PFVCNICGKDFKLKYYVNLHMRTHTR  317 (372)
Q Consensus       292 ~~~C~~C~~~f~~~~~l~~H~~~h~~  317 (372)
                      ||.|..|++.|.+...|..|++.|+.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            46777777777777777777776653


No 35 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.58  E-value=3.6e-05  Score=39.46  Aligned_cols=25  Identities=32%  Similarity=0.554  Sum_probs=22.9

Q ss_pred             ceeCcccCCcccChhhHHHHHhhcC
Q psy16828        348 SHLCFVCGAGFVNDAGLKVHMRKHQ  372 (372)
Q Consensus       348 ~~~C~~C~~~f~~~~~l~~H~~~h~  372 (372)
                      ||.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6899999999999999999999873


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.21  E-value=0.00014  Score=59.60  Aligned_cols=71  Identities=21%  Similarity=0.325  Sum_probs=49.0

Q ss_pred             CCCccccCc--ccccccchhHHhhhhhccCcCCCCccCCCCCCCCcchhhHHHhhhhccCCCCCCCCeecccccccccCh
Q psy16828         18 KYIKVECPV--CGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRK   95 (372)
Q Consensus        18 ~~~~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~   95 (372)
                      +++||+|++  |++.+.+...|+-|+..=|............       ..    .   .=..++|||.|.+|++.+.+.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~-------~~----~---~F~~~~KPYrCevC~KRYKNl  411 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPE-------KM----N---IFSAKDKPYRCEVCDKRYKNL  411 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCcc-------cc----c---cccccCCceeccccchhhccC
Confidence            359999996  9999999999999998545332211111000       00    0   002344899999999999999


Q ss_pred             hHHHHHH
Q psy16828         96 DKLTRHI  102 (372)
Q Consensus        96 ~~l~~H~  102 (372)
                      ..|..|.
T Consensus       412 NGLKYHr  418 (423)
T COG5189         412 NGLKYHR  418 (423)
T ss_pred             ccceecc
Confidence            9998886


No 37 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=97.14  E-value=0.00047  Score=57.37  Aligned_cols=29  Identities=24%  Similarity=0.473  Sum_probs=21.3

Q ss_pred             ccccCc--ccccccchhHHhhhhhccCcCCC
Q psy16828         21 KVECPV--CGKVLSRKSKLVSHMRSFHTSVT   49 (372)
Q Consensus        21 ~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~   49 (372)
                      .|.||.  |......+..|..|.+..|....
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~~~  181 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGFVL  181 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCcEE
Confidence            467775  77777778888899888775543


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.09  E-value=0.00029  Score=40.74  Aligned_cols=40  Identities=23%  Similarity=0.512  Sum_probs=19.2

Q ss_pred             hhhhhhccCCCCcccccccccccccchHHhHHhhhhccCc
Q psy16828        225 THERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQR  264 (372)
Q Consensus       225 ~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  264 (372)
                      .+.+.+...+.|-.||+|+..+....+|+.|+...|+.+|
T Consensus        13 ~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   13 KKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             ---CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3334445556666666666666666666666666665543


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.97  E-value=0.00051  Score=33.95  Aligned_cols=23  Identities=22%  Similarity=0.541  Sum_probs=12.8

Q ss_pred             cccCcccccccchhhHHHHHhhhc
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRTHT  316 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~h~  316 (372)
                      |+|+.|++... ...|.+|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666666665 666666666654


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.97  E-value=0.00054  Score=34.49  Aligned_cols=23  Identities=43%  Similarity=0.732  Sum_probs=21.1

Q ss_pred             eeCcccCCcccChhhHHHHHhhc
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRKH  371 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~h  371 (372)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            57999999999999999999876


No 41 
>KOG2231|consensus
Probab=96.96  E-value=0.0014  Score=60.68  Aligned_cols=14  Identities=36%  Similarity=0.508  Sum_probs=7.7

Q ss_pred             chhHHhhhhhccCc
Q psy16828         33 RKSKLVSHMRSFHT   46 (372)
Q Consensus        33 ~~~~l~~H~~~~H~   46 (372)
                      +...|+.|+...|.
T Consensus       126 s~~~Lk~H~~~~H~  139 (669)
T KOG2231|consen  126 SVENLKNHMRDQHK  139 (669)
T ss_pred             HHHHHHHHHHHhhh
Confidence            45556666655453


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.95  E-value=0.00097  Score=38.66  Aligned_cols=41  Identities=24%  Similarity=0.390  Sum_probs=24.2

Q ss_pred             HHHHhhhcCCCceeecCCCCCcccChHHHHHHHHHhcCCCC
Q psy16828        167 GTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEP  207 (372)
Q Consensus       167 ~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  207 (372)
                      ..+.+.....+.+-.||+|+..+.+..+|++|+...|+.+|
T Consensus        12 ~~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   12 TKKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             ----CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            34444445566778888998888888888888888887665


No 43 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.94  E-value=0.00033  Score=57.61  Aligned_cols=26  Identities=27%  Similarity=0.492  Sum_probs=17.6

Q ss_pred             ccccCcccCCCCccccCChhhHHHHH
Q psy16828        145 ISEIKKFKCDQCDYATKDKYNLGTHI  170 (372)
Q Consensus       145 ~~~~~~~~C~~C~~~~~~~~~l~~H~  170 (372)
                      ....+||+|+.|++.+.+...|+-|.
T Consensus       393 ~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         393 SAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cccCCceeccccchhhccCccceecc
Confidence            34556777777777777777776665


No 44 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.86  E-value=0.00089  Score=33.63  Aligned_cols=23  Identities=52%  Similarity=0.868  Sum_probs=12.9

Q ss_pred             cccCcccccccchhhHHHHHhhh
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRTH  315 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~h  315 (372)
                      |.|..|++.|...+.|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            34555666666666666665543


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.82  E-value=0.00062  Score=33.63  Aligned_cols=22  Identities=27%  Similarity=0.542  Sum_probs=18.2

Q ss_pred             eeCcccCCcccChhhHHHHHhhc
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRKH  371 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~h  371 (372)
                      |+|+.|++... +..|.+|++.|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            78999999998 99999999985


No 46 
>KOG2482|consensus
Probab=96.77  E-value=0.0034  Score=52.38  Aligned_cols=53  Identities=23%  Similarity=0.535  Sum_probs=42.9

Q ss_pred             CCeeccccccccc-ChhHHHHHHHhhccC----------------------ceeecccccccccCchhHHHHHHhh
Q psy16828         81 APVECSYCGKVLS-RKDKLTRHIAAVHSG----------------------KEYPCEQCDRKFTNGYKLKQHMLTH  133 (372)
Q Consensus        81 ~~~~C~~C~~~~~-~~~~l~~H~~~~h~~----------------------~~~~C~~C~~~f~~~~~l~~H~~~~  133 (372)
                      ...+|-.|...+. ++.....|+...|+-                      ..+.|-.|.+.|+++..|+.||+..
T Consensus       143 fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  143 FSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             eeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhc
Confidence            4568999988865 677788888777743                      1489999999999999999999753


No 47 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.71  E-value=0.00087  Score=33.47  Aligned_cols=23  Identities=26%  Similarity=0.739  Sum_probs=21.1

Q ss_pred             eeCcccCCcccChhhHHHHHhhc
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRKH  371 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~h  371 (372)
                      |.|.+|++.|.++..|+.|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            68999999999999999999864


No 48 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.64  E-value=0.0013  Score=33.55  Aligned_cols=22  Identities=36%  Similarity=0.717  Sum_probs=20.7

Q ss_pred             cccCcccccccchhHHhhhhhc
Q psy16828         22 VECPVCGKVLSRKSKLVSHMRS   43 (372)
Q Consensus        22 ~~C~~C~~~f~~~~~l~~H~~~   43 (372)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999985


No 49 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.64  E-value=0.00098  Score=33.28  Aligned_cols=22  Identities=36%  Similarity=0.750  Sum_probs=20.7

Q ss_pred             cccCcccccccchhHHhhhhhc
Q psy16828         22 VECPVCGKVLSRKSKLVSHMRS   43 (372)
Q Consensus        22 ~~C~~C~~~f~~~~~l~~H~~~   43 (372)
                      |.|.+|+..|.+...|+.|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            6899999999999999999985


No 50 
>KOG2785|consensus
Probab=96.31  E-value=0.0059  Score=52.06  Aligned_cols=80  Identities=14%  Similarity=0.287  Sum_probs=47.8

Q ss_pred             ccccCcccccccchhHHhhhhhc-cCcCC-------CCccCCCCCCCCcchhhHHHhhhhccCCCCCCCCeecccccccc
Q psy16828         21 KVECPVCGKVLSRKSKLVSHMRS-FHTSV-------TPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVL   92 (372)
Q Consensus        21 ~~~C~~C~~~f~~~~~l~~H~~~-~H~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~   92 (372)
                      .|+|.-|...|.+...-+.|+++ .|.-.       .|....+.+.........    ...........++.|.+|.+.|
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~----~~~~~~e~~~~~~~c~~c~k~~   78 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDS----EKEENLEEAESVVYCEACNKSF   78 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhh----hhhhhhhhcccceehHHhhccc
Confidence            58999999999999999999974 34321       121111111100000000    0011111223578999999999


Q ss_pred             cChhHHHHHHHh
Q psy16828         93 SRKDKLTRHIAA  104 (372)
Q Consensus        93 ~~~~~l~~H~~~  104 (372)
                      .+......|+..
T Consensus        79 ~s~~a~~~hl~S   90 (390)
T KOG2785|consen   79 ASPKAHENHLKS   90 (390)
T ss_pred             cChhhHHHHHHH
Confidence            999999999854


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.28  E-value=0.0011  Score=33.74  Aligned_cols=22  Identities=32%  Similarity=0.626  Sum_probs=19.1

Q ss_pred             eeCcccCCcccChhhHHHHHhh
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRK  370 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~  370 (372)
                      |.|..|++.|.+...+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999988875


No 52 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.22  E-value=0.0052  Score=51.40  Aligned_cols=133  Identities=23%  Similarity=0.405  Sum_probs=87.7

Q ss_pred             Ceeccc--ccccccChhHHHHHHHhhccCceeecccccc---cc------cCchhHHHHHHhhcccCCCCccccccccCc
Q psy16828         82 PVECSY--CGKVLSRKDKLTRHIAAVHSGKEYPCEQCDR---KF------TNGYKLKQHMLTHMQKDTSISIDVISEIKK  150 (372)
Q Consensus        82 ~~~C~~--C~~~~~~~~~l~~H~~~~h~~~~~~C~~C~~---~f------~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~  150 (372)
                      .|.|+.  |..+......|..|+...|+.  +.|.+|-.   .|      .+...|..|...-.+..        +-...
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~--------GFKGH  220 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEE--------GFKGH  220 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCcccc--------CcCCC
Confidence            478887  888888888999998776653  66776642   22      34455666644322110        11122


Q ss_pred             ccCCCCccccCChhhHHHHHhhhcCCCceeecCCCCC-------cccChHHHHHHHHHhcCCCCccccc--ch----hhh
Q psy16828        151 FKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGF-------GCYTNRELEEHQILTHGAEPYHCKY--CD----KTF  217 (372)
Q Consensus       151 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~-------~f~~~~~l~~H~~~~~~~~~~~C~~--C~----~~f  217 (372)
                      -.|..|...|-+.+.|..|++..|.     .|-+|+.       .|.+...|..|.+..|    |.|..  |.    ..|
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~~HE-----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~~~k~~vf  291 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRLRHE-----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCRVGKCYVF  291 (493)
T ss_pred             chhhhccceecChHHHHHHHHhhhh-----hhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEecCcEEEe
Confidence            3589999999999999999977765     4666664       4666777777776554    66654  32    467


Q ss_pred             cChhhhHhhhhhhccC
Q psy16828        218 TKRMNVKTHERMKHEN  233 (372)
Q Consensus       218 ~~~~~l~~H~~~~h~~  233 (372)
                      ...-.|+.|+...|..
T Consensus       292 ~~~~el~~h~~~~h~~  307 (493)
T COG5236         292 PYHTELLEHLTRFHKV  307 (493)
T ss_pred             ccHHHHHHHHHHHhhc
Confidence            7778888888776643


No 53 
>PRK04860 hypothetical protein; Provisional
Probab=96.11  E-value=0.0026  Score=48.44  Aligned_cols=37  Identities=22%  Similarity=0.679  Sum_probs=24.2

Q ss_pred             cccccccccccCChHHHHHHHhhhcCCCCcccCcccccccc
Q psy16828        264 RFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKL  304 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  304 (372)
                      +|.|. |+.   ....+..|.++|.++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            46666 665   55556667777777777777777766654


No 54 
>KOG2893|consensus
Probab=96.11  E-value=0.0018  Score=51.07  Aligned_cols=53  Identities=25%  Similarity=0.402  Sum_probs=44.0

Q ss_pred             CCccccCcccccccchhHHhhhhhccCcCCCCccCCCCCCCCcchhhHHHhhhhccCCCCCCCCeecccccccccChhHH
Q psy16828         19 YIKVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRKDKL   98 (372)
Q Consensus        19 ~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l   98 (372)
                      ..+-+|=.||+.|.....|..|++.                                     +-|+|.+|.+..-+.-.|
T Consensus         8 ~~kpwcwycnrefddekiliqhqka-------------------------------------khfkchichkkl~sgpgl   50 (341)
T KOG2893|consen    8 VDKPWCWYCNREFDDEKILIQHQKA-------------------------------------KHFKCHICHKKLFSGPGL   50 (341)
T ss_pred             cCCceeeecccccchhhhhhhhhhh-------------------------------------ccceeeeehhhhccCCCc
Confidence            3445699999999999999999887                                     558999999998888888


Q ss_pred             HHHHHhhccC
Q psy16828         99 TRHIAAVHSG  108 (372)
Q Consensus        99 ~~H~~~~h~~  108 (372)
                      ..|....|.+
T Consensus        51 sihcmqvhke   60 (341)
T KOG2893|consen   51 SIHCMQVHKE   60 (341)
T ss_pred             eeehhhhhhh
Confidence            8888777765


No 55 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.78  E-value=0.0077  Score=29.91  Aligned_cols=21  Identities=33%  Similarity=0.632  Sum_probs=16.5

Q ss_pred             eeCcccCCcccChhhHHHHHhh
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRK  370 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~  370 (372)
                      ..|+.||+.| ....|..|++.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4588888888 77888888764


No 56 
>KOG1146|consensus
Probab=95.75  E-value=0.0051  Score=60.79  Aligned_cols=76  Identities=14%  Similarity=0.328  Sum_probs=48.6

Q ss_pred             cccchhhhcChhhhHhhhhhhccCCCCcccccccccccccchHHhHHhhhhc-------------------------cCc
Q psy16828        210 CKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHL-------------------------AQR  264 (372)
Q Consensus       210 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~-------------------------~~~  264 (372)
                      |..|+..+.+...+..|+...+.-.+.++|+.|++.+.....|..|++..|.                         .++
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p  518 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP  518 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc
Confidence            3344455555555555555555556777777777777777777777776432                         235


Q ss_pred             ccccccccccCChHHHHHHHh
Q psy16828        265 FECKLCHKTIVSEKTFKKHMA  285 (372)
Q Consensus       265 ~~C~~C~~~f~~~~~l~~H~~  285 (372)
                      |.|..|..++....+|.+|+.
T Consensus       519 ~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  519 YPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ccceeeeeeeecchHHHHHHH
Confidence            667777777777666666654


No 57 
>KOG2482|consensus
Probab=95.72  E-value=0.025  Score=47.50  Aligned_cols=51  Identities=20%  Similarity=0.315  Sum_probs=34.9

Q ss_pred             ccccccccccCChHHHHHHHhhhcC---------------------------CCCcccCcccccccchhhHHHHHhhh
Q psy16828        265 FECKLCHKTIVSEKTFKKHMALHSD---------------------------AKPFVCNICGKDFKLKYYVNLHMRTH  315 (372)
Q Consensus       265 ~~C~~C~~~f~~~~~l~~H~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~~~h  315 (372)
                      ..|-.|.....+...|..|+..-+.                           ...-.|-.|+-.|.....|..|+.-+
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence            4677777766667777777654321                           01235888999999999999998654


No 58 
>KOG2785|consensus
Probab=95.62  E-value=0.037  Score=47.43  Aligned_cols=52  Identities=19%  Similarity=0.453  Sum_probs=42.2

Q ss_pred             CeecccccccccChhHHHHHHHhh-c------------------------------------cCceeecccccccccCch
Q psy16828         82 PVECSYCGKVLSRKDKLTRHIAAV-H------------------------------------SGKEYPCEQCDRKFTNGY  124 (372)
Q Consensus        82 ~~~C~~C~~~~~~~~~l~~H~~~~-h------------------------------------~~~~~~C~~C~~~f~~~~  124 (372)
                      .|.|..|...|.+...-+.|++.. |                                    ...++.|..|.+.|.+..
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            488999999999998888898532 2                                    012589999999999999


Q ss_pred             hHHHHHHhh
Q psy16828        125 KLKQHMLTH  133 (372)
Q Consensus       125 ~l~~H~~~~  133 (372)
                      ....|+..-
T Consensus        83 a~~~hl~Sk   91 (390)
T KOG2785|consen   83 AHENHLKSK   91 (390)
T ss_pred             hHHHHHHHh
Confidence            999998754


No 59 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.48  E-value=0.011  Score=29.38  Aligned_cols=21  Identities=29%  Similarity=0.630  Sum_probs=15.4

Q ss_pred             cccCcccccccchhhHHHHHhh
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRT  314 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~  314 (372)
                      ..|+.||+.| ..+.|..|+..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4688888888 67777877654


No 60 
>PRK04860 hypothetical protein; Provisional
Probab=95.08  E-value=0.015  Score=44.34  Aligned_cols=35  Identities=23%  Similarity=0.591  Sum_probs=20.0

Q ss_pred             CcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcC
Q psy16828        292 PFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIF  331 (372)
Q Consensus       292 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  331 (372)
                      +|.|. |+.   ....+..|.+++.+.++ |.|..|+..|
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l  153 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETL  153 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCcee
Confidence            46665 665   44555666666665555 5555555544


No 61 
>KOG2231|consensus
Probab=94.90  E-value=0.038  Score=51.67  Aligned_cols=100  Identities=19%  Similarity=0.373  Sum_probs=53.7

Q ss_pred             ecCCCCCcccChHHHHHHHHHhcCCCCcccccch----------hhhcChhhhHhhhhhhccCCCC----cccccccccc
Q psy16828        181 LCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCD----------KTFTKRMNVKTHERMKHENHKP----YECYICNKIL  246 (372)
Q Consensus       181 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~----------~~f~~~~~l~~H~~~~h~~~~~----~~C~~C~~~f  246 (372)
                      .|..| ..|.+...|..|+...|.  .+.|..|-          +.| +...|..|+...-.+++.    -.|..|...|
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Y-t~~el~~h~~~gd~d~~s~rGhp~C~~C~~~f  192 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLY-TRAELNLHLMFGDPDDESCRGHPLCKFCHERF  192 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhh--hhccccccccceeeeeeeehe-hHHHHHHHHhcCCCccccccCCccchhhhhhh
Confidence            46667 666777777777755543  24444442          222 344566665542222211    3466666666


Q ss_pred             cccchHHhHHhhhhccCcccccccc------cccCChHHHHHHHhhhc
Q psy16828        247 VSRGRLNEHLNQVHLAQRFECKLCH------KTIVSEKTFKKHMALHS  288 (372)
Q Consensus       247 ~~~~~l~~H~~~~~~~~~~~C~~C~------~~f~~~~~l~~H~~~h~  288 (372)
                      .....|..|++..|    |.|..|.      .-|....+|..|.+.++
T Consensus       193 ld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  193 LDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             ccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            66666666666544    3344442      33445556666665544


No 62 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.67  E-value=0.14  Score=36.07  Aligned_cols=24  Identities=33%  Similarity=0.535  Sum_probs=13.0

Q ss_pred             ceeCcccCCcccChhhHHHHHhhc
Q psy16828        348 SHLCFVCGAGFVNDAGLKVHMRKH  371 (372)
Q Consensus       348 ~~~C~~C~~~f~~~~~l~~H~~~h  371 (372)
                      .|.|+.|...|-..-+...|..+|
T Consensus        81 ~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        81 RYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ceeCCCCCCccccccchhhhhhcc
Confidence            455555555555555555555444


No 63 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.34  E-value=0.027  Score=30.64  Aligned_cols=24  Identities=13%  Similarity=0.422  Sum_probs=21.6

Q ss_pred             CccccCcccccccchhHHhhhhhc
Q psy16828         20 IKVECPVCGKVLSRKSKLVSHMRS   43 (372)
Q Consensus        20 ~~~~C~~C~~~f~~~~~l~~H~~~   43 (372)
                      .+|.|.+|+..|.+...+..|+..
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHCh
Confidence            368999999999999999999875


No 64 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.05  E-value=0.044  Score=29.76  Aligned_cols=24  Identities=17%  Similarity=0.627  Sum_probs=21.1

Q ss_pred             CceeCcccCCcccChhhHHHHHhh
Q psy16828        347 KSHLCFVCGAGFVNDAGLKVHMRK  370 (372)
Q Consensus       347 ~~~~C~~C~~~f~~~~~l~~H~~~  370 (372)
                      .+|.|.+|+..|.+...+..|++.
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHCh
Confidence            368999999999999999999874


No 65 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=93.98  E-value=0.045  Score=27.39  Aligned_cols=24  Identities=29%  Similarity=0.758  Sum_probs=16.0

Q ss_pred             cCCCCCCcCCCCccccccccccCCCceeCcccCCccc
Q psy16828        323 ECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFV  359 (372)
Q Consensus       323 ~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~~f~  359 (372)
                      .||.|++..+..             .-.|+.||+.|.
T Consensus         2 ~CP~C~~~V~~~-------------~~~Cp~CG~~F~   25 (26)
T PF10571_consen    2 TCPECGAEVPES-------------AKFCPHCGYDFE   25 (26)
T ss_pred             cCCCCcCCchhh-------------cCcCCCCCCCCc
Confidence            477787766433             234888888885


No 66 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.37  E-value=0.05  Score=49.90  Aligned_cols=152  Identities=21%  Similarity=0.336  Sum_probs=98.3

Q ss_pred             CCcccccchhhhcChhhhHhhhhh-hccCC--CCcccc--cccccccccchHHhHHhhhhccCcccccccc--cccCChH
Q psy16828        206 EPYHCKYCDKTFTKRMNVKTHERM-KHENH--KPYECY--ICNKILVSRGRLNEHLNQVHLAQRFECKLCH--KTIVSEK  278 (372)
Q Consensus       206 ~~~~C~~C~~~f~~~~~l~~H~~~-~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~--~~f~~~~  278 (372)
                      .++.|..|...|.....+..|.+. .|.++  +++.|+  .|++.|.....+..|...+.+..++.+..-.  ..+....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            367888888888888888888883 48888  888888  7888888888888888888877766665533  2222221


Q ss_pred             HH-----HHHHhhhcCCCCcccC--cccccccchhhHHHHHhhhcCCCC-CccCCCCCCcCCCC-ccccccccccCCCce
Q psy16828        279 TF-----KKHMALHSDAKPFVCN--ICGKDFKLKYYVNLHMRTHTRIRP-TFECDVCHQIFPTD-FRTKHMLVHDVEKSH  349 (372)
Q Consensus       279 ~l-----~~H~~~h~~~~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~-~~~C~~C~~~f~~~-~l~~h~~~h~~~~~~  349 (372)
                      .-     ......-.....+.+.  .|...+.....+..|...+-..++ .+.+..|.+.+... .+..|++.+....++
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  447 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAPL  447 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCCce
Confidence            11     1111111112222222  266666777777777777665442 26777788888666 667777887777776


Q ss_pred             eCcccCCc
Q psy16828        350 LCFVCGAG  357 (372)
Q Consensus       350 ~C~~C~~~  357 (372)
                      .|..++..
T Consensus       448 ~~~~~~~~  455 (467)
T COG5048         448 LCSILKSF  455 (467)
T ss_pred             eecccccc
Confidence            66555433


No 67 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.33  E-value=0.054  Score=49.68  Aligned_cols=107  Identities=26%  Similarity=0.456  Sum_probs=60.8

Q ss_pred             cccccccccccCChHHHHHHHh--hhcCC--CCcccC--cccccccchhhHHHHHhhhcCCCCCccCCC-----------
Q psy16828        264 RFECKLCHKTIVSEKTFKKHMA--LHSDA--KPFVCN--ICGKDFKLKYYVNLHMRTHTRIRPTFECDV-----------  326 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~-----------  326 (372)
                      ++.|..|...|.....+..|.+  .|.++  +++.|+  .|++.|.+...+..|...|.+..+ +.+..           
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~  367 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP-AKEKLLNSSSKFSPLL  367 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCc-cccccccCcccccccc
Confidence            4556666666666666666666  56665  566666  566666666666666666555443 22222           


Q ss_pred             --------------------------CCCcCCCC-ccccccccccCCC--ceeCcccCCcccChhhHHHHHhhc
Q psy16828        327 --------------------------CHQIFPTD-FRTKHMLVHDVEK--SHLCFVCGAGFVNDAGLKVHMRKH  371 (372)
Q Consensus       327 --------------------------C~~~f~~~-~l~~h~~~h~~~~--~~~C~~C~~~f~~~~~l~~H~~~h  371 (372)
                                                |...+.+. .+..|...+....  .+.+..|...|.....+..|++.|
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  441 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIH  441 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCccccccccccc
Confidence                                      11122111 2222333333333  467888999998888888888765


No 68 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.17  E-value=0.11  Score=27.86  Aligned_cols=10  Identities=50%  Similarity=1.086  Sum_probs=5.5

Q ss_pred             CceeCcccCC
Q psy16828        347 KSHLCFVCGA  356 (372)
Q Consensus       347 ~~~~C~~C~~  356 (372)
                      .++.|++||.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4455666654


No 69 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=91.75  E-value=0.21  Score=35.69  Aligned_cols=89  Identities=18%  Similarity=0.272  Sum_probs=47.8

Q ss_pred             CCCCccccCcccccccchhHHhhhhhccCcCCCCccC----------CCCCCCCcchhhHHHhhhhccCCCCCCCCeec-
Q psy16828         17 SKYIKVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAG----------GDNNDTSGHMSQIQTMLMLDHKKPKSRAPVEC-   85 (372)
Q Consensus        17 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C-   85 (372)
                      .......|..|...... ..+..|++..|........          .........+. ................-|.| 
T Consensus         7 ~~~~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~-~p~~~~~Pi~gLp~~~G~~C~   84 (109)
T PF12013_consen    7 PEYRVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQ-IPPDPSPPIPGLPVYDGYRCQ   84 (109)
T ss_pred             CcCCEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccC-CCCCCCCcCCCCCCCCCeeee
Confidence            34567889999988766 8899999976654322100          00000000000 00000000111111134788 


Q ss_pred             ---ccccccccChhHHHHHHHhhcc
Q psy16828         86 ---SYCGKVLSRKDKLTRHIAAVHS  107 (372)
Q Consensus        86 ---~~C~~~~~~~~~l~~H~~~~h~  107 (372)
                         ..|++.+.+...|..|+...|+
T Consensus        85 ~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   85 CDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             cCCCCCCcEeccHHHHHHHHHHhcC
Confidence               8888888888888888877664


No 70 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.89  E-value=0.14  Score=30.39  Aligned_cols=31  Identities=26%  Similarity=0.593  Sum_probs=23.7

Q ss_pred             CCCCCeecccccccccChhHHHHHHHhhccC
Q psy16828         78 KSRAPVECSYCGKVLSRKDKLTRHIAAVHSG  108 (372)
Q Consensus        78 ~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~  108 (372)
                      +++..+.|+-|+..|..+.++.+|+...|+.
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~~   43 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHGW   43 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhhh
Confidence            3446778888888888888888888776654


No 71 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=90.67  E-value=0.15  Score=31.00  Aligned_cols=31  Identities=19%  Similarity=0.443  Sum_probs=17.5

Q ss_pred             ccCCCCCCc-CCCCccccccccccCCCceeCcccCCc
Q psy16828        322 FECDVCHQI-FPTDFRTKHMLVHDVEKSHLCFVCGAG  357 (372)
Q Consensus       322 ~~C~~C~~~-f~~~~l~~h~~~h~~~~~~~C~~C~~~  357 (372)
                      |.|+.||+. ..+-.--+     .-..+|.|+.||+.
T Consensus        26 F~CPnCG~~~I~RC~~CR-----k~~~~Y~CP~CGF~   57 (59)
T PRK14890         26 FLCPNCGEVIIYRCEKCR-----KQSNPYTCPKCGFE   57 (59)
T ss_pred             eeCCCCCCeeEeechhHH-----hcCCceECCCCCCc
Confidence            777777765 33221000     01257999999863


No 72 
>KOG4173|consensus
Probab=89.70  E-value=0.23  Score=38.63  Aligned_cols=73  Identities=23%  Similarity=0.387  Sum_probs=34.3

Q ss_pred             CccccCChhhHHHHHhhhcCCCceeecCCCCCcccChHHHHHHHHHhc----------CCCCccccc--chhhhcChhhh
Q psy16828        156 CDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTH----------GAEPYHCKY--CDKTFTKRMNV  223 (372)
Q Consensus       156 C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~----------~~~~~~C~~--C~~~f~~~~~l  223 (372)
                      |...|.+.+....|....|.    ..|..|.+.|++.--|..|+..-|          |..-|.|-.  |+..|.+...-
T Consensus        87 c~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~R  162 (253)
T KOG4173|consen   87 CCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDR  162 (253)
T ss_pred             hHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhh
Confidence            44445444444444322222    135555555555554554543332          233455533  66666665555


Q ss_pred             Hhhhhhhcc
Q psy16828        224 KTHERMKHE  232 (372)
Q Consensus       224 ~~H~~~~h~  232 (372)
                      ..|+...|.
T Consensus       163 kdH~I~~Hk  171 (253)
T KOG4173|consen  163 KDHMIRMHK  171 (253)
T ss_pred             hhHHHHhcc
Confidence            555554443


No 73 
>KOG2893|consensus
Probab=89.25  E-value=0.16  Score=40.36  Aligned_cols=41  Identities=24%  Similarity=0.359  Sum_probs=18.6

Q ss_pred             CCCCccccCChhhHHHHHhhhcCCCceeecCCCCCcccChHHHHHH
Q psy16828        153 CDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEH  198 (372)
Q Consensus       153 C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H  198 (372)
                      |=.|++.|.++..|..|.+.     +-|+|-+|.+.+.+-..|..|
T Consensus        13 cwycnrefddekiliqhqka-----khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA-----KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhh-----ccceeeeehhhhccCCCceee
Confidence            44455555554444444322     224455555444444444444


No 74 
>KOG4173|consensus
Probab=89.12  E-value=0.25  Score=38.50  Aligned_cols=88  Identities=19%  Similarity=0.399  Sum_probs=48.3

Q ss_pred             ccccc--chhhhcChhhhHhhhhhhccCCCCcccccccccccccchHHhHHhhhhccCcccccccccccCChHHHHHHHh
Q psy16828        208 YHCKY--CDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMA  285 (372)
Q Consensus       208 ~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  285 (372)
                      +.|+.  |...|.+......|....|.+    .|..|.+.|.+...|..|+..-|..                  .-...
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~----sCs~C~r~~Pt~hLLd~HI~E~HDs------------------~Fqa~  137 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN----SCSFCKRAFPTGHLLDAHILEWHDS------------------LFQAL  137 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc----hhHHHHHhCCchhhhhHHHHHHHHH------------------HHHHH
Confidence            45654  556666666555665443333    5666666666666666665422210                  00012


Q ss_pred             hhcCCCCcccCc--ccccccchhhHHHHHhhhcC
Q psy16828        286 LHSDAKPFVCNI--CGKDFKLKYYVNLHMRTHTR  317 (372)
Q Consensus       286 ~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~  317 (372)
                      +..|...|+|..  |+..|.+...-..|+-.-|.
T Consensus       138 veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  138 VERGQDMYQCLVEGCTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             HHcCccHHHHHHHhhhhhhhhhhhhhhHHHHhcc
Confidence            223556677743  77777777777777655444


No 75 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=88.65  E-value=0.29  Score=26.39  Aligned_cols=24  Identities=38%  Similarity=0.868  Sum_probs=13.3

Q ss_pred             ccCCCCCCcCCCCccccccccccCCCceeCcccCC
Q psy16828        322 FECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGA  356 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~  356 (372)
                      |.|.+||.++...           +.|..|++||.
T Consensus         3 ~~C~~CG~i~~g~-----------~~p~~CP~Cg~   26 (34)
T cd00729           3 WVCPVCGYIHEGE-----------EAPEKCPICGA   26 (34)
T ss_pred             EECCCCCCEeECC-----------cCCCcCcCCCC
Confidence            5666666654322           13456777765


No 76 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.21  E-value=0.24  Score=29.39  Aligned_cols=30  Identities=27%  Similarity=0.294  Sum_probs=25.5

Q ss_pred             ccccCCCceeCcccCCcccChhhHHHHHhh
Q psy16828        341 LVHDVEKSHLCFVCGAGFVNDAGLKVHMRK  370 (372)
Q Consensus       341 ~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  370 (372)
                      ..-.||--+.||.||..|..+....+|+..
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            345678889999999999999999999864


No 77 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=86.95  E-value=1.3  Score=31.65  Aligned_cols=26  Identities=15%  Similarity=0.395  Sum_probs=18.6

Q ss_pred             CCeecccccccccChhHHHHHHHhhcc
Q psy16828         81 APVECSYCGKVLSRKDKLTRHIAAVHS  107 (372)
Q Consensus        81 ~~~~C~~C~~~~~~~~~l~~H~~~~h~  107 (372)
                      +.+.|..|...... .++..|++..|.
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~   35 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHH   35 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcc
Confidence            55778888887655 778888875543


No 78 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=86.64  E-value=1.3  Score=31.27  Aligned_cols=48  Identities=13%  Similarity=0.115  Sum_probs=24.9

Q ss_pred             cCCCCccccCChhhHHHHHhhhcCCCceeecCCCCCcccChHHHHHHHHHh
Q psy16828        152 KCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILT  202 (372)
Q Consensus       152 ~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  202 (372)
                      .|-.|...|........   ..-.....|.|+.|...|-..-++-.|...|
T Consensus        57 ~C~~C~~~f~~~~~~~~---~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPF---DELKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             cccCcCCCCCCcccccc---cccccccceeCCCCCCccccccchhhhhhcc
Confidence            47777777765421110   0012233566777766666665555665444


No 79 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=86.42  E-value=0.24  Score=40.07  Aligned_cols=92  Identities=21%  Similarity=0.569  Sum_probs=49.1

Q ss_pred             hcCCCCcccccchhhhcChhhhHhhhhhh-ccCCCCcccccccccccccchHHhHHhhhhccCcccccccccccCChHHH
Q psy16828        202 THGAEPYHCKYCDKTFTKRMNVKTHERMK-HENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTF  280 (372)
Q Consensus       202 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l  280 (372)
                      .|+.+.|.|.+|....-....+ .|+..- -.....|+|.-|++.-                 .|.|--|.-.|-.    
T Consensus       137 ~hGGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlG-----------------q~sCLRCK~cfCd----  194 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLG-----------------QYSCLRCKICFCD----  194 (314)
T ss_pred             cCCCeEEEeecCCCeeeccchh-hhhhhhhhhhccccccccccccc-----------------chhhhheeeeehh----
Confidence            3567778888887443322222 233221 2233557777776532                 2445555444443    


Q ss_pred             HHHHhhh----cCCCCcccCcccccccchhhHHHHHhhhc
Q psy16828        281 KKHMALH----SDAKPFVCNICGKDFKLKYYVNLHMRTHT  316 (372)
Q Consensus       281 ~~H~~~h----~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  316 (372)
                       .|++.-    ...+++.||.|++....-..|..-.++|.
T Consensus       195 -dHvrrKg~ky~k~k~~PCPKCg~et~eTkdLSmStR~hk  233 (314)
T PF06524_consen  195 -DHVRRKGFKYEKGKPIPCPKCGYETQETKDLSMSTRSHK  233 (314)
T ss_pred             -hhhhhcccccccCCCCCCCCCCCcccccccceeeeecch
Confidence             333321    23367788888887766666655555553


No 80 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.31  E-value=0.55  Score=33.19  Aligned_cols=13  Identities=46%  Similarity=1.237  Sum_probs=6.4

Q ss_pred             CCcccCccccccc
Q psy16828        291 KPFVCNICGKDFK  303 (372)
Q Consensus       291 ~~~~C~~C~~~f~  303 (372)
                      .|..||.||..|.
T Consensus        25 ~PivCP~CG~~~~   37 (108)
T PF09538_consen   25 DPIVCPKCGTEFP   37 (108)
T ss_pred             CCccCCCCCCccC
Confidence            4444555555443


No 81 
>PHA00626 hypothetical protein
Probab=84.94  E-value=0.31  Score=29.07  Aligned_cols=11  Identities=36%  Similarity=0.830  Sum_probs=5.8

Q ss_pred             CcccCcccccc
Q psy16828        292 PFVCNICGKDF  302 (372)
Q Consensus       292 ~~~C~~C~~~f  302 (372)
                      .|.|+.||+.|
T Consensus        23 rYkCkdCGY~f   33 (59)
T PHA00626         23 DYVCCDCGYND   33 (59)
T ss_pred             ceEcCCCCCee
Confidence            35555555555


No 82 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=84.50  E-value=0.8  Score=27.84  Aligned_cols=10  Identities=40%  Similarity=1.158  Sum_probs=6.5

Q ss_pred             CCcccCcccc
Q psy16828        291 KPFVCNICGK  300 (372)
Q Consensus       291 ~~~~C~~C~~  300 (372)
                      .+|.|+.||+
T Consensus        49 ~~Y~Cp~CGF   58 (61)
T COG2888          49 NPYRCPKCGF   58 (61)
T ss_pred             CceECCCcCc
Confidence            4667776665


No 83 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=84.10  E-value=0.64  Score=27.07  Aligned_cols=11  Identities=18%  Similarity=0.727  Sum_probs=6.4

Q ss_pred             ccCCCCCCcCC
Q psy16828        322 FECDVCHQIFP  332 (372)
Q Consensus       322 ~~C~~C~~~f~  332 (372)
                      |+|+.|+..|.
T Consensus         4 y~C~~CG~~~~   14 (46)
T PRK00398          4 YKCARCGREVE   14 (46)
T ss_pred             EECCCCCCEEE
Confidence            56666665543


No 84 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=83.89  E-value=0.26  Score=30.67  Aligned_cols=33  Identities=21%  Similarity=0.492  Sum_probs=15.0

Q ss_pred             CcccCc--ccccccchhhHHHHHhhhcCCCCCccCCC
Q psy16828        292 PFVCNI--CGKDFKLKYYVNLHMRTHTRIRPTFECDV  326 (372)
Q Consensus       292 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~  326 (372)
                      +..|+.  |...+ .+..|..|+...-..++ ..|+.
T Consensus         9 ~v~C~~~cc~~~i-~r~~l~~H~~~~C~~~~-v~C~~   43 (60)
T PF02176_consen    9 PVPCPNGCCNEMI-PRKELDDHLENECPKRP-VPCPY   43 (60)
T ss_dssp             EEE-TT--S-BEE-ECCCHHHHHHTTSTTSE-EE-SS
T ss_pred             EeeCCCCCcccce-eHHHHHHHHHccCCCCc-EECCC
Confidence            345555  33333 35566666664444444 55555


No 85 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=83.37  E-value=0.58  Score=25.91  Aligned_cols=11  Identities=27%  Similarity=0.549  Sum_probs=6.5

Q ss_pred             ceeCcccCCcc
Q psy16828        348 SHLCFVCGAGF  358 (372)
Q Consensus       348 ~~~C~~C~~~f  358 (372)
                      ...|+.|+..|
T Consensus        25 ~v~C~~C~~~~   35 (38)
T TIGR02098        25 KVRCGKCGHVW   35 (38)
T ss_pred             EEECCCCCCEE
Confidence            35566666655


No 86 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.19  E-value=0.85  Score=32.27  Aligned_cols=29  Identities=31%  Similarity=0.739  Sum_probs=15.4

Q ss_pred             ccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC
Q psy16828        294 VCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD  334 (372)
Q Consensus       294 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  334 (372)
                      .|+.||..|...           +..| ..||.||..|.-.
T Consensus        11 ~Cp~CG~kFYDL-----------nk~P-ivCP~CG~~~~~~   39 (108)
T PF09538_consen   11 TCPSCGAKFYDL-----------NKDP-IVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCcchhccC-----------CCCC-ccCCCCCCccCcc
Confidence            466666666532           1123 5566666666443


No 87 
>KOG2186|consensus
Probab=82.76  E-value=1  Score=36.60  Aligned_cols=47  Identities=19%  Similarity=0.610  Sum_probs=39.0

Q ss_pred             CeecccccccccChhHHHHHHHhhccCceeecccccccccCchhHHHHHH
Q psy16828         82 PVECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHML  131 (372)
Q Consensus        82 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~  131 (372)
                      .|.|..|+....- ..+.+|+.+.++ .-|.|-.|+..|.. .++..|..
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            5889999998754 467789988887 67999999999975 88888864


No 88 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=82.58  E-value=1.2  Score=34.07  Aligned_cols=23  Identities=43%  Similarity=0.993  Sum_probs=16.0

Q ss_pred             cccccccccccCChHHHHHHHhhhcCCCCcccCccc
Q psy16828        264 RFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICG  299 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  299 (372)
                      .|.|++||+.             +.|+.|-+||+||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            5777777754             3456777787777


No 89 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=82.38  E-value=0.66  Score=37.69  Aligned_cols=25  Identities=36%  Similarity=0.676  Sum_probs=20.0

Q ss_pred             CCccccCcccccccchhHHhhhhhc
Q psy16828         19 YIKVECPVCGKVLSRKSKLVSHMRS   43 (372)
Q Consensus        19 ~~~~~C~~C~~~f~~~~~l~~H~~~   43 (372)
                      .+.+.||+|+..|.++.......+.
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~   27 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRV   27 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceE
Confidence            3678999999999998876666654


No 90 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=82.33  E-value=0.55  Score=38.15  Aligned_cols=17  Identities=24%  Similarity=0.337  Sum_probs=8.4

Q ss_pred             CceeCcccCCcccChhh
Q psy16828        347 KSHLCFVCGAGFVNDAG  363 (372)
Q Consensus       347 ~~~~C~~C~~~f~~~~~  363 (372)
                      +++.||.||+....-..
T Consensus       208 k~~PCPKCg~et~eTkd  224 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKD  224 (314)
T ss_pred             CCCCCCCCCCccccccc
Confidence            45555555555444333


No 91 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=82.31  E-value=0.89  Score=26.17  Aligned_cols=11  Identities=27%  Similarity=1.180  Sum_probs=5.3

Q ss_pred             cccCccccccc
Q psy16828        293 FVCNICGKDFK  303 (372)
Q Consensus       293 ~~C~~C~~~f~  303 (372)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            44555554443


No 92 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=81.74  E-value=1.3  Score=33.93  Aligned_cols=37  Identities=19%  Similarity=0.490  Sum_probs=26.0

Q ss_pred             hhhcCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcC
Q psy16828        285 ALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIF  331 (372)
Q Consensus       285 ~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  331 (372)
                      ....+..-|.|+.|+..|+.-.++..         . |.||.||...
T Consensus       102 ~~e~~~~~Y~Cp~c~~r~tf~eA~~~---------~-F~Cp~Cg~~L  138 (158)
T TIGR00373       102 EFETNNMFFICPNMCVRFTFNEAMEL---------N-FTCPRCGAML  138 (158)
T ss_pred             hhccCCCeEECCCCCcEeeHHHHHHc---------C-CcCCCCCCEe
Confidence            33445566888888888887777752         2 8888888653


No 93 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=81.44  E-value=0.87  Score=25.08  Aligned_cols=6  Identities=50%  Similarity=1.364  Sum_probs=2.3

Q ss_pred             ccCccc
Q psy16828        294 VCNICG  299 (372)
Q Consensus       294 ~C~~C~  299 (372)
                      +|+.|+
T Consensus        27 rC~~C~   32 (37)
T PF13719_consen   27 RCPKCG   32 (37)
T ss_pred             ECCCCC
Confidence            333333


No 94 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=81.06  E-value=0.33  Score=39.00  Aligned_cols=32  Identities=25%  Similarity=0.472  Sum_probs=25.7

Q ss_pred             CCCCCccccCcccccccchhHHhhhhhccCcC
Q psy16828         16 PSKYIKVECPVCGKVLSRKSKLVSHMRSFHTS   47 (372)
Q Consensus        16 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~   47 (372)
                      -....+|.|++|++.|.-..-+++|+...|.+
T Consensus        72 e~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   72 EEDEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSSSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             HHcCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            34667899999999999999999999998975


No 95 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=80.86  E-value=1.9  Score=21.05  Aligned_cols=10  Identities=30%  Similarity=0.587  Sum_probs=7.1

Q ss_pred             CceeCcccCC
Q psy16828        347 KSHLCFVCGA  356 (372)
Q Consensus       347 ~~~~C~~C~~  356 (372)
                      .+|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4678888874


No 96 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=79.59  E-value=1.2  Score=34.25  Aligned_cols=24  Identities=33%  Similarity=0.790  Sum_probs=17.4

Q ss_pred             CccCCCCCCcCCCCccccccccccCCCceeCcccCC
Q psy16828        321 TFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGA  356 (372)
Q Consensus       321 ~~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~  356 (372)
                      .|.|++||.++.            |+.|-.||+||-
T Consensus       134 ~~vC~vCGy~~~------------ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTHE------------GEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCccc------------CCCCCcCCCCCC
Confidence            388888877543            457888888884


No 97 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=79.36  E-value=0.39  Score=36.45  Aligned_cols=12  Identities=42%  Similarity=0.816  Sum_probs=6.3

Q ss_pred             cccCcccccccc
Q psy16828        293 FVCNICGKDFKL  304 (372)
Q Consensus       293 ~~C~~C~~~f~~  304 (372)
                      ++|+.||++|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            455555555544


No 98 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=79.26  E-value=2.2  Score=23.28  Aligned_cols=32  Identities=22%  Similarity=0.421  Sum_probs=14.4

Q ss_pred             cCCCCccccCChhhHHHHHhhhcCCCceeecCCCCCcc
Q psy16828        152 KCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGC  189 (372)
Q Consensus       152 ~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f  189 (372)
                      .|+.|+..|.-.++.      .-......+|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~------ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEK------IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHH------CCCCCcEEECCCCCCEe
Confidence            455555555433211      12333345555555544


No 99 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=79.02  E-value=1.6  Score=34.18  Aligned_cols=34  Identities=21%  Similarity=0.570  Sum_probs=24.0

Q ss_pred             cCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcC
Q psy16828        288 SDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIF  331 (372)
Q Consensus       288 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  331 (372)
                      .+..-|.|+.|+..|+.-.++..         . |.|+.||...
T Consensus       113 ~~~~~Y~Cp~C~~rytf~eA~~~---------~-F~Cp~Cg~~L  146 (178)
T PRK06266        113 ENNMFFFCPNCHIRFTFDEAMEY---------G-FRCPQCGEML  146 (178)
T ss_pred             cCCCEEECCCCCcEEeHHHHhhc---------C-CcCCCCCCCC
Confidence            34456888888888887766531         2 8888888654


No 100
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=78.90  E-value=0.61  Score=37.87  Aligned_cols=13  Identities=15%  Similarity=0.434  Sum_probs=7.8

Q ss_pred             ccccccccccccc
Q psy16828        237 YECYICNKILVSR  249 (372)
Q Consensus       237 ~~C~~C~~~f~~~  249 (372)
                      ..||.||.++...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            4577777666543


No 101
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=77.70  E-value=1.8  Score=26.82  Aligned_cols=40  Identities=23%  Similarity=0.692  Sum_probs=21.6

Q ss_pred             CCeeccc--ccccccChhHHHHHHHhhccCceeeccc----cccccc
Q psy16828         81 APVECSY--CGKVLSRKDKLTRHIAAVHSGKEYPCEQ----CDRKFT  121 (372)
Q Consensus        81 ~~~~C~~--C~~~~~~~~~l~~H~~~~h~~~~~~C~~----C~~~f~  121 (372)
                      .+..|+.  |...+ .+..|..|+...-...+..|+.    |...+.
T Consensus         8 ~~v~C~~~cc~~~i-~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMI-PRKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEE-ECCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             CEeeCCCCCcccce-eHHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            4566776  44434 3557777776555666777777    777664


No 102
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=77.64  E-value=1.9  Score=24.35  Aligned_cols=37  Identities=16%  Similarity=0.337  Sum_probs=24.3

Q ss_pred             cCCCCCCcCCCCccccccccccCCCceeCcccCCcccChhhHHH
Q psy16828        323 ECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKV  366 (372)
Q Consensus       323 ~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~  366 (372)
                      +||.|+.......+       .+.....|+.|+-.+.+..+|.+
T Consensus         1 ~CP~C~~~l~~~~~-------~~~~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen    1 KCPRCGTELEPVRL-------GDVEIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             CcCCCCcccceEEE-------CCEEEEECCCCCeEEccHHHHHH
Confidence            47777664332222       33456889999988888887764


No 103
>KOG2272|consensus
Probab=77.01  E-value=1.2  Score=36.00  Aligned_cols=15  Identities=20%  Similarity=0.594  Sum_probs=8.8

Q ss_pred             ceeCcccCCcccChh
Q psy16828        348 SHLCFVCGAGFVNDA  362 (372)
Q Consensus       348 ~~~C~~C~~~f~~~~  362 (372)
                      .|.|..|.+.|....
T Consensus       221 HFvCa~CekPFlGHr  235 (332)
T KOG2272|consen  221 HFVCAKCEKPFLGHR  235 (332)
T ss_pred             heeehhcCCcccchh
Confidence            366666666665543


No 104
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=76.89  E-value=2.2  Score=24.13  Aligned_cols=28  Identities=36%  Similarity=0.561  Sum_probs=23.9

Q ss_pred             CCCCCccccCcccccccchhHHhhhhhc
Q psy16828         16 PSKYIKVECPVCGKVLSRKSKLVSHMRS   43 (372)
Q Consensus        16 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~   43 (372)
                      +-+.-.|+|.+|..+...++.|-.||+-
T Consensus        15 ~gkp~~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   15 PGKPFKYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             CCCCccceeecCCcccchHHHHHHHHHH
Confidence            3455679999999999999999999974


No 105
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=75.76  E-value=1.9  Score=31.11  Aligned_cols=17  Identities=24%  Similarity=0.491  Sum_probs=9.6

Q ss_pred             CCCCcccCcccccccch
Q psy16828        289 DAKPFVCNICGKDFKLK  305 (372)
Q Consensus       289 ~~~~~~C~~C~~~f~~~  305 (372)
                      +..|..|+.||..|...
T Consensus        23 nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        23 NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCCCccCCCcCCccCcc
Confidence            34556666666665443


No 106
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=75.52  E-value=2.1  Score=24.19  Aligned_cols=22  Identities=27%  Similarity=0.406  Sum_probs=20.1

Q ss_pred             eeCcccCCcccChhhHHHHHhh
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRK  370 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~  370 (372)
                      |+|-.|.+....++.|..||+.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            7899999999999999999974


No 107
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=75.48  E-value=3.2  Score=31.48  Aligned_cols=39  Identities=15%  Similarity=0.410  Sum_probs=20.5

Q ss_pred             cCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcC
Q psy16828        288 SDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIF  331 (372)
Q Consensus       288 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  331 (372)
                      .+..-|.|+.|+..|+...++.. ..   .... |.||.|+...
T Consensus        95 ~~~~~Y~Cp~C~~~y~~~ea~~~-~d---~~~~-f~Cp~Cg~~l  133 (147)
T smart00531       95 TNNAYYKCPNCQSKYTFLEANQL-LD---MDGT-FTCPRCGEEL  133 (147)
T ss_pred             cCCcEEECcCCCCEeeHHHHHHh-cC---CCCc-EECCCCCCEE
Confidence            34455777777777764333322 01   1122 6777776543


No 108
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=75.10  E-value=1.1  Score=25.26  Aligned_cols=10  Identities=30%  Similarity=1.148  Sum_probs=5.3

Q ss_pred             ccCCCCCCcC
Q psy16828        322 FECDVCHQIF  331 (372)
Q Consensus       322 ~~C~~C~~~f  331 (372)
                      |+|+.|+..|
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            4555555544


No 109
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=75.09  E-value=2  Score=21.45  Aligned_cols=21  Identities=38%  Similarity=0.779  Sum_probs=17.1

Q ss_pred             cccCcccccccchhHHhhhhhc
Q psy16828         22 VECPVCGKVLSRKSKLVSHMRS   43 (372)
Q Consensus        22 ~~C~~C~~~f~~~~~l~~H~~~   43 (372)
                      ..||.|++.+ ....+..|+..
T Consensus         2 v~CPiC~~~v-~~~~in~HLD~   22 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLDS   22 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHHH
Confidence            4799999998 66788888763


No 110
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=74.72  E-value=2  Score=22.73  Aligned_cols=10  Identities=30%  Similarity=0.604  Sum_probs=5.1

Q ss_pred             ceeCcccCCc
Q psy16828        348 SHLCFVCGAG  357 (372)
Q Consensus       348 ~~~C~~C~~~  357 (372)
                      +-+|+.||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            3456666653


No 111
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=74.72  E-value=1.8  Score=25.44  Aligned_cols=10  Identities=30%  Similarity=1.192  Sum_probs=4.8

Q ss_pred             cccCcccccc
Q psy16828        293 FVCNICGKDF  302 (372)
Q Consensus       293 ~~C~~C~~~f  302 (372)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            4444444444


No 112
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=73.88  E-value=5.9  Score=33.34  Aligned_cols=80  Identities=21%  Similarity=0.395  Sum_probs=43.7

Q ss_pred             CCcccCcccccccchhhHHHHHhhhcCCCC-----C------ccCCCCCCcCCCCccccccccccCCCceeCcccCCccc
Q psy16828        291 KPFVCNICGKDFKLKYYVNLHMRTHTRIRP-----T------FECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFV  359 (372)
Q Consensus       291 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~-----~------~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~~f~  359 (372)
                      -|..|+.|+-.......|.+-..---..++     .      -.|-.|--.|+.......-.. +....|.|+.|...|-
T Consensus       321 LPi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~~~~~-~ss~rY~Ce~CK~~FC  399 (421)
T COG5151         321 LPISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSPFDES-TSSGRYQCELCKSTFC  399 (421)
T ss_pred             CCccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCCccccc-ccccceechhhhhhhh
Confidence            466788887666555444443211111111     0      236666666765522111111 1234588999988888


Q ss_pred             ChhhHHHHHhhc
Q psy16828        360 NDAGLKVHMRKH  371 (372)
Q Consensus       360 ~~~~l~~H~~~h  371 (372)
                      .--+...|..+|
T Consensus       400 ~dCdvfiHe~Lh  411 (421)
T COG5151         400 SDCDVFIHETLH  411 (421)
T ss_pred             hhhHHHHHHHHh
Confidence            777777776665


No 113
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=73.75  E-value=1.9  Score=24.85  Aligned_cols=29  Identities=34%  Similarity=0.647  Sum_probs=19.5

Q ss_pred             CCCCccccCcccccccch----hHHhhhhhccC
Q psy16828         17 SKYIKVECPVCGKVLSRK----SKLVSHMRSFH   45 (372)
Q Consensus        17 ~~~~~~~C~~C~~~f~~~----~~l~~H~~~~H   45 (372)
                      .+.....|..|++.+...    ..|..|++..|
T Consensus        12 ~~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   12 GDKKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             GCSS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CCcCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            356778999999988764    78999996655


No 114
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=73.54  E-value=4.1  Score=24.21  Aligned_cols=9  Identities=56%  Similarity=1.224  Sum_probs=6.6

Q ss_pred             ceeCcccCC
Q psy16828        348 SHLCFVCGA  356 (372)
Q Consensus       348 ~~~C~~C~~  356 (372)
                      .+.|++|+.
T Consensus        34 ~w~CP~C~a   42 (50)
T cd00730          34 DWVCPVCGA   42 (50)
T ss_pred             CCCCCCCCC
Confidence            477888874


No 115
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=73.19  E-value=2.7  Score=31.83  Aligned_cols=23  Identities=13%  Similarity=0.247  Sum_probs=16.8

Q ss_pred             CCCCCCccccCcccccccchhHH
Q psy16828         15 KPSKYIKVECPVCGKVLSRKSKL   37 (372)
Q Consensus        15 ~~~~~~~~~C~~C~~~f~~~~~l   37 (372)
                      .-.....|.|+.|+..|....++
T Consensus        93 ~e~~~~~Y~Cp~C~~~y~~~ea~  115 (147)
T smart00531       93 DETNNAYYKCPNCQSKYTFLEAN  115 (147)
T ss_pred             cccCCcEEECcCCCCEeeHHHHH
Confidence            34466789999999999854433


No 116
>PF12907 zf-met2:  Zinc-binding
Probab=72.19  E-value=1.8  Score=24.19  Aligned_cols=32  Identities=22%  Similarity=0.419  Sum_probs=24.0

Q ss_pred             cccCccccc---ccchhHHhhhhhccCcCCCCccC
Q psy16828         22 VECPVCGKV---LSRKSKLVSHMRSFHTSVTPEAG   53 (372)
Q Consensus        22 ~~C~~C~~~---f~~~~~l~~H~~~~H~~~~~~~~   53 (372)
                      +.|.+|-.+   ..+...|..|....|+...+..|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~C   36 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTFEEC   36 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHc
Confidence            679999954   45567899999998987544443


No 117
>KOG2807|consensus
Probab=72.19  E-value=10  Score=32.35  Aligned_cols=23  Identities=30%  Similarity=0.699  Sum_probs=13.8

Q ss_pred             CcccccchhhhcChhhhHhhhhh
Q psy16828        207 PYHCKYCDKTFTKRMNVKTHERM  229 (372)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~  229 (372)
                      .|.|..|...|-..-+.-.|...
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesL  367 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESL  367 (378)
T ss_pred             cEEchhccceeeccchHHHHhhh
Confidence            46666666666666555555544


No 118
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=72.15  E-value=1.3  Score=26.51  Aligned_cols=11  Identities=36%  Similarity=1.238  Sum_probs=6.4

Q ss_pred             cccCccccccc
Q psy16828        293 FVCNICGKDFK  303 (372)
Q Consensus       293 ~~C~~C~~~f~  303 (372)
                      |+|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            55666665554


No 119
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=71.71  E-value=3.5  Score=34.62  Aligned_cols=90  Identities=12%  Similarity=0.119  Sum_probs=42.2

Q ss_pred             eeecccccccccCchhHHHHHHhhcccCCCCccccccccCcccCCCCccccCChhhHHHHHhhhcCCCceeecCCCCCcc
Q psy16828        110 EYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGC  189 (372)
Q Consensus       110 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f  189 (372)
                      |..|+.|+........|.+-...--+.++........+.+.-.|-.|.-.|....   .|.--.-.....|+|+.|...|
T Consensus       322 Pi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~---~~~~~~~~ss~rY~Ce~CK~~F  398 (421)
T COG5151         322 PISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPP---VSPFDESTSSGRYQCELCKSTF  398 (421)
T ss_pred             CccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCC---CCcccccccccceechhhhhhh
Confidence            6777777766554444444322211222211111122233344666666665432   1111112223456777777666


Q ss_pred             cChHHHHHHHHHh
Q psy16828        190 YTNRELEEHQILT  202 (372)
Q Consensus       190 ~~~~~l~~H~~~~  202 (372)
                      -..-+.-.|...|
T Consensus       399 C~dCdvfiHe~Lh  411 (421)
T COG5151         399 CSDCDVFIHETLH  411 (421)
T ss_pred             hhhhHHHHHHHHh
Confidence            6666655565444


No 120
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=71.29  E-value=3.5  Score=19.90  Aligned_cols=7  Identities=43%  Similarity=1.075  Sum_probs=4.9

Q ss_pred             CcccCCc
Q psy16828        351 CFVCGAG  357 (372)
Q Consensus       351 C~~C~~~  357 (372)
                      |+.||..
T Consensus        16 C~~CG~~   22 (23)
T PF13240_consen   16 CPNCGTP   22 (23)
T ss_pred             hhhhCCc
Confidence            7777764


No 121
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=71.23  E-value=3.1  Score=30.05  Aligned_cols=29  Identities=24%  Similarity=0.415  Sum_probs=16.1

Q ss_pred             ccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC
Q psy16828        294 VCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD  334 (372)
Q Consensus       294 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  334 (372)
                      .|+.||..|...           +..| ..|+.||..|...
T Consensus        11 ~Cp~cg~kFYDL-----------nk~p-~vcP~cg~~~~~~   39 (129)
T TIGR02300        11 ICPNTGSKFYDL-----------NRRP-AVSPYTGEQFPPE   39 (129)
T ss_pred             cCCCcCcccccc-----------CCCC-ccCCCcCCccCcc
Confidence            567777666531           1123 6677776666443


No 122
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=70.59  E-value=2.2  Score=24.27  Aligned_cols=11  Identities=27%  Similarity=0.996  Sum_probs=6.0

Q ss_pred             ccCCCCCCcCC
Q psy16828        322 FECDVCHQIFP  332 (372)
Q Consensus       322 ~~C~~C~~~f~  332 (372)
                      |+|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            55555555543


No 123
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=68.04  E-value=3.4  Score=24.18  Aligned_cols=10  Identities=50%  Similarity=1.049  Sum_probs=5.4

Q ss_pred             ceeCcccCCc
Q psy16828        348 SHLCFVCGAG  357 (372)
Q Consensus       348 ~~~C~~C~~~  357 (372)
                      .+.|++|+..
T Consensus        34 ~w~CP~C~a~   43 (47)
T PF00301_consen   34 DWVCPVCGAP   43 (47)
T ss_dssp             T-B-TTTSSB
T ss_pred             CCcCcCCCCc
Confidence            4778888753


No 124
>PF14353 CpXC:  CpXC protein
Probab=67.26  E-value=1.9  Score=31.83  Aligned_cols=10  Identities=40%  Similarity=0.949  Sum_probs=4.9

Q ss_pred             eeCcccCCcc
Q psy16828        349 HLCFVCGAGF  358 (372)
Q Consensus       349 ~~C~~C~~~f  358 (372)
                      |.|+.||..|
T Consensus        39 ~~CP~Cg~~~   48 (128)
T PF14353_consen   39 FTCPSCGHKF   48 (128)
T ss_pred             EECCCCCCce
Confidence            4455555444


No 125
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=66.32  E-value=4.4  Score=24.01  Aligned_cols=24  Identities=33%  Similarity=0.713  Sum_probs=17.7

Q ss_pred             ceeCcccCCcccCh-----hhHHHHHh-hc
Q psy16828        348 SHLCFVCGAGFVND-----AGLKVHMR-KH  371 (372)
Q Consensus       348 ~~~C~~C~~~f~~~-----~~l~~H~~-~h  371 (372)
                      --.|.+|++.+...     +.|.+|++ .|
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            35688888887665     47999988 44


No 126
>KOG2186|consensus
Probab=64.41  E-value=2.4  Score=34.50  Aligned_cols=45  Identities=29%  Similarity=0.623  Sum_probs=22.0

Q ss_pred             ccccccccccCChHHHHHHHhhhcCCCCcccCcccccccchhhHHHHH
Q psy16828        265 FECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHM  312 (372)
Q Consensus       265 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  312 (372)
                      |.|..||.+.. ...+..|+..-.| .-|.|..|+..|.. ..+..|.
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhh
Confidence            45555554443 2234445554444 34555555555544 4455553


No 127
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=63.08  E-value=6.6  Score=23.78  Aligned_cols=30  Identities=30%  Similarity=0.504  Sum_probs=16.1

Q ss_pred             ccCCCCCCcCCCCccccccccccCCCceeCcccCCcc
Q psy16828        322 FECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGF  358 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~~f  358 (372)
                      |+|+.|+..+.-....      .|+ ...|+.||..+
T Consensus         3 ~~CP~CG~~iev~~~~------~Ge-iV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPE------LGE-LVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCc------cCC-EEeCCCCCCEE
Confidence            6777777765332111      022 34677777654


No 128
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=62.98  E-value=6  Score=27.51  Aligned_cols=27  Identities=19%  Similarity=0.215  Sum_probs=17.7

Q ss_pred             cccccccccCChHHHHHHHhhhcCCCCcccCccccccc
Q psy16828        266 ECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFK  303 (372)
Q Consensus       266 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  303 (372)
                      .|+.|++.|..           .+..|..|++||++|+
T Consensus        11 idPetg~KFYD-----------LNrdPiVsPytG~s~P   37 (129)
T COG4530          11 IDPETGKKFYD-----------LNRDPIVSPYTGKSYP   37 (129)
T ss_pred             cCccccchhhc-----------cCCCccccCcccccch
Confidence            46666666643           4557777778887773


No 129
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=62.81  E-value=7  Score=30.05  Aligned_cols=17  Identities=12%  Similarity=0.147  Sum_probs=7.6

Q ss_pred             cccccccccccCChHHH
Q psy16828        264 RFECKLCHKTIVSEKTF  280 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l  280 (372)
                      -|.|+.|+..|+....+
T Consensus       109 ~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAM  125 (158)
T ss_pred             eEECCCCCcEeeHHHHH
Confidence            34454444444443333


No 130
>PRK04023 DNA polymerase II large subunit; Validated
Probab=60.93  E-value=8.8  Score=38.31  Aligned_cols=12  Identities=25%  Similarity=0.462  Sum_probs=7.5

Q ss_pred             ceeCcccCCccc
Q psy16828        348 SHLCFVCGAGFV  359 (372)
Q Consensus       348 ~~~C~~C~~~f~  359 (372)
                      ++.|+.||..-.
T Consensus       663 ~y~CPKCG~El~  674 (1121)
T PRK04023        663 EDECEKCGREPT  674 (1121)
T ss_pred             CCcCCCCCCCCC
Confidence            366777776543


No 131
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=60.87  E-value=7.6  Score=19.29  Aligned_cols=9  Identities=22%  Similarity=0.501  Sum_probs=6.0

Q ss_pred             ccCCCCCCc
Q psy16828        322 FECDVCHQI  330 (372)
Q Consensus       322 ~~C~~C~~~  330 (372)
                      ..|+.|+..
T Consensus         3 ~~Cp~Cg~~   11 (26)
T PF13248_consen    3 MFCPNCGAE   11 (26)
T ss_pred             CCCcccCCc
Confidence            457777774


No 132
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=60.38  E-value=16  Score=31.56  Aligned_cols=21  Identities=33%  Similarity=0.700  Sum_probs=13.7

Q ss_pred             CeecccccccccChhHHHHHH
Q psy16828         82 PVECSYCGKVLSRKDKLTRHI  102 (372)
Q Consensus        82 ~~~C~~C~~~~~~~~~l~~H~  102 (372)
                      .+.|..|++-|....-+..|+
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl  258 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHL  258 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHH
Confidence            456777777776666666665


No 133
>KOG2593|consensus
Probab=59.44  E-value=7.7  Score=34.56  Aligned_cols=43  Identities=19%  Similarity=0.407  Sum_probs=28.6

Q ss_pred             hhhcCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcC
Q psy16828        285 ALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIF  331 (372)
Q Consensus       285 ~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  331 (372)
                      +.-++.+.|.|+.|++.|++..++.-=    ......|.|..|+-..
T Consensus       121 ~d~t~~~~Y~Cp~C~kkyt~Lea~~L~----~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  121 RDDTNVAGYVCPNCQKKYTSLEALQLL----DNETGEFHCENCGGEL  163 (436)
T ss_pred             hhccccccccCCccccchhhhHHHHhh----cccCceEEEecCCCch
Confidence            344566779999999999876665432    2222348899987543


No 134
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=59.13  E-value=5.9  Score=26.44  Aligned_cols=7  Identities=29%  Similarity=1.113  Sum_probs=3.1

Q ss_pred             cccccch
Q psy16828        208 YHCKYCD  214 (372)
Q Consensus       208 ~~C~~C~  214 (372)
                      |.|+.|+
T Consensus        36 ~~Cp~C~   42 (89)
T COG1997          36 HVCPFCG   42 (89)
T ss_pred             CcCCCCC
Confidence            4444444


No 135
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=58.67  E-value=5  Score=29.60  Aligned_cols=26  Identities=38%  Similarity=0.791  Sum_probs=15.1

Q ss_pred             CCcccCcccccccchhhHHHHHhhhcCCC
Q psy16828        291 KPFVCNICGKDFKLKYYVNLHMRTHTRIR  319 (372)
Q Consensus       291 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  319 (372)
                      .-..|-.||+.|..   |.+|+..|++..
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-S-
T ss_pred             CeeEEccCCcccch---HHHHHHHccCCC
Confidence            33678888888765   588888887654


No 136
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=58.38  E-value=24  Score=20.38  Aligned_cols=11  Identities=18%  Similarity=0.398  Sum_probs=7.3

Q ss_pred             CCceeCcccCC
Q psy16828        346 EKSHLCFVCGA  356 (372)
Q Consensus       346 ~~~~~C~~C~~  356 (372)
                      ...|+|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            45677777764


No 137
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=58.12  E-value=6.5  Score=38.29  Aligned_cols=19  Identities=21%  Similarity=0.333  Sum_probs=12.4

Q ss_pred             ccccccCCCceeCcccCCc
Q psy16828        339 HMLVHDVEKSHLCFVCGAG  357 (372)
Q Consensus       339 h~~~h~~~~~~~C~~C~~~  357 (372)
                      |.--+....|..|+.||-.
T Consensus       466 H~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         466 HYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCCCCCCCC
Confidence            3334445578889999854


No 138
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=57.80  E-value=5.3  Score=21.46  Aligned_cols=17  Identities=24%  Similarity=0.553  Sum_probs=9.1

Q ss_pred             ccCCCCCCcCCCCcccc
Q psy16828        322 FECDVCHQIFPTDFRTK  338 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~  338 (372)
                      -.|..|++.|..+.|..
T Consensus         4 ~~C~eC~~~f~dSyL~~   20 (34)
T PF01286_consen    4 PKCDECGKPFMDSYLLN   20 (34)
T ss_dssp             EE-TTT--EES-SSCCC
T ss_pred             chHhHhCCHHHHHHHHH
Confidence            46888888888876653


No 139
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=57.61  E-value=7.9  Score=30.42  Aligned_cols=15  Identities=13%  Similarity=0.208  Sum_probs=7.3

Q ss_pred             Ccccccccccccccc
Q psy16828        236 PYECYICNKILVSRG  250 (372)
Q Consensus       236 ~~~C~~C~~~f~~~~  250 (372)
                      -|.|+.|+..|....
T Consensus       117 ~Y~Cp~C~~rytf~e  131 (178)
T PRK06266        117 FFFCPNCHIRFTFDE  131 (178)
T ss_pred             EEECCCCCcEEeHHH
Confidence            355555555544433


No 140
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=57.25  E-value=7.4  Score=37.92  Aligned_cols=28  Identities=25%  Similarity=0.581  Sum_probs=16.4

Q ss_pred             hcCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCc
Q psy16828        287 HSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQI  330 (372)
Q Consensus       287 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  330 (372)
                      |...+...|.+||+.-.               .| ..|+.|+..
T Consensus       457 H~~~~~L~CH~Cg~~~~---------------~p-~~Cp~Cgs~  484 (730)
T COG1198         457 HKATGQLRCHYCGYQEP---------------IP-QSCPECGSE  484 (730)
T ss_pred             ecCCCeeEeCCCCCCCC---------------CC-CCCCCCCCC
Confidence            33445567777775422               23 778888643


No 141
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=57.10  E-value=7  Score=31.61  Aligned_cols=26  Identities=23%  Similarity=0.383  Sum_probs=20.8

Q ss_pred             CCCceeCcccCCcccChhhHHHHHhh
Q psy16828        345 VEKSHLCFVCGAGFVNDAGLKVHMRK  370 (372)
Q Consensus       345 ~~~~~~C~~C~~~f~~~~~l~~H~~~  370 (372)
                      ++..|.|+.|++.|....-.++|+..
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhh
Confidence            45569999999999999999999985


No 142
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=56.33  E-value=2.5  Score=27.29  Aligned_cols=7  Identities=29%  Similarity=0.648  Sum_probs=3.0

Q ss_pred             ccccccc
Q psy16828        297 ICGKDFK  303 (372)
Q Consensus       297 ~C~~~f~  303 (372)
                      .||.+|.
T Consensus        34 eCg~tF~   40 (72)
T PRK09678         34 NCSATFI   40 (72)
T ss_pred             CCCCEEE
Confidence            4444443


No 143
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=56.26  E-value=4.3  Score=21.10  Aligned_cols=6  Identities=33%  Similarity=1.137  Sum_probs=2.4

Q ss_pred             ccCCCC
Q psy16828        322 FECDVC  327 (372)
Q Consensus       322 ~~C~~C  327 (372)
                      |.|+.|
T Consensus        20 ~vCp~C   25 (30)
T PF08274_consen   20 LVCPEC   25 (30)
T ss_dssp             EEETTT
T ss_pred             EeCCcc
Confidence            334433


No 144
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.09  E-value=5.8  Score=24.25  Aligned_cols=37  Identities=22%  Similarity=0.408  Sum_probs=19.8

Q ss_pred             ccCcccc-cccchhhHHHHHhhhcCCCCCccCCCCCCcC
Q psy16828        294 VCNICGK-DFKLKYYVNLHMRTHTRIRPTFECDVCHQIF  331 (372)
Q Consensus       294 ~C~~C~~-~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  331 (372)
                      +|.+|++ .|-+...+..-+......+. |.|+.|.-..
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrt-ymC~eC~~Rv   41 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRT-YMCPECEHRV   41 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCcee-EechhhHhhh
Confidence            5666665 33344444444444445554 7777775444


No 145
>KOG1280|consensus
Probab=54.84  E-value=12  Score=32.14  Aligned_cols=35  Identities=20%  Similarity=0.349  Sum_probs=29.2

Q ss_pred             CCCCCCccccCcccccccchhHHhhhhhccCcCCC
Q psy16828         15 KPSKYIKVECPVCGKVLSRKSKLVSHMRSFHTSVT   49 (372)
Q Consensus        15 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~   49 (372)
                      .+.....|.|+.|++.-.+...|..|+...|.+..
T Consensus        73 ~~y~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~  107 (381)
T KOG1280|consen   73 SHYDPQSFTCPYCGIMGFTERQFGTHVLSQHPEAS  107 (381)
T ss_pred             cccccccccCCcccccccchhHHHHHhhhcCcccC
Confidence            34455689999999999999999999999897643


No 146
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=53.71  E-value=14  Score=21.91  Aligned_cols=10  Identities=30%  Similarity=0.547  Sum_probs=5.1

Q ss_pred             ccCCCCCCcC
Q psy16828        322 FECDVCHQIF  331 (372)
Q Consensus       322 ~~C~~C~~~f  331 (372)
                      +.|+.|+..+
T Consensus        21 ~vC~~Cg~~~   30 (52)
T smart00661       21 FVCRKCGYEE   30 (52)
T ss_pred             EECCcCCCeE
Confidence            4555555444


No 147
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=52.82  E-value=5.1  Score=20.39  Aligned_cols=20  Identities=25%  Similarity=0.424  Sum_probs=13.9

Q ss_pred             cccCcccccccchhHHhhhhh
Q psy16828         22 VECPVCGKVLSRKSKLVSHMR   42 (372)
Q Consensus        22 ~~C~~C~~~f~~~~~l~~H~~   42 (372)
                      |.|-.|++.| ....++.|..
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT---
T ss_pred             CeeecCCCCc-CcCCcCCCCc
Confidence            5799999999 6666777765


No 148
>KOG0717|consensus
Probab=52.25  E-value=5.6  Score=35.69  Aligned_cols=20  Identities=25%  Similarity=0.590  Sum_probs=17.3

Q ss_pred             eecccccccccChhHHHHHH
Q psy16828         83 VECSYCGKVLSRKDKLTRHI  102 (372)
Q Consensus        83 ~~C~~C~~~~~~~~~l~~H~  102 (372)
                      +.|.+|+++|.+...|.-|-
T Consensus       293 lyC~vCnKsFKseKq~kNHE  312 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHE  312 (508)
T ss_pred             eEEeeccccccchHHHHhhH
Confidence            78999999999998888875


No 149
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=51.23  E-value=11  Score=35.45  Aligned_cols=13  Identities=23%  Similarity=0.598  Sum_probs=6.3

Q ss_pred             CCCcccCcccccc
Q psy16828        290 AKPFVCNICGKDF  302 (372)
Q Consensus       290 ~~~~~C~~C~~~f  302 (372)
                      .+...|.+||+..
T Consensus       238 ~~~l~Ch~Cg~~~  250 (505)
T TIGR00595       238 EGKLRCHYCGYQE  250 (505)
T ss_pred             CCeEEcCCCcCcC
Confidence            3444555555443


No 150
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=50.96  E-value=16  Score=31.55  Aligned_cols=15  Identities=13%  Similarity=0.769  Sum_probs=8.7

Q ss_pred             cCCCCcccCcccccc
Q psy16828        288 SDAKPFVCNICGKDF  302 (372)
Q Consensus       288 ~~~~~~~C~~C~~~f  302 (372)
                      .|.+-..|..|+-..
T Consensus       206 ~G~RyL~CslC~teW  220 (305)
T TIGR01562       206 TGLRYLSCSLCATEW  220 (305)
T ss_pred             CCceEEEcCCCCCcc
Confidence            344555677777543


No 151
>KOG2272|consensus
Probab=50.94  E-value=10  Score=30.89  Aligned_cols=19  Identities=21%  Similarity=0.422  Sum_probs=10.2

Q ss_pred             CccccCcccccccchhHHh
Q psy16828         20 IKVECPVCGKVLSRKSKLV   38 (372)
Q Consensus        20 ~~~~C~~C~~~f~~~~~l~   38 (372)
                      .=|.|++|++...+...++
T Consensus        98 ~CF~Cd~Cn~~Lad~gf~r  116 (332)
T KOG2272|consen   98 ACFRCDLCNKHLADQGFYR  116 (332)
T ss_pred             ccchhHHHHHHHhhhhhHh
Confidence            3455666665555555444


No 152
>PRK04023 DNA polymerase II large subunit; Validated
Probab=50.35  E-value=15  Score=36.73  Aligned_cols=9  Identities=33%  Similarity=0.682  Sum_probs=5.6

Q ss_pred             ccccccccc
Q psy16828        237 YECYICNKI  245 (372)
Q Consensus       237 ~~C~~C~~~  245 (372)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            456666655


No 153
>KOG1701|consensus
Probab=50.14  E-value=6.2  Score=34.96  Aligned_cols=40  Identities=13%  Similarity=0.294  Sum_probs=23.7

Q ss_pred             ecCCCCCcccChHHHHHHHHHhcCCCCcccccchhhhcCh
Q psy16828        181 LCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKR  220 (372)
Q Consensus       181 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~  220 (372)
                      .|..|++...-...--.-|..--...-|+|..|++...-.
T Consensus       276 iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq  315 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQ  315 (468)
T ss_pred             hhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccc
Confidence            6888887765554444444333334557788887765443


No 154
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=48.69  E-value=12  Score=25.10  Aligned_cols=14  Identities=36%  Similarity=0.937  Sum_probs=10.3

Q ss_pred             CCcccCcccccccc
Q psy16828        291 KPFVCNICGKDFKL  304 (372)
Q Consensus       291 ~~~~C~~C~~~f~~  304 (372)
                      .|-.|..||+.|.+
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            45678888888864


No 155
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=48.68  E-value=14  Score=21.96  Aligned_cols=12  Identities=25%  Similarity=0.365  Sum_probs=7.4

Q ss_pred             CceeCcccCCcc
Q psy16828        347 KSHLCFVCGAGF  358 (372)
Q Consensus       347 ~~~~C~~C~~~f  358 (372)
                      ..+.|+.||+.+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            456677777654


No 156
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=48.17  E-value=30  Score=28.38  Aligned_cols=13  Identities=23%  Similarity=0.506  Sum_probs=6.8

Q ss_pred             ceeCcccCCcccC
Q psy16828        348 SHLCFVCGAGFVN  360 (372)
Q Consensus       348 ~~~C~~C~~~f~~  360 (372)
                      .|.|+.|+..|..
T Consensus       155 ef~C~~C~h~F~G  167 (278)
T PF15135_consen  155 EFHCPKCRHNFRG  167 (278)
T ss_pred             eeecccccccchh
Confidence            3555555555543


No 157
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=48.17  E-value=23  Score=36.59  Aligned_cols=53  Identities=23%  Similarity=0.489  Sum_probs=32.2

Q ss_pred             ccccccccccCChHHHHHHHhhhcCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCCcccccccccc
Q psy16828        265 FECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHD  344 (372)
Q Consensus       265 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~l~~h~~~h~  344 (372)
                      ++|+.|+....                ...|+.||...                .+.|.|+.|+.......        +
T Consensus       668 rkCPkCG~~t~----------------~~fCP~CGs~t----------------e~vy~CPsCGaev~~de--------s  707 (1337)
T PRK14714        668 RRCPSCGTETY----------------ENRCPDCGTHT----------------EPVYVCPDCGAEVPPDE--------S  707 (1337)
T ss_pred             EECCCCCCccc----------------cccCcccCCcC----------------CCceeCccCCCccCCCc--------c
Confidence            67888885321                12688888654                22388999987654321        1


Q ss_pred             CCCceeCcccCCccc
Q psy16828        345 VEKSHLCFVCGAGFV  359 (372)
Q Consensus       345 ~~~~~~C~~C~~~f~  359 (372)
                      +  ...|+.||....
T Consensus       708 ~--a~~CP~CGtplv  720 (1337)
T PRK14714        708 G--RVECPRCDVELT  720 (1337)
T ss_pred             c--cccCCCCCCccc
Confidence            1  345999986544


No 158
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=48.13  E-value=14  Score=31.93  Aligned_cols=15  Identities=20%  Similarity=0.753  Sum_probs=8.2

Q ss_pred             cCCCCcccCcccccc
Q psy16828        288 SDAKPFVCNICGKDF  302 (372)
Q Consensus       288 ~~~~~~~C~~C~~~f  302 (372)
                      .|.+-..|..|+-..
T Consensus       208 ~G~RyL~CslC~teW  222 (309)
T PRK03564        208 QGLRYLHCNLCESEW  222 (309)
T ss_pred             CCceEEEcCCCCCcc
Confidence            344445666666443


No 159
>KOG3408|consensus
Probab=47.57  E-value=11  Score=27.00  Aligned_cols=25  Identities=24%  Similarity=0.445  Sum_probs=20.5

Q ss_pred             CCCcccCcccccccchhhHHHHHhh
Q psy16828        290 AKPFVCNICGKDFKLKYYVNLHMRT  314 (372)
Q Consensus       290 ~~~~~C~~C~~~f~~~~~l~~H~~~  314 (372)
                      ...|.|..|.+-|.+...|..|.++
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhc
Confidence            3447899999999999999999766


No 160
>KOG3408|consensus
Probab=47.21  E-value=9.8  Score=27.18  Aligned_cols=26  Identities=15%  Similarity=0.318  Sum_probs=24.0

Q ss_pred             CCCccccCcccccccchhHHhhhhhc
Q psy16828         18 KYIKVECPVCGKVLSRKSKLVSHMRS   43 (372)
Q Consensus        18 ~~~~~~C~~C~~~f~~~~~l~~H~~~   43 (372)
                      |...|.|-.|.+.|.+...|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            67789999999999999999999985


No 161
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=45.08  E-value=14  Score=22.32  Aligned_cols=9  Identities=56%  Similarity=1.508  Sum_probs=4.3

Q ss_pred             ccCcccccc
Q psy16828        294 VCNICGKDF  302 (372)
Q Consensus       294 ~C~~C~~~f  302 (372)
                      .|..|+..|
T Consensus         7 ~C~~Cg~~~   15 (54)
T PF14446_consen    7 KCPVCGKKF   15 (54)
T ss_pred             cChhhCCcc
Confidence            344455444


No 163
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=44.67  E-value=8.9  Score=23.30  Aligned_cols=7  Identities=43%  Similarity=1.402  Sum_probs=3.7

Q ss_pred             ccCCCCC
Q psy16828        322 FECDVCH  328 (372)
Q Consensus       322 ~~C~~C~  328 (372)
                      |.|+.|.
T Consensus        32 YmC~eC~   38 (56)
T PF09963_consen   32 YMCDECK   38 (56)
T ss_pred             eeChhHH
Confidence            5555554


No 164
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=43.98  E-value=12  Score=27.32  Aligned_cols=12  Identities=50%  Similarity=1.032  Sum_probs=5.6

Q ss_pred             CCcccccccccc
Q psy16828        235 KPYECYICNKIL  246 (372)
Q Consensus       235 ~~~~C~~C~~~f  246 (372)
                      +-|.|.+|..+.
T Consensus        79 ~lYeCnIC~etS   90 (140)
T PF05290_consen   79 KLYECNICKETS   90 (140)
T ss_pred             CceeccCccccc
Confidence            445555554443


No 165
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=43.40  E-value=24  Score=36.49  Aligned_cols=12  Identities=33%  Similarity=0.927  Sum_probs=8.0

Q ss_pred             CcccCccccccc
Q psy16828        292 PFVCNICGKDFK  303 (372)
Q Consensus       292 ~~~C~~C~~~f~  303 (372)
                      +|.|+.||....
T Consensus       692 vy~CPsCGaev~  703 (1337)
T PRK14714        692 VYVCPDCGAEVP  703 (1337)
T ss_pred             ceeCccCCCccC
Confidence            467777777543


No 166
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=43.23  E-value=11  Score=20.50  Aligned_cols=8  Identities=25%  Similarity=1.148  Sum_probs=4.0

Q ss_pred             cccchhhh
Q psy16828        210 CKYCDKTF  217 (372)
Q Consensus       210 C~~C~~~f  217 (372)
                      |+.||..|
T Consensus         4 C~~Cg~~Y   11 (36)
T PF05191_consen    4 CPKCGRIY   11 (36)
T ss_dssp             ETTTTEEE
T ss_pred             cCCCCCcc
Confidence            45555544


No 167
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=43.16  E-value=21  Score=21.64  Aligned_cols=14  Identities=21%  Similarity=0.259  Sum_probs=9.0

Q ss_pred             CceeCcccCCcccC
Q psy16828        347 KSHLCFVCGAGFVN  360 (372)
Q Consensus       347 ~~~~C~~C~~~f~~  360 (372)
                      ..|.|+.||..+.-
T Consensus        13 v~~~Cp~cGipthc   26 (55)
T PF13824_consen   13 VNFECPDCGIPTHC   26 (55)
T ss_pred             cCCcCCCCCCcCcc
Confidence            45777777776543


No 168
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=42.86  E-value=11  Score=22.25  Aligned_cols=10  Identities=30%  Similarity=0.906  Sum_probs=4.4

Q ss_pred             eecCCCCCcc
Q psy16828        180 VLCTQCGFGC  189 (372)
Q Consensus       180 ~~C~~C~~~f  189 (372)
                      +.|..|+..|
T Consensus         5 l~C~dCg~~F   14 (49)
T PF13451_consen    5 LTCKDCGAEF   14 (49)
T ss_pred             EEcccCCCeE
Confidence            4444444443


No 169
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=42.85  E-value=22  Score=20.07  Aligned_cols=11  Identities=36%  Similarity=0.927  Sum_probs=6.3

Q ss_pred             eeccccccccc
Q psy16828         83 VECSYCGKVLS   93 (372)
Q Consensus        83 ~~C~~C~~~~~   93 (372)
                      ..|+.|+..|.
T Consensus        14 ~~C~~CgM~Y~   24 (41)
T PF13878_consen   14 TTCPTCGMLYS   24 (41)
T ss_pred             cCCCCCCCEEC
Confidence            45666666554


No 170
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=42.63  E-value=26  Score=19.16  Aligned_cols=30  Identities=17%  Similarity=0.281  Sum_probs=19.4

Q ss_pred             ccCCCCCCcCCCCccccccccccCCCceeCccc
Q psy16828        322 FECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVC  354 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C  354 (372)
                      ..||.|...   ..+.+|-+...|...|.|..|
T Consensus         6 v~CP~C~s~---~~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQST---EGVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCC---CcceeCCCCCCCCEeEecCcC
Confidence            567777532   124566666677777888877


No 171
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=42.30  E-value=26  Score=18.74  Aligned_cols=24  Identities=17%  Similarity=0.346  Sum_probs=16.0

Q ss_pred             cccCcccccccchhhHHHHHhhhcC
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRTHTR  317 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~h~~  317 (372)
                      +.|+.|++.+ ..+.+..|+....+
T Consensus         5 ~~C~nC~R~v-~a~RfA~HLekCmg   28 (33)
T PF08209_consen    5 VECPNCGRPV-AASRFAPHLEKCMG   28 (33)
T ss_dssp             EE-TTTSSEE-EGGGHHHHHHHHTC
T ss_pred             EECCCCcCCc-chhhhHHHHHHHHc
Confidence            5788888876 46677788766543


No 172
>KOG2807|consensus
Probab=42.11  E-value=29  Score=29.79  Aligned_cols=23  Identities=26%  Similarity=0.466  Sum_probs=11.7

Q ss_pred             CcccCcccccccchhhHHHHHhh
Q psy16828        292 PFVCNICGKDFKLKYYVNLHMRT  314 (372)
Q Consensus       292 ~~~C~~C~~~f~~~~~l~~H~~~  314 (372)
                      .|.|+.|.-.|-.--....|...
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesL  367 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESL  367 (378)
T ss_pred             cEEchhccceeeccchHHHHhhh
Confidence            35556565555544444445333


No 173
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=41.60  E-value=19  Score=19.93  Aligned_cols=23  Identities=30%  Similarity=0.395  Sum_probs=10.0

Q ss_pred             CccccCcccccc-cch-hHHhhhhh
Q psy16828         20 IKVECPVCGKVL-SRK-SKLVSHMR   42 (372)
Q Consensus        20 ~~~~C~~C~~~f-~~~-~~l~~H~~   42 (372)
                      +.|.|+.|+..| ... ..-+.|..
T Consensus         2 ~ryyCdyC~~~~~~d~~~~Rk~H~~   26 (38)
T PF06220_consen    2 PRYYCDYCKKYLTHDSPSIRKQHER   26 (38)
T ss_dssp             -S-B-TTT--B-S--SHHHHHHHT-
T ss_pred             cCeecccccceecCCChHHHHHhhc
Confidence            468999999999 333 44467765


No 174
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=41.57  E-value=25  Score=26.04  Aligned_cols=26  Identities=27%  Similarity=0.460  Sum_probs=14.5

Q ss_pred             CCCeecccccccccChhHHHHHHHhhccC
Q psy16828         80 RAPVECSYCGKVLSRKDKLTRHIAAVHSG  108 (372)
Q Consensus        80 ~~~~~C~~C~~~~~~~~~l~~H~~~~h~~  108 (372)
                      .....|-+||+.|.+.   .+|+..+|+.
T Consensus        70 ~d~i~clecGk~~k~L---krHL~~~~gl   95 (132)
T PF05443_consen   70 PDYIICLECGKKFKTL---KRHLRTHHGL   95 (132)
T ss_dssp             SS-EE-TBT--EESBH---HHHHHHTT-S
T ss_pred             cCeeEEccCCcccchH---HHHHHHccCC
Confidence            3457788888888554   7888777654


No 175
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=41.51  E-value=25  Score=18.86  Aligned_cols=11  Identities=27%  Similarity=0.594  Sum_probs=7.5

Q ss_pred             eeCcccCCccc
Q psy16828        349 HLCFVCGAGFV  359 (372)
Q Consensus       349 ~~C~~C~~~f~  359 (372)
                      |.|..|+..+.
T Consensus        28 f~C~~C~~~L~   38 (39)
T smart00132       28 FKCSKCGKPLG   38 (39)
T ss_pred             CCCcccCCcCc
Confidence            67777776653


No 176
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=40.97  E-value=20  Score=20.32  Aligned_cols=12  Identities=25%  Similarity=0.559  Sum_probs=6.3

Q ss_pred             CceeCcccCCcc
Q psy16828        347 KSHLCFVCGAGF  358 (372)
Q Consensus       347 ~~~~C~~C~~~f  358 (372)
                      .-+.|+.||...
T Consensus        18 g~~vC~~CG~Vl   29 (43)
T PF08271_consen   18 GELVCPNCGLVL   29 (43)
T ss_dssp             TEEEETTT-BBE
T ss_pred             CeEECCCCCCEe
Confidence            445677776543


No 177
>PRK14873 primosome assembly protein PriA; Provisional
Probab=40.97  E-value=18  Score=35.22  Aligned_cols=12  Identities=25%  Similarity=0.673  Sum_probs=7.1

Q ss_pred             CCCCcccCcccc
Q psy16828        289 DAKPFVCNICGK  300 (372)
Q Consensus       289 ~~~~~~C~~C~~  300 (372)
                      +.+...|.+||+
T Consensus       407 ~~~~l~Ch~CG~  418 (665)
T PRK14873        407 AGGTPRCRWCGR  418 (665)
T ss_pred             CCCeeECCCCcC
Confidence            344566777764


No 178
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=40.51  E-value=19  Score=24.83  Aligned_cols=17  Identities=29%  Similarity=0.548  Sum_probs=9.6

Q ss_pred             CcccCcccccccchhhH
Q psy16828        292 PFVCNICGKDFKLKYYV  308 (372)
Q Consensus       292 ~~~C~~C~~~f~~~~~l  308 (372)
                      |++|..||..|.+.+..
T Consensus         2 pH~CtrCG~vf~~g~~~   18 (112)
T COG3364           2 PHQCTRCGEVFDDGSEE   18 (112)
T ss_pred             CceecccccccccccHH
Confidence            45666666666654333


No 179
>KOG1280|consensus
Probab=40.23  E-value=27  Score=30.21  Aligned_cols=36  Identities=22%  Similarity=0.586  Sum_probs=21.3

Q ss_pred             CeecccccccccChhHHHHHHHhhccCc--eeeccccc
Q psy16828         82 PVECSYCGKVLSRKDKLTRHIAAVHSGK--EYPCEQCD  117 (372)
Q Consensus        82 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~--~~~C~~C~  117 (372)
                      .|.|++|++.--+...|..|+...|.+.  ...|++|.
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4666666666666666666666666554  34455554


No 180
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=40.11  E-value=18  Score=23.02  Aligned_cols=29  Identities=34%  Similarity=0.741  Sum_probs=12.6

Q ss_pred             cccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD  334 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  334 (372)
                      -.|..|++.|...             +..+.|-.||.+|=+.
T Consensus        10 ~~C~~C~~~F~~~-------------~rrhhCr~CG~~vC~~   38 (69)
T PF01363_consen   10 SNCMICGKKFSLF-------------RRRHHCRNCGRVVCSS   38 (69)
T ss_dssp             SB-TTT--B-BSS-------------S-EEE-TTT--EEECC
T ss_pred             CcCcCcCCcCCCc-------------eeeEccCCCCCEECCc
Confidence            3688888888531             2227788888777443


No 181
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=39.62  E-value=24  Score=22.46  Aligned_cols=13  Identities=23%  Similarity=0.501  Sum_probs=8.6

Q ss_pred             CceeCcccCCccc
Q psy16828        347 KSHLCFVCGAGFV  359 (372)
Q Consensus       347 ~~~~C~~C~~~f~  359 (372)
                      +.|.|+.||..+.
T Consensus        45 r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   45 RVFTCPNCGFEMD   57 (69)
T ss_pred             ceEEcCCCCCEEC
Confidence            4577777777643


No 182
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.38  E-value=22  Score=22.16  Aligned_cols=31  Identities=16%  Similarity=0.194  Sum_probs=17.0

Q ss_pred             CCCccCCCCCCcCCCCccccccccccCCCceeCcccCC
Q psy16828        319 RPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGA  356 (372)
Q Consensus       319 ~~~~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~  356 (372)
                      +.+.+|+.|++...-.....       -+||.+..|..
T Consensus         5 ~~~v~CP~Cgkpv~w~~~s~-------frPFCSkRCkl   35 (65)
T COG3024           5 RITVPCPTCGKPVVWGEESP-------FRPFCSKRCKL   35 (65)
T ss_pred             cccccCCCCCCcccccccCC-------cCcchhHhhhh
Confidence            34577888887664432221       25666655543


No 183
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=39.30  E-value=17  Score=20.26  Aligned_cols=15  Identities=27%  Similarity=0.605  Sum_probs=12.0

Q ss_pred             ceeCcccCCcccChh
Q psy16828        348 SHLCFVCGAGFVNDA  362 (372)
Q Consensus       348 ~~~C~~C~~~f~~~~  362 (372)
                      ||.|..|+..|-...
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            788999999886544


No 184
>KOG2593|consensus
Probab=38.39  E-value=16  Score=32.72  Aligned_cols=37  Identities=16%  Similarity=0.378  Sum_probs=23.0

Q ss_pred             ccCcccCCCCccccCChhhHHHHHhhhcCCCceeecCCCCC
Q psy16828        147 EIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGF  187 (372)
Q Consensus       147 ~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~  187 (372)
                      ....|.|+.|...|++..+++.    .-.....|.|..|+-
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~L----~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQL----LDNETGEFHCENCGG  161 (436)
T ss_pred             ccccccCCccccchhhhHHHHh----hcccCceEEEecCCC
Confidence            3455778888887776655533    223345677888774


No 185
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=38.18  E-value=23  Score=25.95  Aligned_cols=15  Identities=33%  Similarity=0.778  Sum_probs=8.9

Q ss_pred             CcccCcccccccchh
Q psy16828        292 PFVCNICGKDFKLKY  306 (372)
Q Consensus       292 ~~~C~~C~~~f~~~~  306 (372)
                      |++|..||+.|.+.+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            456666666666544


No 186
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=38.09  E-value=21  Score=20.23  Aligned_cols=13  Identities=38%  Similarity=0.833  Sum_probs=9.3

Q ss_pred             eCcccCCcccChh
Q psy16828        350 LCFVCGAGFVNDA  362 (372)
Q Consensus       350 ~C~~C~~~f~~~~  362 (372)
                      .|++||+.|+-+.
T Consensus        10 ~C~~C~rpf~WRK   22 (42)
T PF10013_consen   10 ICPVCGRPFTWRK   22 (42)
T ss_pred             cCcccCCcchHHH
Confidence            4888888887654


No 187
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=37.93  E-value=7.9  Score=26.59  Aligned_cols=18  Identities=22%  Similarity=0.438  Sum_probs=13.0

Q ss_pred             CCCccccCcccccccchh
Q psy16828         18 KYIKVECPVCGKVLSRKS   35 (372)
Q Consensus        18 ~~~~~~C~~C~~~f~~~~   35 (372)
                      =.+.|.|+.||..-....
T Consensus        19 L~k~FtCp~Cghe~vs~c   36 (104)
T COG4888          19 LPKTFTCPRCGHEKVSSC   36 (104)
T ss_pred             CCceEecCccCCeeeeEE
Confidence            356799999997765544


No 188
>KOG2071|consensus
Probab=37.87  E-value=25  Score=32.92  Aligned_cols=24  Identities=29%  Similarity=0.513  Sum_probs=14.6

Q ss_pred             cccccccccccCChHHHHHHHhhh
Q psy16828        264 RFECKLCHKTIVSEKTFKKHMALH  287 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l~~H~~~h  287 (372)
                      +-.|..||.+|.+......||..|
T Consensus       418 pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  418 PNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             cchhcccccccccchhhhhHhhhh
Confidence            456666666666666555555444


No 189
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=37.74  E-value=5.4  Score=38.03  Aligned_cols=81  Identities=19%  Similarity=0.364  Sum_probs=39.5

Q ss_pred             cccccchhhhcChhhhHhhhhhhccCCCC-cccccccccccccchHHhHHhhhhccCcccccccccccCChHHHHHHHhh
Q psy16828        208 YHCKYCDKTFTKRMNVKTHERMKHENHKP-YECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMAL  286 (372)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~-~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  286 (372)
                      -.|+.|-+.+.++.+-.-+        -| ..|..||-.|.-...|-.......-..--.|+.|.+.+.+..+.+-|.  
T Consensus       102 a~C~~Cl~Ei~dp~~rrY~--------YPF~~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfHA--  171 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRYL--------YPFINCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFHA--  171 (750)
T ss_pred             hhhHHHHHHhcCCCCccee--------ccccccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCcccccccc--
Confidence            4566666665544431111        11 247777777765544433322211122234666766666655543332  


Q ss_pred             hcCCCCcccCcccccc
Q psy16828        287 HSDAKPFVCNICGKDF  302 (372)
Q Consensus       287 h~~~~~~~C~~C~~~f  302 (372)
                          .|..|+.||-..
T Consensus       172 ----Qp~aCp~CGP~~  183 (750)
T COG0068         172 ----QPIACPKCGPHL  183 (750)
T ss_pred             ----ccccCcccCCCe
Confidence                345677776533


No 190
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=37.73  E-value=22  Score=18.27  Aligned_cols=12  Identities=17%  Similarity=0.210  Sum_probs=4.6

Q ss_pred             CceeCcccCCcc
Q psy16828        347 KSHLCFVCGAGF  358 (372)
Q Consensus       347 ~~~~C~~C~~~f  358 (372)
                      -.|.|..|.+.+
T Consensus        14 ~~Y~C~~Cdf~l   25 (30)
T PF07649_consen   14 WFYRCSECDFDL   25 (30)
T ss_dssp             -EEE-TTT----
T ss_pred             ceEECccCCCcc
Confidence            357788887654


No 191
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=37.48  E-value=5  Score=23.41  Aligned_cols=12  Identities=17%  Similarity=0.874  Sum_probs=6.6

Q ss_pred             CcccCccccccc
Q psy16828        292 PFVCNICGKDFK  303 (372)
Q Consensus       292 ~~~C~~C~~~f~  303 (372)
                      .|.|..|+.+|+
T Consensus         7 ry~CDLCn~~~p   18 (57)
T PF14445_consen    7 RYSCDLCNSSHP   18 (57)
T ss_pred             hHhHHhhcccCc
Confidence            355666665553


No 192
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=37.38  E-value=27  Score=19.54  Aligned_cols=11  Identities=27%  Similarity=0.760  Sum_probs=8.3

Q ss_pred             eeCcccCCccc
Q psy16828        349 HLCFVCGAGFV  359 (372)
Q Consensus       349 ~~C~~C~~~f~  359 (372)
                      |.|..||..+.
T Consensus        29 y~C~~C~~~w~   39 (40)
T smart00440       29 YVCTKCGHRWR   39 (40)
T ss_pred             EEeCCCCCEeC
Confidence            77888887664


No 193
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=37.36  E-value=13  Score=25.28  Aligned_cols=7  Identities=43%  Similarity=1.668  Sum_probs=2.8

Q ss_pred             cccccch
Q psy16828        208 YHCKYCD  214 (372)
Q Consensus       208 ~~C~~C~  214 (372)
                      |.|+.|+
T Consensus        36 y~Cp~Cg   42 (90)
T PF01780_consen   36 YTCPFCG   42 (90)
T ss_dssp             BEESSSS
T ss_pred             CcCCCCC
Confidence            3344443


No 194
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=37.06  E-value=30  Score=21.24  Aligned_cols=21  Identities=24%  Similarity=0.403  Sum_probs=9.2

Q ss_pred             CCcccCcccccccchhhHHHHH
Q psy16828        291 KPFVCNICGKDFKLKYYVNLHM  312 (372)
Q Consensus       291 ~~~~C~~C~~~f~~~~~l~~H~  312 (372)
                      .|+....|+-.| .+.++.+.+
T Consensus        23 ~PV~s~~C~H~f-ek~aI~~~i   43 (57)
T PF11789_consen   23 DPVKSKKCGHTF-EKEAILQYI   43 (57)
T ss_dssp             SEEEESSS--EE-EHHHHHHHC
T ss_pred             CCcCcCCCCCee-cHHHHHHHH
Confidence            344555555555 344444444


No 195
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=36.99  E-value=8.7  Score=22.91  Aligned_cols=10  Identities=30%  Similarity=1.072  Sum_probs=3.2

Q ss_pred             ccCCCCCCcC
Q psy16828        322 FECDVCHQIF  331 (372)
Q Consensus       322 ~~C~~C~~~f  331 (372)
                      |+|+.|...|
T Consensus        22 y~C~~C~~~F   31 (51)
T PF07975_consen   22 YRCPKCKNHF   31 (51)
T ss_dssp             E--TTTT--B
T ss_pred             EECCCCCCcc
Confidence            5555555544


No 196
>KOG0801|consensus
Probab=36.83  E-value=11  Score=28.43  Aligned_cols=32  Identities=28%  Similarity=0.681  Sum_probs=20.3

Q ss_pred             hhhHHHHHhhhcCCCCCccCCCCCCcCCCCcccccc
Q psy16828        305 KYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHM  340 (372)
Q Consensus       305 ~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~l~~h~  340 (372)
                      ..+|-.|+..|.+    ++|++|.|..+...+.-|.
T Consensus       126 a~slP~hi~~~~g----~KCPvC~K~V~sDd~e~Hl  157 (205)
T KOG0801|consen  126 ADSLPVHIMDHSG----MKCPVCHKVVPSDDAEIHL  157 (205)
T ss_pred             hhccceeeeccCC----ccCCccccccCCCcceEEE
Confidence            3455566666665    7788888887666444443


No 197
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=35.74  E-value=27  Score=26.40  Aligned_cols=41  Identities=20%  Similarity=0.402  Sum_probs=26.7

Q ss_pred             ccCCCCCCcCCCCcccc--ccccccCCCceeCcccCCcccChh
Q psy16828        322 FECDVCHQIFPTDFRTK--HMLVHDVEKSHLCFVCGAGFVNDA  362 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~--h~~~h~~~~~~~C~~C~~~f~~~~  362 (372)
                      -.|+.|+.......-..  .....+-+.|..|..||+.|-.-.
T Consensus        40 ~~Cp~C~~~IrG~y~v~gv~~~g~~~~~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   40 TSCPNCSTPIRGDYHVEGVFGLGGHYEAPSYCHNCGKPYPWTE   82 (158)
T ss_pred             HHCcCCCCCCCCceecCCeeeeCCCCCCChhHHhCCCCCchHH
Confidence            56888887766552221  112244568999999999987644


No 198
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.57  E-value=38  Score=24.34  Aligned_cols=41  Identities=24%  Similarity=0.510  Sum_probs=27.1

Q ss_pred             ccCCCCCCcCCCCcccc--ccccccCCCceeCcccCCcccChh
Q psy16828        322 FECDVCHQIFPTDFRTK--HMLVHDVEKSHLCFVCGAGFVNDA  362 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~--h~~~h~~~~~~~C~~C~~~f~~~~  362 (372)
                      ..||.|+.........+  -..-+.-+.|-.|..||..|..-.
T Consensus        40 ~qcp~csasirgd~~vegvlglg~dye~psfchncgs~fpwte   82 (160)
T COG4306          40 TQCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPWTE   82 (160)
T ss_pred             hcCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCcHH
Confidence            67888887776663333  123345567888999998886543


No 199
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=35.25  E-value=13  Score=30.75  Aligned_cols=25  Identities=20%  Similarity=0.482  Sum_probs=0.0

Q ss_pred             ccCCCCCCcCCCCccccccccccCC
Q psy16828        322 FECDVCHQIFPTDFRTKHMLVHDVE  346 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~h~~~h~~~  346 (372)
                      ..||.||+.++...+.+|+|+....
T Consensus       169 ~~cPitGe~IP~~e~~eHmRi~LlD  193 (229)
T PF12230_consen  169 IICPITGEMIPADEMDEHMRIELLD  193 (229)
T ss_dssp             -------------------------
T ss_pred             ccccccccccccccccccccccccc
Confidence            6677777777777777777765543


No 200
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=34.98  E-value=34  Score=25.93  Aligned_cols=38  Identities=24%  Similarity=0.413  Sum_probs=16.8

Q ss_pred             CcccCcccccc------cchhhHHHHHhh-hcC------CC----CCccCCCCCC
Q psy16828        292 PFVCNICGKDF------KLKYYVNLHMRT-HTR------IR----PTFECDVCHQ  329 (372)
Q Consensus       292 ~~~C~~C~~~f------~~~~~l~~H~~~-h~~------~~----~~~~C~~C~~  329 (372)
                      -.+|..|++.|      ++.+.+..|+.. .|.      +.    .+..|..||.
T Consensus        14 vv~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~   68 (152)
T PF09416_consen   14 VVKCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGS   68 (152)
T ss_dssp             EEEETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT--
T ss_pred             EeEcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCC
Confidence            34566666655      356777888543 221      11    2478888874


No 201
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=34.31  E-value=26  Score=25.64  Aligned_cols=21  Identities=33%  Similarity=0.624  Sum_probs=17.5

Q ss_pred             eeCcccCCcccChhhHHHHHhhcC
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRKHQ  372 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~h~  372 (372)
                      ..|-.+|+.|   ..|.+|+.+|+
T Consensus        77 IicLEDGkkf---KSLKRHL~t~~   97 (148)
T COG4957          77 IICLEDGKKF---KSLKRHLTTHY   97 (148)
T ss_pred             EEEeccCcch---HHHHHHHhccc
Confidence            4699999999   57889999874


No 202
>KOG4167|consensus
Probab=34.22  E-value=8.8  Score=36.61  Aligned_cols=24  Identities=29%  Similarity=0.535  Sum_probs=22.5

Q ss_pred             ceeCcccCCcccChhhHHHHHhhc
Q psy16828        348 SHLCFVCGAGFVNDAGLKVHMRKH  371 (372)
Q Consensus       348 ~~~C~~C~~~f~~~~~l~~H~~~h  371 (372)
                      -|.|..|++.|..-..+-.||++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            499999999999999999999987


No 203
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=34.10  E-value=19  Score=25.92  Aligned_cols=24  Identities=21%  Similarity=0.654  Sum_probs=15.2

Q ss_pred             cccCcccccccchhhHHHHHhhhcCCCCCccCCCCCC
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQ  329 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  329 (372)
                      ..|..|+..|.....             .+.||.|+.
T Consensus        71 ~~C~~Cg~~~~~~~~-------------~~~CP~Cgs   94 (115)
T TIGR00100        71 CECEDCSEEVSPEID-------------LYRCPKCHG   94 (115)
T ss_pred             EEcccCCCEEecCCc-------------CccCcCCcC
Confidence            568888877754321             266777774


No 204
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=33.86  E-value=19  Score=25.82  Aligned_cols=12  Identities=17%  Similarity=0.385  Sum_probs=7.6

Q ss_pred             cccCcccccccc
Q psy16828        293 FVCNICGKDFKL  304 (372)
Q Consensus       293 ~~C~~C~~~f~~  304 (372)
                      ..|+.|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PRK12380         71 AWCWDCSQVVEI   82 (113)
T ss_pred             EEcccCCCEEec
Confidence            567777766653


No 205
>PRK05580 primosome assembly protein PriA; Validated
Probab=33.76  E-value=28  Score=34.18  Aligned_cols=13  Identities=23%  Similarity=0.644  Sum_probs=6.7

Q ss_pred             CCCcccCcccccc
Q psy16828        290 AKPFVCNICGKDF  302 (372)
Q Consensus       290 ~~~~~C~~C~~~f  302 (372)
                      .+...|.+||+..
T Consensus       406 ~~~l~Ch~Cg~~~  418 (679)
T PRK05580        406 QRRLRCHHCGYQE  418 (679)
T ss_pred             CCeEECCCCcCCC
Confidence            3445566666543


No 206
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=33.71  E-value=19  Score=20.21  Aligned_cols=12  Identities=25%  Similarity=0.791  Sum_probs=9.8

Q ss_pred             CceeCcccCCcc
Q psy16828        347 KSHLCFVCGAGF  358 (372)
Q Consensus       347 ~~~~C~~C~~~f  358 (372)
                      ++-.|++||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            568899999876


No 207
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=33.59  E-value=23  Score=32.49  Aligned_cols=30  Identities=30%  Similarity=0.394  Sum_probs=26.5

Q ss_pred             CccccCcccccccchhHHhhhhhccCcCCC
Q psy16828         20 IKVECPVCGKVLSRKSKLVSHMRSFHTSVT   49 (372)
Q Consensus        20 ~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~   49 (372)
                      +-+.|+.|.+.|.....+..|+...|.+..
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~~l   85 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPAGL   85 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhhhc
Confidence            347899999999999999999998897754


No 208
>KOG1994|consensus
Probab=33.59  E-value=23  Score=28.56  Aligned_cols=21  Identities=29%  Similarity=0.762  Sum_probs=18.5

Q ss_pred             CceeCcccCCcccChhhHHHH
Q psy16828        347 KSHLCFVCGAGFVNDAGLKVH  367 (372)
Q Consensus       347 ~~~~C~~C~~~f~~~~~l~~H  367 (372)
                      -.|.|-.||..|.+...|..|
T Consensus       238 eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             cceEEEEeccccCCHHHHHHh
Confidence            458999999999999999887


No 209
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=33.45  E-value=16  Score=27.18  Aligned_cols=10  Identities=30%  Similarity=0.830  Sum_probs=4.4

Q ss_pred             eecCCCCCcc
Q psy16828        180 VLCTQCGFGC  189 (372)
Q Consensus       180 ~~C~~C~~~f  189 (372)
                      +.|+.|+..|
T Consensus        71 ~~C~~CG~~~   80 (135)
T PRK03824         71 LKCRNCGNEW   80 (135)
T ss_pred             EECCCCCCEE
Confidence            4444444443


No 210
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=33.35  E-value=16  Score=22.07  Aligned_cols=13  Identities=23%  Similarity=0.662  Sum_probs=7.1

Q ss_pred             eCcccCCcccChh
Q psy16828        350 LCFVCGAGFVNDA  362 (372)
Q Consensus       350 ~C~~C~~~f~~~~  362 (372)
                      .||+|++.|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            8999999987554


No 211
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=33.21  E-value=51  Score=31.97  Aligned_cols=9  Identities=33%  Similarity=1.143  Sum_probs=6.1

Q ss_pred             ccCcccccc
Q psy16828        294 VCNICGKDF  302 (372)
Q Consensus       294 ~C~~C~~~f  302 (372)
                      .|+.||..+
T Consensus        17 FC~~CG~~l   25 (645)
T PRK14559         17 FCQKCGTSL   25 (645)
T ss_pred             cccccCCCC
Confidence            577777665


No 212
>KOG4167|consensus
Probab=32.84  E-value=17  Score=34.90  Aligned_cols=27  Identities=22%  Similarity=0.445  Sum_probs=19.1

Q ss_pred             CCCeecccccccccChhHHHHHHHhhc
Q psy16828         80 RAPVECSYCGKVLSRKDKLTRHIAAVH  106 (372)
Q Consensus        80 ~~~~~C~~C~~~~~~~~~l~~H~~~~h  106 (372)
                      +..|-|.+|++.|....++..||+.|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            456777777777777777777776654


No 213
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=32.79  E-value=23  Score=24.84  Aligned_cols=13  Identities=15%  Similarity=0.120  Sum_probs=6.9

Q ss_pred             CCccccccccccc
Q psy16828        235 KPYECYICNKILV  247 (372)
Q Consensus       235 ~~~~C~~C~~~f~  247 (372)
                      ..|.||.|+..+.
T Consensus        18 ~~~iCpeC~~EW~   30 (109)
T TIGR00686        18 TQLICPSCLYEWN   30 (109)
T ss_pred             CeeECcccccccc
Confidence            3455666655544


No 214
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=32.58  E-value=23  Score=25.64  Aligned_cols=11  Identities=36%  Similarity=0.860  Sum_probs=6.6

Q ss_pred             cccCccccccc
Q psy16828        293 FVCNICGKDFK  303 (372)
Q Consensus       293 ~~C~~C~~~f~  303 (372)
                      ..|..||..|.
T Consensus        72 ~~C~~Cg~~~~   82 (117)
T PRK00564         72 LECKDCSHVFK   82 (117)
T ss_pred             EEhhhCCCccc
Confidence            55666665554


No 215
>KOG2636|consensus
Probab=31.62  E-value=30  Score=31.14  Aligned_cols=29  Identities=17%  Similarity=0.444  Sum_probs=24.8

Q ss_pred             ccccCCCceeCcccC-CcccChhhHHHHHh
Q psy16828        341 LVHDVEKSHLCFVCG-AGFVNDAGLKVHMR  369 (372)
Q Consensus       341 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  369 (372)
                      ++|.-...|.|.+|| +.+..+..+.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            456667789999999 89999999999975


No 216
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=31.61  E-value=21  Score=24.24  Aligned_cols=7  Identities=43%  Similarity=1.677  Sum_probs=3.2

Q ss_pred             cccccch
Q psy16828        208 YHCKYCD  214 (372)
Q Consensus       208 ~~C~~C~  214 (372)
                      |.|++|+
T Consensus        37 y~CpfCg   43 (90)
T PTZ00255         37 YFCPFCG   43 (90)
T ss_pred             ccCCCCC
Confidence            4444444


No 217
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=31.56  E-value=10  Score=28.43  Aligned_cols=12  Identities=25%  Similarity=0.484  Sum_probs=6.6

Q ss_pred             ccCcccccccch
Q psy16828        294 VCNICGKDFKLK  305 (372)
Q Consensus       294 ~C~~C~~~f~~~  305 (372)
                      .|..|++.|++.
T Consensus        30 eC~~C~~RFTTy   41 (147)
T TIGR00244        30 ECLECHERFTTF   41 (147)
T ss_pred             cCCccCCcccee
Confidence            455555555553


No 218
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=31.26  E-value=21  Score=21.70  Aligned_cols=12  Identities=25%  Similarity=0.335  Sum_probs=6.7

Q ss_pred             CCCceeCcccCC
Q psy16828        345 VEKSHLCFVCGA  356 (372)
Q Consensus       345 ~~~~~~C~~C~~  356 (372)
                      |++.-.|+.|+.
T Consensus        41 GE~VArCPSCSL   52 (67)
T COG5216          41 GEVVARCPSCSL   52 (67)
T ss_pred             CceEEEcCCceE
Confidence            555555666653


No 219
>PRK00420 hypothetical protein; Validated
Probab=31.12  E-value=43  Score=23.97  Aligned_cols=28  Identities=21%  Similarity=0.383  Sum_probs=14.8

Q ss_pred             ccCCCCCCcCCCCccccccccccCCCceeCcccCCccc
Q psy16828        322 FECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFV  359 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~~f~  359 (372)
                      -.||.|+..+...          ......|+.||....
T Consensus        24 ~~CP~Cg~pLf~l----------k~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         24 KHCPVCGLPLFEL----------KDGEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCCcceec----------CCCceECCCCCCeee
Confidence            4577776544321          013456777776443


No 220
>KOG1842|consensus
Probab=31.04  E-value=24  Score=31.69  Aligned_cols=32  Identities=25%  Similarity=0.311  Sum_probs=28.1

Q ss_pred             CCccccCcccccccchhHHhhhhhccCcCCCC
Q psy16828         19 YIKVECPVCGKVLSRKSKLVSHMRSFHTSVTP   50 (372)
Q Consensus        19 ~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~   50 (372)
                      -..|.||+|...|.+.+.|..|+...|.++..
T Consensus        13 ~egflCPiC~~dl~~~~~L~~H~d~eH~~ed~   44 (505)
T KOG1842|consen   13 LEGFLCPICLLDLPNLSALNDHLDVEHFEEDE   44 (505)
T ss_pred             hhcccCchHhhhhhhHHHHHHHHhhhccccch
Confidence            34699999999999999999999988987654


No 221
>COG1773 Rubredoxin [Energy production and conversion]
Probab=30.82  E-value=21  Score=21.66  Aligned_cols=12  Identities=33%  Similarity=0.659  Sum_probs=7.4

Q ss_pred             ceeCcccCCccc
Q psy16828        348 SHLCFVCGAGFV  359 (372)
Q Consensus       348 ~~~C~~C~~~f~  359 (372)
                      .|+|..||+.|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            466666666654


No 222
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=30.78  E-value=45  Score=18.60  Aligned_cols=32  Identities=22%  Similarity=0.532  Sum_probs=15.7

Q ss_pred             ccCCCCCCcCCCCccccccccccCCCceeCcccCCcc
Q psy16828        322 FECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGF  358 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~~f  358 (372)
                      .+|..|+..+     .-+.....+.+.+.|++|+..-
T Consensus         3 ~rC~~C~ayl-----Np~~~~~~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen    3 VRCRRCRAYL-----NPFCQFDDGGKTWICNFCGTKN   34 (40)
T ss_dssp             -B-TTT--BS------TTSEEETTTTEEEETTT--EE
T ss_pred             cccCCCCCEE-----CCcceEcCCCCEEECcCCCCcC
Confidence            5677775533     2333444466789999998753


No 223
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=30.61  E-value=36  Score=20.05  Aligned_cols=10  Identities=30%  Similarity=0.574  Sum_probs=5.7

Q ss_pred             ceeCcccCCc
Q psy16828        348 SHLCFVCGAG  357 (372)
Q Consensus       348 ~~~C~~C~~~  357 (372)
                      .+.|..||+.
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            3556666653


No 224
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=30.42  E-value=21  Score=20.32  Aligned_cols=16  Identities=25%  Similarity=0.503  Sum_probs=9.9

Q ss_pred             CceeCcccCCcccChh
Q psy16828        347 KSHLCFVCGAGFVNDA  362 (372)
Q Consensus       347 ~~~~C~~C~~~f~~~~  362 (372)
                      -|+.|..|+..|-...
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            4789999999886543


No 225
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.88  E-value=11  Score=30.31  Aligned_cols=40  Identities=23%  Similarity=0.549  Sum_probs=21.9

Q ss_pred             cCcccccccccccCChHHHHHHHhhhcCC----------CC-----cccCccccc
Q psy16828        262 AQRFECKLCHKTIVSEKTFKKHMALHSDA----------KP-----FVCNICGKD  301 (372)
Q Consensus       262 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~----------~~-----~~C~~C~~~  301 (372)
                      .+.+.||+|+-.|....-+..-.++-+|+          .|     ..||.|.++
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~yA   71 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYYA   71 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhHH
Confidence            34566777777776554443333333322          23     358888874


No 226
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=29.86  E-value=17  Score=26.04  Aligned_cols=40  Identities=20%  Similarity=0.434  Sum_probs=22.2

Q ss_pred             CeecccccccccChhHHHHHHHhhccCceeeccccccccc
Q psy16828         82 PVECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFT  121 (372)
Q Consensus        82 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~C~~C~~~f~  121 (372)
                      .+.|+.|+..=.....++.=........-|.|..|+..|.
T Consensus        72 ~~~CpkCg~~ea~y~~~QtRsaDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          72 KEKCPKCGNKEAYYWQLQTRSADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             cccCCCCCCceeEEEeeehhccCCCceEEEEecccCCEee
Confidence            4678888765433333322221112222589999998764


No 227
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=29.64  E-value=31  Score=31.04  Aligned_cols=16  Identities=25%  Similarity=0.613  Sum_probs=9.3

Q ss_pred             CCCCcccCcccccccc
Q psy16828        289 DAKPFVCNICGKDFKL  304 (372)
Q Consensus       289 ~~~~~~C~~C~~~f~~  304 (372)
                      |.+-|+|+.||+.++.
T Consensus       364 G~~g~rC~kCg~~~~~  379 (421)
T COG1571         364 GRNGFRCKKCGTRARE  379 (421)
T ss_pred             CCCCcccccccccCCc
Confidence            3335666666666554


No 228
>PTZ00448 hypothetical protein; Provisional
Probab=29.63  E-value=35  Score=30.04  Aligned_cols=23  Identities=26%  Similarity=0.553  Sum_probs=21.3

Q ss_pred             ceeCcccCCcccChhhHHHHHhh
Q psy16828        348 SHLCFVCGAGFVNDAGLKVHMRK  370 (372)
Q Consensus       348 ~~~C~~C~~~f~~~~~l~~H~~~  370 (372)
                      .|.|..|+..|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            68899999999999999999986


No 229
>KOG0717|consensus
Probab=29.31  E-value=28  Score=31.57  Aligned_cols=22  Identities=27%  Similarity=0.526  Sum_probs=19.9

Q ss_pred             eeCcccCCcccChhhHHHHHhh
Q psy16828        349 HLCFVCGAGFVNDAGLKVHMRK  370 (372)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~  370 (372)
                      -.|..|+..|..+.-|..|++.
T Consensus       461 ~~C~tCr~~FdSRnkLF~Hlk~  482 (508)
T KOG0717|consen  461 ISCTTCRESFDSRNKLFAHLKK  482 (508)
T ss_pred             HhhhhhhhhccchhHHHHHhhh
Confidence            6799999999999999999874


No 230
>PRK10220 hypothetical protein; Provisional
Probab=29.23  E-value=32  Score=24.23  Aligned_cols=12  Identities=25%  Similarity=0.406  Sum_probs=6.4

Q ss_pred             Cccccccccccc
Q psy16828        236 PYECYICNKILV  247 (372)
Q Consensus       236 ~~~C~~C~~~f~  247 (372)
                      .|.||.|+..+.
T Consensus        20 ~~vCpeC~hEW~   31 (111)
T PRK10220         20 MYICPECAHEWN   31 (111)
T ss_pred             eEECCcccCcCC
Confidence            355555555444


No 231
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=29.13  E-value=26  Score=25.16  Aligned_cols=11  Identities=18%  Similarity=0.540  Sum_probs=6.2

Q ss_pred             cccCccccccc
Q psy16828        293 FVCNICGKDFK  303 (372)
Q Consensus       293 ~~C~~C~~~f~  303 (372)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (114)
T PRK03681         71 CWCETCQQYVT   81 (114)
T ss_pred             EEcccCCCeee
Confidence            45666665443


No 232
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=29.03  E-value=41  Score=23.44  Aligned_cols=11  Identities=27%  Similarity=0.286  Sum_probs=5.2

Q ss_pred             eeCcccCCccc
Q psy16828        349 HLCFVCGAGFV  359 (372)
Q Consensus       349 ~~C~~C~~~f~  359 (372)
                      ..|+.||..+.
T Consensus        43 ~~C~~CG~y~~   53 (99)
T PRK14892         43 ITCGNCGLYTE   53 (99)
T ss_pred             EECCCCCCccC
Confidence            34555555443


No 233
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=28.98  E-value=40  Score=30.93  Aligned_cols=31  Identities=23%  Similarity=0.323  Sum_probs=25.7

Q ss_pred             CCCCeecccccccccChhHHHHHHHhhccCc
Q psy16828         79 SRAPVECSYCGKVLSRKDKLTRHIAAVHSGK  109 (372)
Q Consensus        79 ~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~  109 (372)
                      ..+.+.|+.|.+.|.+...+..|+...|...
T Consensus        54 sWrFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   54 SWRFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             ceeEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            3467889999999999999999998777654


No 234
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=28.78  E-value=22  Score=19.28  Aligned_cols=13  Identities=31%  Similarity=0.634  Sum_probs=6.0

Q ss_pred             cccchhhhcChhh
Q psy16828        210 CKYCDKTFTKRMN  222 (372)
Q Consensus       210 C~~C~~~f~~~~~  222 (372)
                      |+.|.+.+.++.+
T Consensus         2 C~~C~~Ey~~p~~   14 (35)
T PF07503_consen    2 CDDCLKEYFDPSN   14 (35)
T ss_dssp             -HHHHHHHCSTTS
T ss_pred             CHHHHHHHcCCCC
Confidence            4455555544443


No 235
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=28.72  E-value=27  Score=21.06  Aligned_cols=36  Identities=19%  Similarity=0.405  Sum_probs=19.5

Q ss_pred             CCeecccccccccChhHHHHHHHhhccCceeecccccccc
Q psy16828         81 APVECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKF  120 (372)
Q Consensus        81 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~C~~C~~~f  120 (372)
                      ..+.|++|+.....+..  ..  ..-..-|+.|+.|....
T Consensus         3 ~Wi~CP~CgnKTR~kir--~D--T~LkNfPlyCpKCK~Et   38 (55)
T PF14205_consen    3 EWILCPICGNKTRLKIR--ED--TVLKNFPLYCPKCKQET   38 (55)
T ss_pred             eEEECCCCCCccceeee--cC--ceeccccccCCCCCceE
Confidence            45778888865543311  00  11112278888887653


No 236
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=28.70  E-value=23  Score=24.09  Aligned_cols=7  Identities=43%  Similarity=1.587  Sum_probs=3.1

Q ss_pred             cccccch
Q psy16828        208 YHCKYCD  214 (372)
Q Consensus       208 ~~C~~C~  214 (372)
                      |.|++|+
T Consensus        36 y~CpfCg   42 (91)
T TIGR00280        36 YVCPFCG   42 (91)
T ss_pred             ccCCCCC
Confidence            4444443


No 237
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=28.26  E-value=44  Score=20.11  Aligned_cols=28  Identities=39%  Similarity=0.807  Sum_probs=19.6

Q ss_pred             ccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC
Q psy16828        294 VCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD  334 (372)
Q Consensus       294 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  334 (372)
                      .|..|++.|...            .+. +.|..||.+|=..
T Consensus         4 ~C~~C~~~F~~~------------~rk-~~Cr~Cg~~~C~~   31 (57)
T cd00065           4 SCMGCGKPFTLT------------RRR-HHCRNCGRIFCSK   31 (57)
T ss_pred             cCcccCccccCC------------ccc-cccCcCcCCcChH
Confidence            588899888741            122 7788888887554


No 238
>KOG2071|consensus
Probab=27.99  E-value=34  Score=32.09  Aligned_cols=26  Identities=27%  Similarity=0.539  Sum_probs=22.7

Q ss_pred             CCceeCcccCCcccChhhHHHHHhhc
Q psy16828        346 EKSHLCFVCGAGFVNDAGLKVHMRKH  371 (372)
Q Consensus       346 ~~~~~C~~C~~~f~~~~~l~~H~~~h  371 (372)
                      ..|..|..||..|.+.....+||-.|
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhh
Confidence            35799999999999999988888776


No 239
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=27.56  E-value=33  Score=18.43  Aligned_cols=10  Identities=30%  Similarity=0.627  Sum_probs=6.3

Q ss_pred             ceeCcccCCc
Q psy16828        348 SHLCFVCGAG  357 (372)
Q Consensus       348 ~~~C~~C~~~  357 (372)
                      .+.|+.||..
T Consensus        22 R~vC~~Cg~I   31 (34)
T PF14803_consen   22 RLVCPACGFI   31 (34)
T ss_dssp             EEEETTTTEE
T ss_pred             ceECCCCCCE
Confidence            3667777654


No 240
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=27.55  E-value=41  Score=24.84  Aligned_cols=14  Identities=21%  Similarity=0.871  Sum_probs=9.4

Q ss_pred             CccCCCCCCcCCCC
Q psy16828        321 TFECDVCHQIFPTD  334 (372)
Q Consensus       321 ~~~C~~C~~~f~~~  334 (372)
                      .|+|+.|++.|...
T Consensus        53 RyrC~~C~~tf~~~   66 (129)
T COG3677          53 RYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccCCcCcceeee
Confidence            37777777777554


No 241
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=27.24  E-value=19  Score=30.87  Aligned_cols=11  Identities=18%  Similarity=0.440  Sum_probs=6.6

Q ss_pred             ccCCCCCCcCC
Q psy16828        322 FECDVCHQIFP  332 (372)
Q Consensus       322 ~~C~~C~~~f~  332 (372)
                      +.|+.|+.-|.
T Consensus        58 ~vcp~c~~h~r   68 (296)
T CHL00174         58 NICEQCGYHLK   68 (296)
T ss_pred             CCCCCCCCCcC
Confidence            56666666554


No 242
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=27.17  E-value=39  Score=30.45  Aligned_cols=29  Identities=28%  Similarity=0.552  Sum_probs=19.4

Q ss_pred             ccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC
Q psy16828        294 VCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD  334 (372)
Q Consensus       294 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  334 (372)
                      .|+.||.+..+.           +... |+|+.|+..++..
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g-~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNG-FRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhhc-----------CCCC-cccccccccCCcc
Confidence            688888765432           1113 8888888887665


No 243
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=27.05  E-value=15  Score=27.59  Aligned_cols=11  Identities=36%  Similarity=0.869  Sum_probs=6.0

Q ss_pred             ccCcccccccc
Q psy16828        294 VCNICGKDFKL  304 (372)
Q Consensus       294 ~C~~C~~~f~~  304 (372)
                      .|+.|+..|++
T Consensus        30 eC~~C~~RFTT   40 (156)
T COG1327          30 ECLECGERFTT   40 (156)
T ss_pred             cccccccccch
Confidence            45555555554


No 244
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=26.91  E-value=47  Score=18.79  Aligned_cols=15  Identities=20%  Similarity=0.691  Sum_probs=10.4

Q ss_pred             CCceeCcccCCcccC
Q psy16828        346 EKSHLCFVCGAGFVN  360 (372)
Q Consensus       346 ~~~~~C~~C~~~f~~  360 (372)
                      ...+.|+.||..+.+
T Consensus        30 vp~~~C~~CGE~~~~   44 (46)
T TIGR03831        30 VPALVCPQCGEEYLD   44 (46)
T ss_pred             CCccccccCCCEeeC
Confidence            345778888877654


No 245
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=26.65  E-value=41  Score=26.55  Aligned_cols=17  Identities=24%  Similarity=0.733  Sum_probs=11.8

Q ss_pred             CCCCCccCCCCCCcCCC
Q psy16828        317 RIRPTFECDVCHQIFPT  333 (372)
Q Consensus       317 ~~~~~~~C~~C~~~f~~  333 (372)
                      +..+++.|..||..++.
T Consensus        26 g~~~lvrC~eCG~V~~~   42 (201)
T COG1326          26 GREPLVRCEECGTVHPA   42 (201)
T ss_pred             CCceEEEccCCCcEeec
Confidence            33456888888887754


No 247
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=26.32  E-value=1.1e+02  Score=18.71  Aligned_cols=30  Identities=10%  Similarity=0.093  Sum_probs=14.6

Q ss_pred             ccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC
Q psy16828        298 CGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD  334 (372)
Q Consensus       298 C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  334 (372)
                      ||..| ....+..+++.     . ..||.|++.+...
T Consensus        19 ~G~v~-~~~~i~~~~~~-----~-~~cP~~~~~~~~~   48 (63)
T smart00504       19 SGQTY-ERRAIEKWLLS-----H-GTDPVTGQPLTHE   48 (63)
T ss_pred             CCCEE-eHHHHHHHHHH-----C-CCCCCCcCCCChh
Confidence            45444 34444555443     1 3566666655433


No 248
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=25.94  E-value=43  Score=18.26  Aligned_cols=25  Identities=24%  Similarity=0.429  Sum_probs=15.5

Q ss_pred             ccCCCCCCcCCCCccccccccccCCCceeCcccCC
Q psy16828        322 FECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGA  356 (372)
Q Consensus       322 ~~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~~  356 (372)
                      +.|+.|+..+...          .+.-|.|..||-
T Consensus         9 ~~C~~C~~~~~~~----------~dG~~yC~~cG~   33 (36)
T PF11781_consen    9 EPCPVCGSRWFYS----------DDGFYYCDRCGH   33 (36)
T ss_pred             CcCCCCCCeEeEc----------cCCEEEhhhCce
Confidence            5688887653222          345677877774


No 249
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=25.72  E-value=36  Score=23.61  Aligned_cols=19  Identities=26%  Similarity=0.401  Sum_probs=14.0

Q ss_pred             ccccCCCceeCcccCCcccC
Q psy16828        341 LVHDVEKSHLCFVCGAGFVN  360 (372)
Q Consensus       341 ~~h~~~~~~~C~~C~~~f~~  360 (372)
                      .++.| +|++|+.||..|..
T Consensus        73 ~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          73 WLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEeCC-CceeCCCCCcEEEE
Confidence            34555 78999999988754


No 250
>KOG4124|consensus
Probab=25.70  E-value=21  Score=30.81  Aligned_cols=71  Identities=21%  Similarity=0.242  Sum_probs=44.4

Q ss_pred             CCCccccC--cccccccchhHHhhhhhccCcCCCCccCCCCCCCCcchhhHHHhhhhccCCCCCCCCeecccccccccCh
Q psy16828         18 KYIKVECP--VCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRK   95 (372)
Q Consensus        18 ~~~~~~C~--~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~   95 (372)
                      ..++|+|+  .|.+.+.+...|..|...-|............       .+..       .-...|+++|++|.+.+...
T Consensus       346 ~~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~-------ph~~-------~~~~nk~~r~~i~~~~~k~~  411 (442)
T KOG4124|consen  346 VDKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPI-------PHQG-------FVVENKPYRCEVCSKRYKNL  411 (442)
T ss_pred             ecCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCC-------Ccce-------eeeccCcccChhhhhhhccC
Confidence            45788897  49999999999998887656543221111000       0000       11233789999999988777


Q ss_pred             hHHHHHH
Q psy16828         96 DKLTRHI  102 (372)
Q Consensus        96 ~~l~~H~  102 (372)
                      ..|..|.
T Consensus       412 ~~l~~~~  418 (442)
T KOG4124|consen  412 NGLKYHR  418 (442)
T ss_pred             CCCCcee
Confidence            6665554


No 251
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=25.40  E-value=29  Score=24.12  Aligned_cols=26  Identities=15%  Similarity=0.337  Sum_probs=23.1

Q ss_pred             CCCccccCcccccccchhHHhhhhhc
Q psy16828         18 KYIKVECPVCGKVLSRKSKLVSHMRS   43 (372)
Q Consensus        18 ~~~~~~C~~C~~~f~~~~~l~~H~~~   43 (372)
                      |...+-|-.|.+.|.+...|..|.+.
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhcc
Confidence            56667899999999999999999875


No 252
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=25.16  E-value=22  Score=30.37  Aligned_cols=31  Identities=19%  Similarity=0.300  Sum_probs=15.9

Q ss_pred             cccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCC
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPT  333 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~  333 (372)
                      .+|+.|+.....+.....         . +.|+.|+.-|.-
T Consensus        27 ~~c~~c~~~~~~~~l~~~---------~-~vc~~c~~h~rl   57 (285)
T TIGR00515        27 TKCPKCGQVLYTKELERN---------L-EVCPKCDHHMRM   57 (285)
T ss_pred             eECCCCcchhhHHHHHhh---------C-CCCCCCCCcCcC
Confidence            457777765543322111         1 567777665543


No 253
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=24.82  E-value=39  Score=20.55  Aligned_cols=20  Identities=25%  Similarity=0.768  Sum_probs=13.8

Q ss_pred             CceeCcccCCcccChhhHHH
Q psy16828        347 KSHLCFVCGAGFVNDAGLKV  366 (372)
Q Consensus       347 ~~~~C~~C~~~f~~~~~l~~  366 (372)
                      +-+.|-.||..|.+...|..
T Consensus        26 ~~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   26 EHNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             hCceeeeeCCccCCHHHHHh
Confidence            34667777777777776654


No 254
>KOG1842|consensus
Probab=24.52  E-value=41  Score=30.32  Aligned_cols=29  Identities=21%  Similarity=0.303  Sum_probs=26.1

Q ss_pred             CCeecccccccccChhHHHHHHHhhccCc
Q psy16828         81 APVECSYCGKVLSRKDKLTRHIAAVHSGK  109 (372)
Q Consensus        81 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~  109 (372)
                      ..|.|++|...|.+...|..|+...|.+.
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            46899999999999999999998888764


No 255
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=24.50  E-value=46  Score=26.41  Aligned_cols=15  Identities=20%  Similarity=0.412  Sum_probs=10.9

Q ss_pred             ceeCcccCCcccChh
Q psy16828        348 SHLCFVCGAGFVNDA  362 (372)
Q Consensus       348 ~~~C~~C~~~f~~~~  362 (372)
                      ...|..||+.+.+..
T Consensus        43 t~~C~~CgYR~~DV~   57 (201)
T COG1779          43 TGVCERCGYRSTDVK   57 (201)
T ss_pred             EEEccccCCccccee
Confidence            467888888877643


No 256
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=24.45  E-value=39  Score=25.73  Aligned_cols=10  Identities=30%  Similarity=0.630  Sum_probs=5.4

Q ss_pred             eeCcccCCcc
Q psy16828        349 HLCFVCGAGF  358 (372)
Q Consensus       349 ~~C~~C~~~f  358 (372)
                      |.|+.|+..|
T Consensus       144 ~~C~~C~~~l  153 (157)
T PF10263_consen  144 YRCGRCGGPL  153 (157)
T ss_pred             EECCCCCCEE
Confidence            5566565443


No 257
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=24.45  E-value=30  Score=23.51  Aligned_cols=6  Identities=33%  Similarity=0.949  Sum_probs=2.6

Q ss_pred             cccccc
Q psy16828        208 YHCKYC  213 (372)
Q Consensus       208 ~~C~~C  213 (372)
                      |.|++|
T Consensus        37 y~CpfC   42 (90)
T PRK03976         37 HVCPVC   42 (90)
T ss_pred             ccCCCC
Confidence            444444


No 258
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.10  E-value=32  Score=22.32  Aligned_cols=30  Identities=30%  Similarity=0.680  Sum_probs=16.0

Q ss_pred             cccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCc
Q psy16828        293 FVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQI  330 (372)
Q Consensus       293 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  330 (372)
                      |.|..|+..|.    +.+++    .+.|.-.|+.|+..
T Consensus        13 Y~c~~cg~~~d----vvq~~----~ddplt~ce~c~a~   42 (82)
T COG2331          13 YECTECGNRFD----VVQAM----TDDPLTTCEECGAR   42 (82)
T ss_pred             EeecccchHHH----HHHhc----ccCccccChhhChH
Confidence            66777776553    33332    23343566777653


No 259
>PTZ00448 hypothetical protein; Provisional
Probab=23.96  E-value=45  Score=29.38  Aligned_cols=23  Identities=26%  Similarity=0.456  Sum_probs=21.6

Q ss_pred             ccccCcccccccchhHHhhhhhc
Q psy16828         21 KVECPVCGKVLSRKSKLVSHMRS   43 (372)
Q Consensus        21 ~~~C~~C~~~f~~~~~l~~H~~~   43 (372)
                      .|.|..|+..|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            68999999999999999999986


No 260
>PRK05978 hypothetical protein; Provisional
Probab=23.84  E-value=31  Score=26.13  Aligned_cols=10  Identities=30%  Similarity=0.740  Sum_probs=4.7

Q ss_pred             ccCCCCCCcC
Q psy16828        322 FECDVCHQIF  331 (372)
Q Consensus       322 ~~C~~C~~~f  331 (372)
                      -.|+.|+..|
T Consensus        53 ~~C~~CG~~~   62 (148)
T PRK05978         53 DHCAACGEDF   62 (148)
T ss_pred             CCccccCCcc
Confidence            3455555443


No 261
>KOG4727|consensus
Probab=23.74  E-value=46  Score=25.56  Aligned_cols=23  Identities=22%  Similarity=0.436  Sum_probs=18.1

Q ss_pred             CCCeecccccccccChhHHHHHH
Q psy16828         80 RAPVECSYCGKVLSRKDKLTRHI  102 (372)
Q Consensus        80 ~~~~~C~~C~~~~~~~~~l~~H~  102 (372)
                      ..-|.|.+|+-++.....+..|+
T Consensus        73 ~~GyyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   73 KGGYYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             cCceeeeecceeehhhHHHHHHh
Confidence            35688888888888888888886


No 262
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=23.66  E-value=45  Score=25.19  Aligned_cols=10  Identities=30%  Similarity=0.557  Sum_probs=5.4

Q ss_pred             ceeCcccCCc
Q psy16828        348 SHLCFVCGAG  357 (372)
Q Consensus       348 ~~~C~~C~~~  357 (372)
                      .|.|..|+-.
T Consensus       140 ~YrC~~C~gk  149 (156)
T COG3091         140 VYRCGKCGGK  149 (156)
T ss_pred             eEEeccCCce
Confidence            5556555543


No 263
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=23.29  E-value=48  Score=28.79  Aligned_cols=29  Identities=17%  Similarity=0.462  Sum_probs=24.3

Q ss_pred             ccccCCCceeCcccC-CcccChhhHHHHHh
Q psy16828        341 LVHDVEKSHLCFVCG-AGFVNDAGLKVHMR  369 (372)
Q Consensus       341 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  369 (372)
                      ++|.-.+.|.|.+|| +.+..+..+.+|..
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhhhh
Confidence            466777889999999 88888998988864


No 264
>KOG3214|consensus
Probab=22.66  E-value=32  Score=23.66  Aligned_cols=16  Identities=13%  Similarity=0.418  Sum_probs=12.8

Q ss_pred             CCeecccccccccChh
Q psy16828         81 APVECSYCGKVLSRKD   96 (372)
Q Consensus        81 ~~~~C~~C~~~~~~~~   96 (372)
                      +...|.+|+..|.+..
T Consensus        46 G~~sC~iC~esFqt~i   61 (109)
T KOG3214|consen   46 GKASCRICEESFQTTI   61 (109)
T ss_pred             ceeeeeehhhhhccch
Confidence            5678999999997663


No 265
>KOG1994|consensus
Probab=22.25  E-value=44  Score=27.00  Aligned_cols=21  Identities=29%  Similarity=0.599  Sum_probs=18.8

Q ss_pred             ceeecccccccccCchhHHHH
Q psy16828        109 KEYPCEQCDRKFTNGYKLKQH  129 (372)
Q Consensus       109 ~~~~C~~C~~~f~~~~~l~~H  129 (372)
                      .-|.|-.||..|.+..+|..|
T Consensus       238 eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             cceEEEEeccccCCHHHHHHh
Confidence            359999999999999999988


No 266
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=21.93  E-value=75  Score=22.24  Aligned_cols=11  Identities=18%  Similarity=0.452  Sum_probs=7.6

Q ss_pred             ccCCCCCCcCC
Q psy16828        322 FECDVCHQIFP  332 (372)
Q Consensus       322 ~~C~~C~~~f~  332 (372)
                      +.|+.|+..+.
T Consensus        17 ~~C~~C~~~~~   27 (104)
T TIGR01384        17 YVCPSCGYEKE   27 (104)
T ss_pred             EECcCCCCccc
Confidence            77777776654


No 267
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=21.87  E-value=30  Score=27.54  Aligned_cols=28  Identities=18%  Similarity=0.551  Sum_probs=0.0

Q ss_pred             cccCCCceeCcccCC-cccChhhHHHHHh
Q psy16828        342 VHDVEKSHLCFVCGA-GFVNDAGLKVHMR  369 (372)
Q Consensus       342 ~h~~~~~~~C~~C~~-~f~~~~~l~~H~~  369 (372)
                      +|.-.+.|.|.+||. +|..+..+.+|..
T Consensus        95 LhGL~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   95 LHGLGVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -----------------------------
T ss_pred             HhCCCCeeeeEeCCCcceecHHHHHHhcC
Confidence            444456788888865 6667888888864


No 268
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=21.85  E-value=85  Score=23.98  Aligned_cols=51  Identities=18%  Similarity=0.290  Sum_probs=28.8

Q ss_pred             ccccccccccCChHHHHHHHhhhcCCCCcccCc--ccccccchhhHHHHHhhhcC
Q psy16828        265 FECKLCHKTIVSEKTFKKHMALHSDAKPFVCNI--CGKDFKLKYYVNLHMRTHTR  317 (372)
Q Consensus       265 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~  317 (372)
                      ..||+|.-........ .-.+.+.+.|+-.|..  |.+. .+...|.+|.+.-|.
T Consensus        81 L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP  133 (162)
T PF07800_consen   81 LACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHP  133 (162)
T ss_pred             ccCccccCceeceEEc-hHHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCC
Confidence            5566666544433322 2245556666666644  6655 356778888777553


No 269
>KOG0782|consensus
Probab=21.84  E-value=14  Score=34.09  Aligned_cols=26  Identities=35%  Similarity=0.664  Sum_probs=11.6

Q ss_pred             HHHHHHhhhcCCCCcccCcccccccc
Q psy16828        279 TFKKHMALHSDAKPFVCNICGKDFKL  304 (372)
Q Consensus       279 ~l~~H~~~h~~~~~~~C~~C~~~f~~  304 (372)
                      .|.+|-.+|....--+|..|+++|-+
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQ  265 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQ  265 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhh
Confidence            34444444433333345555555543


No 270
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=21.31  E-value=38  Score=24.32  Aligned_cols=11  Identities=36%  Similarity=1.008  Sum_probs=5.7

Q ss_pred             cccCccccccc
Q psy16828        293 FVCNICGKDFK  303 (372)
Q Consensus       293 ~~C~~C~~~f~  303 (372)
                      ..|..|++.|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            45666666554


No 271
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=21.06  E-value=87  Score=22.70  Aligned_cols=20  Identities=20%  Similarity=0.464  Sum_probs=14.3

Q ss_pred             CCceeCcccCCcccChhhHH
Q psy16828        346 EKSHLCFVCGAGFVNDAGLK  365 (372)
Q Consensus       346 ~~~~~C~~C~~~f~~~~~l~  365 (372)
                      ..-+.|+.||..+.......
T Consensus        29 ~~~~~C~~CGe~~~~~e~~~   48 (127)
T TIGR03830        29 VPGWYCPACGEELLDPEESK   48 (127)
T ss_pred             eeeeECCCCCCEEEcHHHHH
Confidence            35578999988887776543


No 272
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=21.05  E-value=29  Score=23.18  Aligned_cols=15  Identities=33%  Similarity=0.663  Sum_probs=8.3

Q ss_pred             CceeCcccCCcccCh
Q psy16828        347 KSHLCFVCGAGFVND  361 (372)
Q Consensus       347 ~~~~C~~C~~~f~~~  361 (372)
                      ....|..||..|...
T Consensus        45 ~~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   45 GILSCRVCGESFQTK   59 (81)
T ss_dssp             EEEEESSS--EEEEE
T ss_pred             EEEEecCCCCeEEEc
Confidence            346688888777543


No 273
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=21.00  E-value=44  Score=18.87  Aligned_cols=11  Identities=27%  Similarity=0.996  Sum_probs=5.4

Q ss_pred             CCCCCCcCCCC
Q psy16828        324 CDVCHQIFPTD  334 (372)
Q Consensus       324 C~~C~~~f~~~  334 (372)
                      |++|...|.+.
T Consensus         1 CpiC~~~~~~P   11 (42)
T PF15227_consen    1 CPICLDLFKDP   11 (42)
T ss_dssp             ETTTTSB-SSE
T ss_pred             CCccchhhCCc
Confidence            45555555554


No 274
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=20.94  E-value=66  Score=19.37  Aligned_cols=17  Identities=18%  Similarity=0.337  Sum_probs=11.7

Q ss_pred             CCeecccccccccChhH
Q psy16828         81 APVECSYCGKVLSRKDK   97 (372)
Q Consensus        81 ~~~~C~~C~~~~~~~~~   97 (372)
                      ..++|+.|+..+.....
T Consensus        27 v~W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   27 VWWKCPKCGHEWKASVN   43 (55)
T ss_pred             EEEECCCCCCeeEccHh
Confidence            35788888887766543


No 275
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=20.90  E-value=1.2e+02  Score=23.74  Aligned_cols=17  Identities=18%  Similarity=0.667  Sum_probs=9.3

Q ss_pred             cCCCCcccCcccccccc
Q psy16828        288 SDAKPFVCNICGKDFKL  304 (372)
Q Consensus       288 ~~~~~~~C~~C~~~f~~  304 (372)
                      .+..-|.|+.|.-.|+.
T Consensus       109 ~~~~~y~C~~~~~r~sf  125 (176)
T COG1675         109 TENNYYVCPNCHVKYSF  125 (176)
T ss_pred             ccCCceeCCCCCCcccH
Confidence            44445666666655543


No 276
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=20.65  E-value=30  Score=29.71  Aligned_cols=11  Identities=18%  Similarity=0.422  Sum_probs=6.9

Q ss_pred             ccCCCCCCcCC
Q psy16828        322 FECDVCHQIFP  332 (372)
Q Consensus       322 ~~C~~C~~~f~  332 (372)
                      +.|+.|+.-|.
T Consensus        47 ~vc~~c~~h~r   57 (292)
T PRK05654         47 NVCPKCGHHMR   57 (292)
T ss_pred             CCCCCCCCCee
Confidence            56777766553


No 277
>KOG4377|consensus
Probab=20.61  E-value=38  Score=30.14  Aligned_cols=76  Identities=20%  Similarity=0.308  Sum_probs=43.3

Q ss_pred             eecc--cccccccCchhHHHHHHhhcccCCCCccccccccCcccC--CCCccccCChhhHHHHHhhhcCCC-------ce
Q psy16828        111 YPCE--QCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKC--DQCDYATKDKYNLGTHIKRRHTKE-------YS  179 (372)
Q Consensus       111 ~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~C--~~C~~~~~~~~~l~~H~~~~h~~~-------~~  179 (372)
                      |.|.  .|...+-.+.++.+|...|...+.........-...|.|  .+|++.   .++.+.|- ..|...       .-
T Consensus       272 yhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~ks---TsdV~~h~-nFht~~~n~Gfrrth  347 (480)
T KOG4377|consen  272 YHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEKS---TSDVLLHD-NFHTDKRNNGFRRTH  347 (480)
T ss_pred             hcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCcc---cccccccC-ccccccccCceecce
Confidence            5563  698888779999999999876655443333222333556  357662   23344553 344321       13


Q ss_pred             eecCCCC--Cccc
Q psy16828        180 VLCTQCG--FGCY  190 (372)
Q Consensus       180 ~~C~~C~--~~f~  190 (372)
                      |-|..++  ..|.
T Consensus       348 fhC~r~gCTdtfK  360 (480)
T KOG4377|consen  348 FHCQRIGCTDTFK  360 (480)
T ss_pred             eEEeccCCccccc
Confidence            5566555  4554


No 278
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=20.29  E-value=35  Score=17.47  Aligned_cols=26  Identities=19%  Similarity=0.369  Sum_probs=12.0

Q ss_pred             cCCCCCCcCCCCccccccccccCCCceeCcccC
Q psy16828        323 ECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCG  355 (372)
Q Consensus       323 ~C~~C~~~f~~~~l~~h~~~h~~~~~~~C~~C~  355 (372)
                      +|+.|+..+....+       .+..+|.|+.|-
T Consensus         3 ~C~rC~~~~~~~~~-------~~r~~~~C~rCq   28 (30)
T PF06827_consen    3 KCPRCWNYIEDIGI-------NGRSTYLCPRCQ   28 (30)
T ss_dssp             B-TTT--BBEEEEE-------TTEEEEE-TTTC
T ss_pred             cCccCCCcceEeEe-------cCCCCeECcCCc
Confidence            57777665443321       234567788775


No 279
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=20.26  E-value=28  Score=30.60  Aligned_cols=56  Identities=25%  Similarity=0.431  Sum_probs=23.3

Q ss_pred             cccccccccccCChHHHH---HHH-hhhcCCCC-cccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCc
Q psy16828        264 RFECKLCHKTIVSEKTFK---KHM-ALHSDAKP-FVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQI  330 (372)
Q Consensus       264 ~~~C~~C~~~f~~~~~l~---~H~-~~h~~~~~-~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  330 (372)
                      .+.|..|.++....+..-   .|. .++.+.+. |+|..|++.+.+...|           |.-.|..|+..
T Consensus       252 av~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~Rt~sl~r~-----------P~~~C~~Cg~~  312 (344)
T PF09332_consen  252 AVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNRTISLERL-----------PKKHCSNCGSS  312 (344)
T ss_dssp             EEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-EEEESSSS-------------S--TTT-S-
T ss_pred             EEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCeeeecccC-----------CCCCCCcCCcC
Confidence            477888887766555443   232 23444443 6788888876543222           22568888753


Done!