Query         psy16829
Match_columns 243
No_of_seqs    176 out of 1948
Neff          10.8
Searched_HMMs 46136
Date          Fri Aug 16 23:05:26 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16829.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16829hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 1.4E-30   3E-35  192.0   5.5  133   86-222   130-264 (279)
  2 KOG2462|consensus              100.0 1.5E-29 3.2E-34  186.5   8.0  136   55-193   126-265 (279)
  3 KOG1074|consensus               99.9 7.9E-26 1.7E-30  188.1   4.1   80  116-195   606-692 (958)
  4 KOG3608|consensus               99.9 5.2E-25 1.1E-29  167.0   8.1  181   42-226   190-377 (467)
  5 KOG3608|consensus               99.9 1.7E-24 3.6E-29  164.3   7.7  177   60-241   178-365 (467)
  6 KOG3623|consensus               99.9 1.5E-24 3.3E-29  178.1   5.0   69  172-242   895-964 (1007)
  7 KOG3623|consensus               99.9 1.4E-22   3E-27  166.7   3.3   77  144-222   895-971 (1007)
  8 KOG1074|consensus               99.8 4.3E-22 9.3E-27  166.2   0.5   51   59-109   353-404 (958)
  9 KOG3576|consensus               99.7 8.4E-19 1.8E-23  123.7   2.6  111   86-197   117-238 (267)
 10 KOG3576|consensus               99.7 1.4E-18 3.1E-23  122.6   3.0  116  112-227   114-238 (267)
 11 PLN03086 PRLI-interacting fact  99.5   4E-13 8.7E-18  111.6  12.0  146   56-222   404-561 (567)
 12 PLN03086 PRLI-interacting fact  99.4 1.6E-12 3.4E-17  108.1   6.9  134   87-241   408-554 (567)
 13 PHA00733 hypothetical protein   99.3   2E-12 4.3E-17   88.2   4.9   83  141-227    38-125 (128)
 14 PHA02768 hypothetical protein;  99.2 1.5E-11 3.2E-16   69.2   3.0   42  201-243     5-46  (55)
 15 PHA00733 hypothetical protein   99.1 5.3E-11 1.2E-15   81.2   4.3   82  113-196    38-124 (128)
 16 PHA02768 hypothetical protein;  99.0 1.9E-10   4E-15   64.8   1.8   43  171-217     5-47  (55)
 17 KOG3993|consensus               98.9 3.1E-10 6.6E-15   89.3   1.0  163   59-223   267-480 (500)
 18 KOG3993|consensus               98.9 3.6E-10 7.9E-15   88.9  -0.1  155   86-241   267-471 (500)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.7 6.9E-09 1.5E-13   50.0   2.2   24  187-212     2-25  (26)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.7 4.3E-09 9.4E-14   50.7   0.9   25  216-240     1-26  (26)
 21 PHA00616 hypothetical protein   98.7 3.7E-09 8.1E-14   56.6   0.1   33  201-233     1-34  (44)
 22 PF05605 zf-Di19:  Drought indu  98.6 7.9E-08 1.7E-12   55.4   4.3   53  171-226     2-54  (54)
 23 PHA00616 hypothetical protein   98.6 3.3E-08 7.1E-13   53.0   1.7   36  171-208     1-36  (44)
 24 PHA00732 hypothetical protein   98.4 1.4E-07   3E-12   58.5   2.7   48  171-225     1-48  (79)
 25 PHA00732 hypothetical protein   98.4 1.8E-07   4E-12   57.9   3.0   39  201-241     1-40  (79)
 26 PF00096 zf-C2H2:  Zinc finger,  98.3 4.5E-07 9.7E-12   42.4   1.6   23  202-224     1-23  (23)
 27 PF05605 zf-Di19:  Drought indu  98.1 5.3E-06 1.2E-10   47.7   4.3   49  144-195     3-53  (54)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.0 3.8E-06 8.2E-11   39.5   2.0   24  202-225     1-24  (24)
 29 PF13912 zf-C2H2_6:  C2H2-type   98.0 3.5E-06 7.5E-11   41.0   1.7   26  201-226     1-26  (27)
 30 PF00096 zf-C2H2:  Zinc finger,  98.0 7.1E-06 1.5E-10   38.2   2.1   23  172-194     1-23  (23)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.8 2.2E-05 4.9E-10   36.7   2.4   24  172-195     1-24  (24)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.7 2.4E-05 5.1E-10   51.3   2.5   22  118-139     2-23  (100)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.7 3.8E-05 8.3E-10   50.3   3.1   21  202-222    51-71  (100)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.6 3.4E-05 7.4E-10   37.4   1.5   25  171-195     1-25  (27)
 35 smart00355 ZnF_C2H2 zinc finge  97.6 6.7E-05 1.4E-09   35.7   2.5   24  202-225     1-24  (26)
 36 PF13909 zf-H2C2_5:  C2H2-type   97.4 0.00011 2.3E-09   34.5   1.4   23  202-225     1-23  (24)
 37 PF09237 GAGA:  GAGA factor;  I  97.4 0.00011 2.5E-09   40.3   1.6   26  201-226    24-49  (54)
 38 KOG2231|consensus               97.3 0.00091   2E-08   57.5   7.0   99   89-195   118-236 (669)
 39 COG5189 SFP1 Putative transcri  97.2  0.0001 2.3E-09   56.7   0.8   55  168-222   346-419 (423)
 40 KOG2231|consensus               97.2 0.00086 1.9E-08   57.7   5.7  121   87-232   100-240 (669)
 41 COG5189 SFP1 Putative transcri  97.1 0.00014   3E-09   56.0   0.5   25  168-192   395-419 (423)
 42 PF12874 zf-met:  Zinc-finger o  97.1 0.00031 6.7E-09   33.2   1.3   22  202-223     1-22  (25)
 43 PRK04860 hypothetical protein;  97.0 0.00032   7E-09   49.8   1.7   36  201-240   119-155 (160)
 44 PF09237 GAGA:  GAGA factor;  I  97.0 0.00046   1E-08   38.0   1.7   25   85-109    23-47  (54)
 45 smart00355 ZnF_C2H2 zinc finge  96.9   0.001 2.2E-08   31.4   2.2   24  172-195     1-24  (26)
 46 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00081 1.7E-08   31.4   1.8   23  172-195     1-23  (24)
 47 PF12874 zf-met:  Zinc-finger o  96.6  0.0012 2.5E-08   31.2   1.2   20   61-80      2-21  (25)
 48 PRK04860 hypothetical protein;  96.6  0.0018 3.9E-08   46.1   2.4   39  170-214   118-156 (160)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  96.4 0.00092   2E-08   32.2   0.2   22  202-223     2-23  (27)
 50 PF13913 zf-C2HC_2:  zinc-finge  96.4  0.0032 6.8E-08   29.7   2.0   21  202-223     3-23  (25)
 51 KOG1146|consensus               96.4  0.0024 5.3E-08   58.5   2.7  160   60-224   437-641 (1406)
 52 PF12171 zf-C2H2_jaz:  Zinc-fin  96.3  0.0024 5.3E-08   30.7   1.2   22   60-81      2-23  (27)
 53 KOG1146|consensus               95.5  0.0019   4E-08   59.2  -1.8  147   89-238   439-628 (1406)
 54 COG5048 FOG: Zn-finger [Genera  95.3  0.0029 6.4E-08   52.8  -1.2  147   86-233   289-451 (467)
 55 smart00451 ZnF_U1 U1-like zinc  95.3   0.015 3.3E-07   29.7   2.0   22  201-222     3-24  (35)
 56 KOG2482|consensus               95.1   0.076 1.7E-06   41.9   6.0   50  173-222   281-355 (423)
 57 cd00350 rubredoxin_like Rubred  95.0   0.017 3.7E-07   29.3   1.5   24  172-209     2-25  (33)
 58 PF12013 DUF3505:  Protein of u  94.8   0.064 1.4E-06   35.7   4.3   26  201-226    80-109 (109)
 59 KOG2785|consensus               94.2    0.17 3.7E-06   40.7   6.0   52  171-222   166-241 (390)
 60 KOG2482|consensus               94.1    0.18 3.9E-06   39.9   6.0   53  114-166   143-218 (423)
 61 COG5236 Uncharacterized conser  94.0    0.07 1.5E-06   42.2   3.6  130   87-226   152-306 (493)
 62 PF12013 DUF3505:  Protein of u  93.9    0.12 2.6E-06   34.4   4.1   25  172-196    81-109 (109)
 63 COG5048 FOG: Zn-finger [Genera  93.4    0.02 4.4E-07   47.8  -0.2  148   58-208   288-453 (467)
 64 smart00451 ZnF_U1 U1-like zinc  93.4   0.057 1.2E-06   27.5   1.5   21   60-80      4-24  (35)
 65 TIGR00622 ssl1 transcription f  93.3    0.15 3.3E-06   33.7   3.7   54  173-235    57-110 (112)
 66 TIGR00622 ssl1 transcription f  92.1    0.33 7.1E-06   32.2   4.1   48  145-194    57-104 (112)
 67 cd00729 rubredoxin_SM Rubredox  91.9   0.087 1.9E-06   26.8   1.0   25  171-209     2-26  (34)
 68 KOG2893|consensus               91.9   0.044 9.5E-07   40.9  -0.2   43   61-106    12-54  (341)
 69 KOG2893|consensus               91.6   0.048   1E-06   40.7  -0.2   42   89-135    13-54  (341)
 70 KOG4173|consensus               91.3    0.15 3.2E-06   37.3   2.0   77   59-137    79-168 (253)
 71 PF09538 FYDLN_acid:  Protein o  90.7     0.2 4.2E-06   33.2   2.0   15  114-128    25-39  (108)
 72 COG4049 Uncharacterized protei  89.1    0.16 3.5E-06   28.6   0.5   23  201-223    17-39  (65)
 73 COG4049 Uncharacterized protei  88.9    0.21 4.6E-06   28.1   0.9   29  168-196    14-42  (65)
 74 KOG2785|consensus               88.5    0.79 1.7E-05   37.0   4.2   28   57-84    164-191 (390)
 75 KOG2186|consensus               88.1    0.37 7.9E-06   36.6   2.0   47   59-107     3-49  (276)
 76 COG2888 Predicted Zn-ribbon RN  88.0    0.48 1.1E-05   27.2   2.0   13  201-213    27-39  (61)
 77 PF09538 FYDLN_acid:  Protein o  87.8    0.35 7.5E-06   32.0   1.6   30   60-99     10-39  (108)
 78 KOG4173|consensus               87.7    0.53 1.1E-05   34.5   2.6   19  146-164   109-127 (253)
 79 COG1592 Rubrerythrin [Energy p  87.5    0.31 6.7E-06   34.9   1.3   23  171-208   134-156 (166)
 80 PF10571 UPF0547:  Uncharacteri  87.2    0.43 9.3E-06   22.6   1.3    8  204-211    17-24  (26)
 81 PF13719 zinc_ribbon_5:  zinc-r  86.9    0.49 1.1E-05   24.6   1.5   10  172-181    26-35  (37)
 82 COG5236 Uncharacterized conser  86.7    0.83 1.8E-05   36.4   3.3   75   60-139   221-305 (493)
 83 PF13717 zinc_ribbon_4:  zinc-r  86.6    0.55 1.2E-05   24.2   1.6   11  145-155     4-14  (36)
 84 TIGR02098 MJ0042_CXXC MJ0042 f  86.1    0.51 1.1E-05   24.5   1.4   12  145-156     4-15  (38)
 85 PF09986 DUF2225:  Uncharacteri  85.9    0.14 3.1E-06   38.6  -1.2   45  170-214     4-61  (214)
 86 TIGR00373 conserved hypothetic  85.4     0.8 1.7E-05   32.7   2.5   33  139-180   105-137 (158)
 87 PF06524 NOA36:  NOA36 protein;  85.3    0.34 7.3E-06   36.9   0.6   79   60-151    98-179 (314)
 88 TIGR00373 conserved hypothetic  84.7     1.2 2.6E-05   31.9   3.1   32  168-210   106-137 (158)
 89 TIGR02300 FYDLN_acid conserved  84.3    0.86 1.9E-05   30.8   2.1   15  114-128    25-39  (129)
 90 smart00659 RPOLCX RNA polymera  83.8    0.83 1.8E-05   24.8   1.5   11  172-182     3-13  (44)
 91 PHA00626 hypothetical protein   83.7    0.23 4.9E-06   28.1  -0.7   12  201-212    23-34  (59)
 92 PF09986 DUF2225:  Uncharacteri  83.3    0.36 7.8E-06   36.4  -0.0   42   58-99      4-61  (214)
 93 smart00734 ZnF_Rad18 Rad18-lik  82.7     1.3 2.9E-05   20.9   1.8   20  202-222     2-21  (26)
 94 smart00834 CxxC_CXXC_SSSS Puta  82.0    0.58 1.3E-05   24.7   0.5   31   58-94      4-34  (41)
 95 PRK06266 transcription initiat  81.2     1.2 2.6E-05   32.5   2.1   33  140-181   114-146 (178)
 96 PRK06266 transcription initiat  81.1     1.8 3.8E-05   31.7   2.9   34  168-212   114-147 (178)
 97 PF09723 Zn-ribbon_8:  Zinc rib  80.6    0.97 2.1E-05   24.2   1.1   31   58-94      4-34  (42)
 98 TIGR02605 CxxC_CxxC_SSSS putat  80.6    0.69 1.5E-05   26.0   0.5   31   58-94      4-34  (52)
 99 TIGR02300 FYDLN_acid conserved  80.2     1.2 2.5E-05   30.2   1.5   33   60-102    10-42  (129)
100 PF02892 zf-BED:  BED zinc fing  80.1     1.2 2.6E-05   24.0   1.4   21  201-221    16-40  (45)
101 PRK14890 putative Zn-ribbon RN  79.9    0.97 2.1E-05   26.0   0.9    8  201-208    48-55  (59)
102 smart00614 ZnF_BED BED zinc fi  79.3     1.7 3.6E-05   24.2   1.8   21  202-222    19-44  (50)
103 PF05443 ROS_MUCR:  ROS/MUCR tr  78.1     1.6 3.4E-05   30.1   1.7   27   55-84     68-94  (132)
104 smart00531 TFIIE Transcription  77.9     2.6 5.6E-05   29.7   2.8   37  169-211    97-133 (147)
105 PF14353 CpXC:  CpXC protein     77.8     1.9   4E-05   29.6   2.1   40   60-101     2-53  (128)
106 COG1592 Rubrerythrin [Energy p  77.7     1.5 3.3E-05   31.4   1.6   24   86-123   134-157 (166)
107 PF08274 PhnA_Zn_Ribbon:  PhnA   77.4    0.72 1.6E-05   22.7  -0.0    9  201-209    19-27  (30)
108 smart00531 TFIIE Transcription  77.4     2.4 5.1E-05   29.9   2.5   38  140-181    96-133 (147)
109 PF15269 zf-C2H2_7:  Zinc-finge  77.4     1.9 4.1E-05   23.1   1.5   23  201-223    20-42  (54)
110 PRK00464 nrdR transcriptional   77.2    0.43 9.3E-06   33.8  -1.2   12  172-183    29-40  (154)
111 KOG2807|consensus               76.5     4.7  0.0001   32.1   4.0   30  201-235   345-374 (378)
112 PRK04023 DNA polymerase II lar  75.5     3.9 8.4E-05   37.8   3.8   12  229-240   664-675 (1121)
113 PRK00398 rpoP DNA-directed RNA  74.7     1.7 3.8E-05   23.7   1.0    9   60-68      4-12  (46)
114 KOG2186|consensus               74.2     2.8 6.1E-05   32.0   2.3   46  144-192     4-49  (276)
115 PF03604 DNA_RNApol_7kD:  DNA d  73.9     1.9 4.1E-05   21.6   0.9    9  201-209    17-25  (32)
116 COG1997 RPL43A Ribosomal prote  73.4     1.9 4.2E-05   27.0   1.1   12  201-212    53-64  (89)
117 PF02176 zf-TRAF:  TRAF-type zi  73.1     2.2 4.9E-05   24.6   1.3   40  170-212     8-53  (60)
118 PRK09678 DNA-binding transcrip  72.9    0.74 1.6E-05   27.9  -0.8   39  172-214     2-42  (72)
119 PF05443 ROS_MUCR:  ROS/MUCR tr  72.3     2.2 4.8E-05   29.3   1.3   25  201-228    72-96  (132)
120 PRK04023 DNA polymerase II lar  71.5     4.6 9.9E-05   37.4   3.3   10  201-210   663-672 (1121)
121 PF13451 zf-trcl:  Probable zin  67.2     5.1 0.00011   22.3   1.8   39  169-208     2-40  (49)
122 PF07975 C1_4:  TFIIH C1-like d  66.6     1.7 3.6E-05   24.4  -0.2   30  201-235    21-50  (51)
123 COG1996 RPC10 DNA-directed RNA  66.5     3.5 7.7E-05   22.9   1.1   12   58-69      5-16  (49)
124 COG5151 SSL1 RNA polymerase II  63.4     5.7 0.00012   31.4   2.0   30  201-235   388-417 (421)
125 KOG2593|consensus               62.4      10 0.00022   31.6   3.4   40  139-181   124-163 (436)
126 PRK14714 DNA polymerase II lar  60.3      11 0.00024   36.0   3.5   30  201-240   692-721 (1337)
127 PF07754 DUF1610:  Domain of un  59.2     4.2 9.2E-05   18.8   0.5    8  201-208    16-23  (24)
128 COG3357 Predicted transcriptio  58.9     7.1 0.00015   24.7   1.5   30   85-125    57-86  (97)
129 COG4530 Uncharacterized protei  58.4     5.9 0.00013   26.0   1.1   26   61-96     11-36  (129)
130 COG4957 Predicted transcriptio  58.4      20 0.00044   24.6   3.7   25   57-84     74-98  (148)
131 PF12760 Zn_Tnp_IS1595:  Transp  57.9      11 0.00024   20.5   2.1    8  201-208    37-44  (46)
132 PF12907 zf-met2:  Zinc-binding  56.9     7.4 0.00016   20.6   1.2    8  100-107    18-25  (40)
133 KOG3408|consensus               56.4     6.1 0.00013   26.5   1.0   22  201-222    57-78  (129)
134 KOG2907|consensus               55.5     6.2 0.00013   26.1   0.9   39   60-98     75-114 (116)
135 COG1998 RPS31 Ribosomal protei  54.9       7 0.00015   21.6   0.9    8  202-209    38-45  (51)
136 PF05191 ADK_lid:  Adenylate ki  54.7     2.5 5.3E-05   21.8  -0.8   10  173-182     3-12  (36)
137 KOG3408|consensus               53.4      20 0.00043   24.2   3.0   31   51-81     49-79  (129)
138 KOG4167|consensus               53.3     4.6  0.0001   35.8   0.1   27   57-83    790-816 (907)
139 PRK03824 hypA hydrogenase nick  53.2     4.1   9E-05   28.2  -0.2   12  144-155    71-82  (135)
140 PF13878 zf-C2H2_3:  zinc-finge  52.7      15 0.00033   19.5   2.0   22  203-224    15-38  (41)
141 COG1198 PriA Primosomal protei  52.7     9.6 0.00021   34.4   1.9   46   60-124   436-484 (730)
142 PF05290 Baculo_IE-1:  Baculovi  52.7      13 0.00028   25.5   2.1   58  139-215    76-135 (140)
143 TIGR01206 lysW lysine biosynth  52.0     4.6 9.9E-05   23.0  -0.1   12  172-183     3-14  (54)
144 KOG2807|consensus               50.7      18 0.00039   28.9   2.9   88   58-178   275-374 (378)
145 KOG1280|consensus               50.6      15 0.00032   29.7   2.4   36  143-178    79-116 (381)
146 smart00154 ZnF_AN1 AN1-like Zi  50.4     8.1 0.00018   20.3   0.7   14  201-214    12-25  (39)
147 KOG2593|consensus               49.8      16 0.00034   30.5   2.5   16  170-185   127-142 (436)
148 PF01155 HypA:  Hydrogenase exp  49.6     6.8 0.00015   26.2   0.4   12  172-183    71-82  (113)
149 PF06524 NOA36:  NOA36 protein;  49.0      19 0.00042   27.8   2.7   85  139-224   138-232 (314)
150 KOG2272|consensus               48.8      13 0.00028   28.5   1.8   14  229-242   281-294 (332)
151 PF07800 DUF1644:  Protein of u  48.7      98  0.0021   22.1   6.0   54   58-115    79-137 (162)
152 PF10013 DUF2256:  Uncharacteri  48.2      10 0.00022   20.2   0.8   11  230-240    10-20  (42)
153 PRK12380 hydrogenase nickel in  48.0     9.2  0.0002   25.6   0.9   12  172-183    71-82  (113)
154 PF04959 ARS2:  Arsenite-resist  46.4     8.5 0.00018   29.0   0.6   22  172-193    78-99  (214)
155 PF04959 ARS2:  Arsenite-resist  46.0     9.9 0.00021   28.7   0.9   29  140-168    74-102 (214)
156 PF13453 zf-TFIIB:  Transcripti  45.9     9.7 0.00021   20.1   0.6   19  201-219    19-37  (41)
157 KOG4167|consensus               45.2     5.1 0.00011   35.5  -0.8   23   87-109   793-815 (907)
158 PRK00432 30S ribosomal protein  44.4      12 0.00026   20.9   0.8    8  172-179    38-45  (50)
159 PTZ00255 60S ribosomal protein  44.2     9.2  0.0002   24.3   0.4   12  114-125    53-64  (90)
160 PF01780 Ribosomal_L37ae:  Ribo  43.7     5.7 0.00012   25.3  -0.6   11   85-95     34-44  (90)
161 PF09963 DUF2197:  Uncharacteri  43.1     8.7 0.00019   22.0   0.1   12   60-71      3-14  (56)
162 PF04216 FdhE:  Protein involve  42.4     3.2 6.9E-05   33.0  -2.3   35  145-182   174-208 (290)
163 PRK00564 hypA hydrogenase nick  41.3      14 0.00029   25.0   0.9   11  172-182    72-82  (117)
164 COG5151 SSL1 RNA polymerase II  41.2      14 0.00031   29.2   1.1   26  141-166   386-411 (421)
165 PF14311 DUF4379:  Domain of un  41.1      20 0.00044   20.2   1.5   12  172-183    29-40  (55)
166 COG4888 Uncharacterized Zn rib  41.1     5.5 0.00012   25.7  -0.9    8  172-179    23-30  (104)
167 PF08790 zf-LYAR:  LYAR-type C2  40.5     9.7 0.00021   18.3   0.1    9   61-69      2-10  (28)
168 TIGR00280 L37a ribosomal prote  39.9     9.9 0.00021   24.2   0.1   12  114-125    52-63  (91)
169 PF01096 TFIIS_C:  Transcriptio  39.7     3.5 7.6E-05   21.6  -1.7    9   87-95     29-37  (39)
170 COG1773 Rubredoxin [Energy pro  39.7      15 0.00032   21.0   0.7   14  171-184     3-16  (55)
171 PRK10220 hypothetical protein;  39.2      19 0.00041   23.8   1.2   12  115-126    20-31  (111)
172 smart00440 ZnF_C2C2 C2C2 Zinc   38.7     7.5 0.00016   20.5  -0.5    9   87-95     29-37  (40)
173 PF01428 zf-AN1:  AN1-like Zinc  38.5       9 0.00019   20.5  -0.3   14  201-214    13-26  (43)
174 TIGR00100 hypA hydrogenase nic  38.1      18 0.00038   24.3   1.1   28   56-94     67-94  (115)
175 TIGR00686 phnA alkylphosphonat  38.1      17 0.00037   23.9   0.9   12  115-126    19-30  (109)
176 PRK03681 hypA hydrogenase nick  37.7      16 0.00035   24.5   0.8   11  172-182    71-81  (114)
177 TIGR00595 priA primosomal prot  37.4      18  0.0004   31.3   1.3   10  114-123   252-261 (505)
178 KOG0717|consensus               36.7      20 0.00043   30.3   1.3   21  202-222   293-313 (508)
179 PF01286 XPA_N:  XPA protein N-  36.5      13 0.00027   18.9   0.1    9  231-239     6-14  (34)
180 PRK04351 hypothetical protein;  36.2      16 0.00034   25.9   0.6   10  229-238   133-142 (149)
181 KOG1280|consensus               36.0      36 0.00077   27.6   2.5   37   57-93     77-116 (381)
182 COG1675 TFA1 Transcription ini  35.8      40 0.00086   24.6   2.6   34  139-181   109-142 (176)
183 COG1198 PriA Primosomal protei  35.7      28  0.0006   31.6   2.2    9  229-237   476-484 (730)
184 TIGR01562 FdhE formate dehydro  35.6      24 0.00051   28.3   1.6   15  167-181   206-220 (305)
185 PRK03564 formate dehydrogenase  35.5      18 0.00039   29.0   0.9   15  167-181   208-222 (309)
186 PF07282 OrfB_Zn_ribbon:  Putat  35.3      25 0.00054   20.8   1.3    7  172-178    47-53  (69)
187 PRK03976 rpl37ae 50S ribosomal  35.1      12 0.00026   23.8  -0.1   12  114-125    53-64  (90)
188 PF01363 FYVE:  FYVE zinc finge  34.4      24 0.00052   20.9   1.2    8  146-153    12-19  (69)
189 PF04780 DUF629:  Protein of un  34.0      30 0.00065   29.5   2.0   21  202-222    58-78  (466)
190 COG3091 SprT Zn-dependent meta  34.0      17 0.00036   25.7   0.4   10  171-181   117-126 (156)
191 COG4896 Uncharacterized protei  33.8      29 0.00062   20.2   1.3    8  172-179    32-39  (68)
192 KOG0978|consensus               33.7      13 0.00029   33.1  -0.1   47   59-105   643-697 (698)
193 KOG1842|consensus               33.2      25 0.00055   29.5   1.4   26  171-196    15-40  (505)
194 PF10276 zf-CHCC:  Zinc-finger   33.1      20 0.00043   19.0   0.6   12   58-69     28-39  (40)
195 KOG3214|consensus               33.1      11 0.00023   24.4  -0.6   12  202-213    48-59  (109)
196 PF14787 zf-CCHC_5:  GAG-polypr  32.4      36 0.00078   17.5   1.4   11  203-213     4-14  (36)
197 COG0068 HypF Hydrogenase matur  32.2     7.8 0.00017   34.5  -1.7   29  173-209   153-181 (750)
198 COG4338 Uncharacterized protei  32.1      13 0.00027   20.4  -0.3   11  230-240    14-24  (54)
199 PRK12496 hypothetical protein;  31.8      28 0.00061   25.1   1.3   11  172-182   128-138 (164)
200 PF11672 DUF3268:  Protein of u  31.5      24 0.00051   23.2   0.8   10   59-68      2-11  (102)
201 PF10263 SprT-like:  SprT-like   31.3      12 0.00025   26.5  -0.7   10  172-181   124-133 (157)
202 KOG0782|consensus               31.1     5.4 0.00012   34.4  -2.7   25   74-98    240-265 (1004)
203 PRK14873 primosome assembly pr  31.0      35 0.00076   30.8   2.0   47   60-124   384-431 (665)
204 cd00924 Cyt_c_Oxidase_Vb Cytoc  30.9      27 0.00059   22.7   1.0   16  168-183    76-91  (97)
205 PF04423 Rad50_zn_hook:  Rad50   30.5      17 0.00037   20.5   0.0    9  203-211    22-30  (54)
206 PF07649 C1_3:  C1-like domain;  30.5      21 0.00046   17.2   0.4   10  201-210    15-24  (30)
207 COG4391 Uncharacterized protei  30.4      25 0.00054   20.5   0.7   15   56-70     45-59  (62)
208 COG2331 Uncharacterized protei  30.4      26 0.00056   21.4   0.8   37   54-96      7-43  (82)
209 PF01927 Mut7-C:  Mut7-C RNAse   29.9      36 0.00077   23.9   1.6   16  171-186   124-139 (147)
210 KOG4602|consensus               29.8      91   0.002   24.2   3.7   37   58-94    232-276 (318)
211 PF04810 zf-Sec23_Sec24:  Sec23  29.7      13 0.00028   19.5  -0.5   12  168-179    21-32  (40)
212 PF04780 DUF629:  Protein of un  29.7      44 0.00095   28.5   2.3   23  172-194    58-80  (466)
213 PF00301 Rubredoxin:  Rubredoxi  29.4      25 0.00054   19.4   0.5   13  172-184     2-14  (47)
214 KOG2636|consensus               29.3      42 0.00092   28.2   2.0   44   59-107   249-292 (497)
215 PF09332 Mcm10:  Mcm10 replicat  28.9      13 0.00029   30.2  -0.8   40  172-212   253-296 (344)
216 KOG1842|consensus               28.8      36 0.00078   28.6   1.6   27   58-84     14-40  (505)
217 cd00730 rubredoxin Rubredoxin;  28.7      24 0.00052   19.7   0.4   13  172-184     2-14  (50)
218 cd00065 FYVE FYVE domain; Zinc  28.0      34 0.00074   19.2   1.0    9  174-182     5-13  (57)
219 PF07295 DUF1451:  Protein of u  27.7      24 0.00052   24.9   0.4   32   55-95    108-139 (146)
220 PF13824 zf-Mss51:  Zinc-finger  27.6      27 0.00059   19.9   0.5   11  229-239    15-25  (55)
221 PF14369 zf-RING_3:  zinc-finge  27.3      47   0.001   16.9   1.3    8   89-96     24-31  (35)
222 PF15135 UPF0515:  Uncharacteri  27.3      56  0.0012   25.2   2.2   39  113-156   130-168 (278)
223 PLN02294 cytochrome c oxidase   27.2      33 0.00072   24.7   1.0   17  168-184   138-154 (174)
224 PF14446 Prok-RING_1:  Prokaryo  27.2      42 0.00091   19.1   1.2    8   61-68      7-14  (54)
225 COG1655 Uncharacterized protei  27.1      10 0.00022   28.7  -1.6    9  202-210    63-71  (267)
226 smart00132 LIM Zinc-binding do  25.9      22 0.00048   17.8  -0.0    9   87-95     28-36  (39)
227 COG1594 RPB9 DNA-directed RNA   25.3      16 0.00035   24.4  -0.8   10  172-181   101-110 (113)
228 PRK05580 primosome assembly pr  25.2      50  0.0011   29.9   2.0   10   60-69    382-391 (679)
229 TIGR00627 tfb4 transcription f  25.1      52  0.0011   26.1   1.8   11  172-182   256-266 (279)
230 PRK14892 putative transcriptio  24.9      19 0.00042   23.4  -0.4   13  201-213    42-54  (99)
231 KOG3362|consensus               24.9      24 0.00052   24.5  -0.0   22  201-222   129-150 (156)
232 KOG2071|consensus               24.6      36 0.00078   29.7   1.0   24   59-82    418-441 (579)
233 KOG4317|consensus               24.6      18 0.00039   28.8  -0.8   13  172-184    20-32  (383)
234 PF10058 DUF2296:  Predicted in  24.5      86  0.0019   17.8   2.2   35   55-94     18-52  (54)
235 COG1571 Predicted DNA-binding   24.3      50  0.0011   27.8   1.7   14  115-128   367-380 (421)
236 PTZ00448 hypothetical protein;  23.9      60  0.0013   26.7   2.0   22  201-222   314-335 (373)
237 PF08209 Sgf11:  Sgf11 (transcr  23.2      78  0.0017   15.9   1.6    8  173-180     6-13  (33)
238 PF09845 DUF2072:  Zn-ribbon co  23.2      39 0.00085   23.2   0.7   15   86-100     1-15  (131)
239 KOG2071|consensus               23.0      50  0.0011   28.9   1.5   27  201-227   418-444 (579)
240 smart00064 FYVE Protein presen  22.8      48   0.001   19.5   1.0   10  145-154    12-21  (68)
241 PF05495 zf-CHY:  CHY zinc fing  22.3      37  0.0008   20.5   0.5   55   60-123    11-69  (71)
242 smart00661 RPOL9 RNA polymeras  22.2      52  0.0011   18.0   1.0    9   87-95     21-29  (52)
243 PF14205 Cys_rich_KTR:  Cystein  21.8      28  0.0006   19.8  -0.2    9  201-209    28-36  (55)
244 KOG4377|consensus               21.6      42 0.00091   27.9   0.8   22  206-227   408-429 (480)
245 smart00731 SprT SprT homologue  21.5      29 0.00064   24.3  -0.1   11  201-211   112-122 (146)
246 PF07503 zf-HYPF:  HypF finger;  21.0      44 0.00095   17.0   0.5   30   62-96      2-31  (35)
247 PRK14559 putative protein seri  20.9 1.1E+02  0.0025   27.5   3.3   11  145-155    43-53  (645)
248 PF05741 zf-nanos:  Nanos RNA b  20.8      36 0.00077   19.5   0.2    8   87-94     34-41  (55)
249 PF02591 DUF164:  Putative zinc  20.2      65  0.0014   18.2   1.2    8  115-122    46-53  (56)

No 1  
>KOG2462|consensus
Probab=99.96  E-value=1.4e-30  Score=191.95  Aligned_cols=133  Identities=24%  Similarity=0.504  Sum_probs=102.2

Q ss_pred             cccccccccccCChHHHHHHHHhhc--CCCCcccCCcccccccChHHHHHHHHhhcCCCCcccccccccccChhHHHHHH
Q psy16829         86 SHVCDICLEAFPSSDDRDLHFLSHL--TSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHK  163 (243)
Q Consensus        86 ~~~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  163 (243)
                      .|+|+.|++.+.+.+.|-+|.+.|-  ...+.+.|.+|++.+.....|+.|+++|.  -+++|.+||+.|+..+.|+.|+
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHi  207 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHI  207 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccc
Confidence            3566666666666666666665551  23456777888888888888888888776  4678888888888888888888


Q ss_pred             HHhcCCCCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHh
Q psy16829        164 IKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       164 ~~~~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      +.|+|+|||.|+.|++.|.++++|+.|+++|.+.+  +|+|..|+++|...+-|.+|..
T Consensus       208 RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K--~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  208 RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVK--KHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             ccccCCCCccCCcccchhcchHHHHHHHHhhcCCc--cccCcchhhHHHHHHHHHHhhh
Confidence            88888888888888888888888888888888887  8888888888888888888864


No 2  
>KOG2462|consensus
Probab=99.96  E-value=1.5e-29  Score=186.50  Aligned_cols=136  Identities=24%  Similarity=0.424  Sum_probs=128.6

Q ss_pred             CCcceeeccccchhccChhhHHhhhhccCC----CcccccccccccCChHHHHHHHHhhcCCCCcccCCcccccccChHH
Q psy16829         55 DKPLLLTCVECNEDFINVNDFVSHLRGHDS----TSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTH  130 (243)
Q Consensus        55 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~----~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~  130 (243)
                      .....++|..||+.|.+..+|.+|.++|..    +.+.|+.|++.+.+...|.-|+++| .  -++.|.+||+.|...+.
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH-~--l~c~C~iCGKaFSRPWL  202 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTH-T--LPCECGICGKAFSRPWL  202 (279)
T ss_pred             ccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhcc-C--CCcccccccccccchHH
Confidence            355679999999999999999999999976    6799999999999999999999988 2  47999999999999999


Q ss_pred             HHHHHHhhcCCCCcccccccccccChhHHHHHHHHhcCCCCeeccccccccCChhHHHHHHHH
Q psy16829        131 LKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKA  193 (243)
Q Consensus       131 l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~~~~~l~~H~~~  193 (243)
                      |+.|+++|.||+||.|+.|++.|.+.++|+.|+++|.+.|+|.|..|++.|...+.|.+|...
T Consensus       203 LQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  203 LQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            999999999999999999999999999999999999999999999999999999999999764


No 3  
>KOG1074|consensus
Probab=99.92  E-value=7.9e-26  Score=188.15  Aligned_cols=80  Identities=30%  Similarity=0.517  Sum_probs=69.8

Q ss_pred             ccCCcccccccChHHHHHHHHhhcCCCCcccccccccccChhHHHHHHHHhcCC----CCeecc---ccccccCChhHHH
Q psy16829        116 YQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNA----FPFQCE---ICHKIFTNKSTMW  188 (243)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~----k~~~C~---~C~~~f~~~~~l~  188 (243)
                      .+|.+|.++..-..+|+-|.++|.+++||+|.+||+.|.++..|+.|+..|-..    -++.|+   +|.+.|...-.|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            899999999999999999999999999999999999999999999999877533    235677   7777787777777


Q ss_pred             HHHHHhC
Q psy16829        189 SHKKAHK  195 (243)
Q Consensus       189 ~H~~~h~  195 (243)
                      .|++.|.
T Consensus       686 QhIriH~  692 (958)
T KOG1074|consen  686 QHIRIHL  692 (958)
T ss_pred             ceEEeec
Confidence            7777776


No 4  
>KOG3608|consensus
Probab=99.92  E-value=5.2e-25  Score=167.04  Aligned_cols=181  Identities=21%  Similarity=0.417  Sum_probs=151.7

Q ss_pred             ccccccCCCCCCCCCcceeeccccchhccChhhHHhhhhccCC---CcccccccccccCChHHHHHHHHhhcCCCCcccC
Q psy16829         42 VQYEEDKDYDDGEDKPLLLTCVECNEDFINVNDFVSHLRGHDS---TSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQC  118 (243)
Q Consensus        42 ~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~---~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C  118 (243)
                      .+.....++.+.+..++.+.|+.||.-|.++..|..|++.-..   .+|.|..|.+.|.+...|..|+..| .  ..|+|
T Consensus       190 ~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rH-v--n~ykC  266 (467)
T KOG3608|consen  190 GNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRH-V--NCYKC  266 (467)
T ss_pred             ccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHh-h--hcccc
Confidence            3444556677788888999999999999999999999876544   6899999999999999999999887 2  45899


Q ss_pred             CcccccccChHHHHHHHHh-hcCCCCcccccccccccChhHHHHHHHHhcCCCCeeccc--cccccCChhHHHHHHHHhC
Q psy16829        119 NECEFVGKRLTHLKTHKKI-HEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEI--CHKIFTNKSTMWSHKKAHK  195 (243)
Q Consensus       119 ~~C~~~f~~~~~l~~H~~~-~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~--C~~~f~~~~~l~~H~~~h~  195 (243)
                      +.|+++....+.|.+|++. |...++|+|..|...|.+.++|.+|...|. +-.|.|..  |.++|.+...|++|.+.++
T Consensus       267 plCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  267 PLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             cccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            9999999999999999885 777889999999999999999999988665 77789977  9999999999999988876


Q ss_pred             -CCCCCCcccccccCccCChHHHHHHHhhcCC
Q psy16829        196 -PEDQIPWECEHCHKVYPNKRSYKRHKQVHLG  226 (243)
Q Consensus       196 -~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~  226 (243)
                       |....+|.|..|++.|++-.+|.+|++.-++
T Consensus       346 Eg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  346 EGNNPILYACHCCDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             cCCCCCceeeecchhhhccchhHHHHHHHhhc
Confidence             5555689999999999999999999865544


No 5  
>KOG3608|consensus
Probab=99.91  E-value=1.7e-24  Score=164.28  Aligned_cols=177  Identities=23%  Similarity=0.376  Sum_probs=159.0

Q ss_pred             eec--cccchhccChhhHHhhhhccCC-CcccccccccccCChHHHHHHHHhhc-CCCCcccCCcccccccChHHHHHHH
Q psy16829         60 LTC--VECNEDFINVNDFVSHLRGHDS-TSHVCDICLEAFPSSDDRDLHFLSHL-TSDGLYQCNECEFVGKRLTHLKTHK  135 (243)
Q Consensus        60 ~~C--~~C~~~~~~~~~l~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~h~-~~~~~~~C~~C~~~f~~~~~l~~H~  135 (243)
                      +.|  ..|-+.+.++..|+.|+++|.+ +...|+.|+.-|..+..|-.|++... ....+|.|..|.+.|.+...|..|+
T Consensus       178 ~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv  257 (467)
T KOG3608|consen  178 TMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHV  257 (467)
T ss_pred             eeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHH
Confidence            455  5799999999999999999998 78899999999999999999998653 2455899999999999999999999


Q ss_pred             HhhcCCCCcccccccccccChhHHHHHHHHhc-CCCCeeccccccccCChhHHHHHHHHhCCCCCCCccccc--ccCccC
Q psy16829        136 KIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEH-NAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEH--CHKVYP  212 (243)
Q Consensus       136 ~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~-~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~--C~~~f~  212 (243)
                      ..|..  .|+|+.|.-.....+.|..|++..| .+|||+|..|.+.+.+.+.|.+|+..|. +.  .|.|..  |.++|.
T Consensus       258 ~rHvn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~--~y~C~h~~C~~s~r  332 (467)
T KOG3608|consen  258 VRHVN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KT--VYQCEHPDCHYSVR  332 (467)
T ss_pred             HHhhh--cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-cc--ceecCCCCCcHHHH
Confidence            98864  6899999999999999999998755 7899999999999999999999999988 44  799988  999999


Q ss_pred             ChHHHHHHHhh-cCCCC---CCCCCCCCCccCc
Q psy16829        213 NKRSYKRHKQV-HLGVK---HECEGGPIPALAL  241 (243)
Q Consensus       213 ~~~~l~~H~~~-H~~~~---~~c~~c~~~~~~~  241 (243)
                      +...|++|.+. |.|.+   |.|.-|++.|+++
T Consensus       333 ~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G  365 (467)
T KOG3608|consen  333 TYTQMRRHFLEVHEGNNPILYACHCCDRFFTSG  365 (467)
T ss_pred             HHHHHHHHHHHhccCCCCCceeeecchhhhccc
Confidence            99999999875 44666   9999999999875


No 6  
>KOG3623|consensus
Probab=99.90  E-value=1.5e-24  Score=178.08  Aligned_cols=69  Identities=28%  Similarity=0.585  Sum_probs=65.1

Q ss_pred             eeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHhhcCCCC-CCCCCCCCCccCcC
Q psy16829        172 FQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVK-HECEGGPIPALALF  242 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~-~~c~~c~~~~~~~~  242 (243)
                      |.|..|.+.|...++|.+|.-.|+|.+  ||+|.+|.+.|+.+-+|..|+|.|.|++ |.|..|+|.|+..+
T Consensus       895 yaCDqCDK~FqKqSSLaRHKYEHsGqR--PyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSG  964 (1007)
T KOG3623|consen  895 YACDQCDKAFQKQSSLARHKYEHSGQR--PYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSG  964 (1007)
T ss_pred             chHHHHHHHHHhhHHHHHhhhhhcCCC--CcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhccccc
Confidence            679999999999999999999999999  9999999999999999999999999999 99999999998764


No 7  
>KOG3623|consensus
Probab=99.86  E-value=1.4e-22  Score=166.68  Aligned_cols=77  Identities=32%  Similarity=0.773  Sum_probs=75.6

Q ss_pred             cccccccccccChhHHHHHHHHhcCCCCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHh
Q psy16829        144 VYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      |.|+.|.+.|...+.|.+|.-.|+|.+||+|.+|.+.|..+-.|..|.|.|.|++  ||.|..|+++|....++.+||.
T Consensus       895 yaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEK--PfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  895 YACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEK--PFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             chHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCC--cchhhhhhhhcccccchHhhhc
Confidence            8999999999999999999999999999999999999999999999999999999  9999999999999999999985


No 8  
>KOG1074|consensus
Probab=99.83  E-value=4.3e-22  Score=166.16  Aligned_cols=51  Identities=25%  Similarity=0.549  Sum_probs=45.1

Q ss_pred             eeeccccchhccChhhHHhhhhccCC-CcccccccccccCChHHHHHHHHhh
Q psy16829         59 LLTCVECNEDFINVNDFVSHLRGHDS-TSHVCDICLEAFPSSDDRDLHFLSH  109 (243)
Q Consensus        59 ~~~C~~C~~~~~~~~~l~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~h  109 (243)
                      +.+|.+|.+.|...+.|+.|++.|++ +||+|.+||..|.++.+|..|...|
T Consensus       353 khkCr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTkGNLKvH~~rH  404 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTKGNLKVHFQRH  404 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccccceeeeeeec
Confidence            46799999999999999999999988 8999999999999999998888777


No 9  
>KOG3576|consensus
Probab=99.74  E-value=8.4e-19  Score=123.74  Aligned_cols=111  Identities=25%  Similarity=0.381  Sum_probs=64.4

Q ss_pred             cccccccccccCChHHHHHHHHhhcCCCCcccCCcccccccChHHHHHHHHhhcCCCCcccccccccccChhHHHHHHHH
Q psy16829         86 SHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIK  165 (243)
Q Consensus        86 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  165 (243)
                      .+.|.+|++.|.-...|.+|++.| ...+.|.|..|++.|.+.-+|++|+++|.+.+||+|..|++.|.....|..|.+.
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch-~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~k  195 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCH-SDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKK  195 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhc-cHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHH
Confidence            355555555555555555555555 4555555555555555555555555555555555555555555555555555554


Q ss_pred             hcC-----------CCCeeccccccccCChhHHHHHHHHhCCC
Q psy16829        166 EHN-----------AFPFQCEICHKIFTNKSTMWSHKKAHKPE  197 (243)
Q Consensus       166 ~~~-----------~k~~~C~~C~~~f~~~~~l~~H~~~h~~~  197 (243)
                      .|+           +|.|.|..||+.-.....+..|++.|+..
T Consensus       196 vhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  196 VHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             HcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence            442           45566666666666666666666666543


No 10 
>KOG3576|consensus
Probab=99.73  E-value=1.4e-18  Score=122.57  Aligned_cols=116  Identities=24%  Similarity=0.472  Sum_probs=104.5

Q ss_pred             CCCcccCCcccccccChHHHHHHHHhhcCCCCcccccccccccChhHHHHHHHHhcCCCCeeccccccccCChhHHHHHH
Q psy16829        112 SDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHK  191 (243)
Q Consensus       112 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~~~~~l~~H~  191 (243)
                      +...|.|.+|++.|.....|.+|++.|...+.+.|..||+.|.+..+|.+|.++|+|-+||+|..|++.|.+..+|..|+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            44569999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhCCC---------CCCCcccccccCccCChHHHHHHHhhcCCC
Q psy16829        192 KAHKPE---------DQIPWECEHCHKVYPNKRSYKRHKQVHLGV  227 (243)
Q Consensus       192 ~~h~~~---------~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~  227 (243)
                      +.-|+.         +.+.|.|+.||.+-.....+..|++.|+..
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence            987753         234799999999999999999999988753


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.49  E-value=4e-13  Score=111.59  Aligned_cols=146  Identities=15%  Similarity=0.314  Sum_probs=112.9

Q ss_pred             CcceeeccccchhccChhhHHhhhhccCCCcccccc--cccccCChHHHHHHHHhhcCCCCcccCCcccccccChHHHHH
Q psy16829         56 KPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDI--CLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKT  133 (243)
Q Consensus        56 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~  133 (243)
                      ......|+.|..... ...|..|........-.|+.  |+..|.. ..          .+..+.|+.|+..|. ...|..
T Consensus       404 ~~~~V~C~NC~~~i~-l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r-~e----------l~~H~~C~~Cgk~f~-~s~Lek  470 (567)
T PLN03086        404 DVDTVECRNCKHYIP-SRSIALHEAYCSRHNVVCPHDGCGIVLRV-EE----------AKNHVHCEKCGQAFQ-QGEMEK  470 (567)
T ss_pred             CCCeEECCCCCCccc-hhHHHHHHhhCCCcceeCCcccccceeec-cc----------cccCccCCCCCCccc-hHHHHH
Confidence            344578999988655 44677887655545567885  9988832 22          233468999999985 677999


Q ss_pred             HHHhhcCCCCcccccccccccChhHHHHHHHHhcCCCCeeccccccccCC----------hhHHHHHHHHhCCCCCCCcc
Q psy16829        134 HKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTN----------KSTMWSHKKAHKPEDQIPWE  203 (243)
Q Consensus       134 H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~~----------~~~l~~H~~~h~~~~~~~~~  203 (243)
                      |+..++  .++.|+ |+..+ ....|..|+..+...+++.|+.|++.|..          .+.|..|.... +.+  ++.
T Consensus       471 H~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~r--t~~  543 (567)
T PLN03086        471 HMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSR--TAP  543 (567)
T ss_pred             HHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCc--ceE
Confidence            999875  789999 99755 56899999999999999999999999852          35899998885 777  999


Q ss_pred             cccccCccCChHHHHHHHh
Q psy16829        204 CEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       204 C~~C~~~f~~~~~l~~H~~  222 (243)
                      |..|++.|..+ .|..|+-
T Consensus       544 C~~Cgk~Vrlr-dm~~H~~  561 (567)
T PLN03086        544 CDSCGRSVMLK-EMDIHQI  561 (567)
T ss_pred             ccccCCeeeeh-hHHHHHH
Confidence            99999998766 5788864


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.36  E-value=1.6e-12  Score=108.13  Aligned_cols=134  Identities=23%  Similarity=0.437  Sum_probs=104.9

Q ss_pred             ccccccccccCChHHHHHHHHhhcCCCCcccCCc--ccccccChHHHHHHHHhhcCCCCcccccccccccChhHHHHHHH
Q psy16829         87 HVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNE--CEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKI  164 (243)
Q Consensus        87 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  164 (243)
                      -.|+.|..... ...|..|.... . ...-.|+.  |+..|... .+         +..+.|+.|++.|. ...|..|+.
T Consensus       408 V~C~NC~~~i~-l~~l~lHe~~C-~-r~~V~Cp~~~Cg~v~~r~-el---------~~H~~C~~Cgk~f~-~s~LekH~~  473 (567)
T PLN03086        408 VECRNCKHYIP-SRSIALHEAYC-S-RHNVVCPHDGCGIVLRVE-EA---------KNHVHCEKCGQAFQ-QGEMEKHMK  473 (567)
T ss_pred             EECCCCCCccc-hhHHHHHHhhC-C-CcceeCCcccccceeecc-cc---------ccCccCCCCCCccc-hHHHHHHHH
Confidence            46999987654 56677888655 2 22345774  88887333 23         33368999999996 678999999


Q ss_pred             HhcCCCCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccC----------ChHHHHHHHhhcCCCC-CCCCC
Q psy16829        165 KEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYP----------NKRSYKRHKQVHLGVK-HECEG  233 (243)
Q Consensus       165 ~~~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~----------~~~~l~~H~~~H~~~~-~~c~~  233 (243)
                      .+|  +++.|+ ||+.+ .+..|..|+..|.+.+  |+.|+.|++.|.          ..+.|..|+.+. |.+ +.|..
T Consensus       474 ~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~K--pi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~  546 (567)
T PLN03086        474 VFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLR--LITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDS  546 (567)
T ss_pred             hcC--CCccCC-CCCCc-chhHHHhhhhccCCCC--ceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccc
Confidence            886  889999 99765 6789999999999998  999999999995          246899999986 777 99999


Q ss_pred             CCCCccCc
Q psy16829        234 GPIPALAL  241 (243)
Q Consensus       234 c~~~~~~~  241 (243)
                      ||+.|..+
T Consensus       547 Cgk~Vrlr  554 (567)
T PLN03086        547 CGRSVMLK  554 (567)
T ss_pred             cCCeeeeh
Confidence            99987643


No 13 
>PHA00733 hypothetical protein
Probab=99.32  E-value=2e-12  Score=88.20  Aligned_cols=83  Identities=16%  Similarity=0.232  Sum_probs=63.7

Q ss_pred             CCCcccccccccccChhHHHHH--H---HHhcCCCCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChH
Q psy16829        141 VYGVYCDVCGRGFHQNNEVTLH--K---IKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKR  215 (243)
Q Consensus       141 ~~~~~C~~C~~~f~~~~~l~~H--~---~~~~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~  215 (243)
                      .+++.|.+|.+.|.....|..+  +   ...++.+||.|+.|++.|.....|..|++.+  ..  +|.|+.|++.|....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~--~~~C~~CgK~F~~~~  113 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EH--SKVCPVCGKEFRNTD  113 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--Cc--CccCCCCCCccCCHH
Confidence            4456677776666655555444  1   2334688999999999999999999999876  34  799999999999999


Q ss_pred             HHHHHHhhcCCC
Q psy16829        216 SYKRHKQVHLGV  227 (243)
Q Consensus       216 ~l~~H~~~H~~~  227 (243)
                      .|.+|++..+++
T Consensus       114 sL~~H~~~~h~~  125 (128)
T PHA00733        114 STLDHVCKKHNI  125 (128)
T ss_pred             HHHHHHHHhcCc
Confidence            999999877763


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.19  E-value=1.5e-11  Score=69.22  Aligned_cols=42  Identities=21%  Similarity=0.321  Sum_probs=31.0

Q ss_pred             CcccccccCccCChHHHHHHHhhcCCCCCCCCCCCCCccCcCC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGPIPALALFE  243 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~c~~c~~~~~~~~~  243 (243)
                      .|+|+.||+.|...++|..|+++|+ ..|.|..|++.|+++++
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~   46 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGE   46 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceecccce
Confidence            5777778888877777888877777 23777777777776653


No 15 
>PHA00733 hypothetical protein
Probab=99.14  E-value=5.3e-11  Score=81.22  Aligned_cols=82  Identities=15%  Similarity=0.143  Sum_probs=50.2

Q ss_pred             CCcccCCcccccccChHHHHHH--HH---hhcCCCCcccccccccccChhHHHHHHHHhcCCCCeeccccccccCChhHH
Q psy16829        113 DGLYQCNECEFVGKRLTHLKTH--KK---IHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTM  187 (243)
Q Consensus       113 ~~~~~C~~C~~~f~~~~~l~~H--~~---~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~~~~~l  187 (243)
                      .+++.|.+|...|.....|..+  +.   .+.+.++|.|+.|++.|.....|..|++.+  ..+|.|+.|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            3445555555555554444443  11   223456677777777777777777776654  3457777777777777777


Q ss_pred             HHHHHHhCC
Q psy16829        188 WSHKKAHKP  196 (243)
Q Consensus       188 ~~H~~~h~~  196 (243)
                      ..|+...|+
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            777776654


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.99  E-value=1.9e-10  Score=64.79  Aligned_cols=43  Identities=21%  Similarity=0.641  Sum_probs=34.3

Q ss_pred             CeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHH
Q psy16829        171 PFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSY  217 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l  217 (243)
                      .|.|+.||+.|...+.|..|+++|+  +  ||+|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k--~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--T--NLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--C--cccCCcccceeccccee
Confidence            3678888888888888888888887  4  78888888888876655


No 17 
>KOG3993|consensus
Probab=98.91  E-value=3.1e-10  Score=89.32  Aligned_cols=163  Identities=12%  Similarity=0.158  Sum_probs=102.6

Q ss_pred             eeeccccchhccChhhHHhhhhccCC-CcccccccccccCChHHHHHHHHhhcCCCCcccCCcc-cc-cccChHHHHHHH
Q psy16829         59 LLTCVECNEDFINVNDFVSHLRGHDS-TSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNEC-EF-VGKRLTHLKTHK  135 (243)
Q Consensus        59 ~~~C~~C~~~~~~~~~l~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C-~~-~f~~~~~l~~H~  135 (243)
                      -|+|.+|...|.+.-.|..|.=.-.- ..|+|+.|+++|....+|-.|.++|-.....-.=..= .+ ........+.-.
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            49999999999999999999532222 6899999999999999999999999311111100000 00 000000000000


Q ss_pred             Hh--hcCCCCcccccccccccChhHHHHHHHHhcCC--------------------------------------------
Q psy16829        136 KI--HEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNA--------------------------------------------  169 (243)
Q Consensus       136 ~~--~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~--------------------------------------------  169 (243)
                      +.  ...+..|.|..|++.|....-|+.|+..|+..                                            
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~  426 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAG  426 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeec
Confidence            00  11223566666666666666666666555421                                            


Q ss_pred             --CCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHhh
Q psy16829        170 --FPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQV  223 (243)
Q Consensus       170 --k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  223 (243)
                        -...|+.|+..+..+..--.+.+....+.  .|.|.+|.-+|-+.-+|.+|+..
T Consensus       427 sael~~pp~~~~ppsss~~sgg~~rlg~~~q--~f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  427 SAELELPPYDGSPPSSSGSSGGYGRLGIAEQ--GFTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             cccccCCCCCCCCcccCCCCCccccccchhh--ccccccchHhhhcCcchHhHhhh
Confidence              00247778877777655555555555555  79999999999999999999864


No 18 
>KOG3993|consensus
Probab=98.86  E-value=3.6e-10  Score=88.90  Aligned_cols=155  Identities=15%  Similarity=0.199  Sum_probs=100.6

Q ss_pred             cccccccccccCChHHHHHHHHhhcCCCCcccCCcccccccChHHHHHHHHhhcCCCCcc---cccccccccChhHHHHH
Q psy16829         86 SHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVY---CDVCGRGFHQNNEVTLH  162 (243)
Q Consensus        86 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~---C~~C~~~f~~~~~l~~H  162 (243)
                      .|.|++|...|.+...|-+|.-.. .-..-|+|+.|++.|.-..+|..|.+=|.....-.   -+-=.+........+.-
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~R-IV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPR-IVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCe-eEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            388999999999999999997433 22235999999999999999999988764221100   00000000111111110


Q ss_pred             HHH--hcCCCCeeccccccccCChhHHHHHHHHhCCCCC-----------------------------------------
Q psy16829        163 KIK--EHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQ-----------------------------------------  199 (243)
Q Consensus       163 ~~~--~~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~-----------------------------------------  199 (243)
                      .+.  ...+.-|.|..|++.|.....|+.|+.+|+....                                         
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a  425 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVA  425 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeee
Confidence            000  0123469999999999999999999888763210                                         


Q ss_pred             ---CCcccccccCccCChHHHHHHHhhcCCCC-CCCCCCCCCccCc
Q psy16829        200 ---IPWECEHCHKVYPNKRSYKRHKQVHLGVK-HECEGGPIPALAL  241 (243)
Q Consensus       200 ---~~~~C~~C~~~f~~~~~l~~H~~~H~~~~-~~c~~c~~~~~~~  241 (243)
                         ..-.|+.|+--+.++..=..+.+.-.-+- |.|..|.-.|.+.
T Consensus       426 ~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss  471 (500)
T KOG3993|consen  426 GSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSS  471 (500)
T ss_pred             ccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcC
Confidence               02457778877777766666666544444 8899888888764


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.74  E-value=6.9e-09  Score=49.98  Aligned_cols=24  Identities=29%  Similarity=0.791  Sum_probs=14.6

Q ss_pred             HHHHHHHhCCCCCCCcccccccCccC
Q psy16829        187 MWSHKKAHKPEDQIPWECEHCHKVYP  212 (243)
Q Consensus       187 l~~H~~~h~~~~~~~~~C~~C~~~f~  212 (243)
                      |.+|++.|++++  ||.|+.|+++|.
T Consensus         2 l~~H~~~H~~~k--~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEK--PYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSS--SEEESSSSEEES
T ss_pred             HHHHhhhcCCCC--CCCCCCCcCeeC
Confidence            556666666665  666666666654


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.71  E-value=4.3e-09  Score=50.70  Aligned_cols=25  Identities=24%  Similarity=0.308  Sum_probs=23.2

Q ss_pred             HHHHHHhhcCCCC-CCCCCCCCCccC
Q psy16829        216 SYKRHKQVHLGVK-HECEGGPIPALA  240 (243)
Q Consensus       216 ~l~~H~~~H~~~~-~~c~~c~~~~~~  240 (243)
                      +|.+|+++|+|++ |.|+.|+++|..
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            5899999999999 999999999974


No 21 
>PHA00616 hypothetical protein
Probab=98.68  E-value=3.7e-09  Score=56.60  Aligned_cols=33  Identities=15%  Similarity=0.252  Sum_probs=18.3

Q ss_pred             CcccccccCccCChHHHHHHHhhcCCCC-CCCCC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLGVK-HECEG  233 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~-~~c~~  233 (243)
                      ||+|+.||+.|...++|.+|++.|+|++ +.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            4555555555555555555555555555 54443


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.60  E-value=7.9e-08  Score=55.37  Aligned_cols=53  Identities=19%  Similarity=0.332  Sum_probs=39.7

Q ss_pred             CeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHhhcCC
Q psy16829        171 PFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLG  226 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~  226 (243)
                      .|.||+|++. .+...|..|....|....+.+.||+|...+.  .+|.+|+..+++
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            3789999994 5567889998876655444788999988654  489999887653


No 23 
>PHA00616 hypothetical protein
Probab=98.56  E-value=3.3e-08  Score=53.00  Aligned_cols=36  Identities=22%  Similarity=0.333  Sum_probs=28.1

Q ss_pred             CeeccccccccCChhHHHHHHHHhCCCCCCCccccccc
Q psy16829        171 PFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCH  208 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~  208 (243)
                      ||+|+.||+.|...+.|..|++.||+++  |+.|+.=-
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~--~~~~~~~y   36 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQN--KLTLEYFY   36 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCC--ccceeEEE
Confidence            5778888888888888888888888887  77776543


No 24 
>PHA00732 hypothetical protein
Probab=98.45  E-value=1.4e-07  Score=58.47  Aligned_cols=48  Identities=21%  Similarity=0.417  Sum_probs=25.6

Q ss_pred             CeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHhhcC
Q psy16829        171 PFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHL  225 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~  225 (243)
                      ||.|..|++.|.....|..|++.++.    ++.|+.|+++|.   .|..|.+.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~----~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT----LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC----CCccCCCCCEeC---ChhhhhcccC
Confidence            35566666666666666666553221    334666666665   3555554433


No 25 
>PHA00732 hypothetical protein
Probab=98.44  E-value=1.8e-07  Score=57.92  Aligned_cols=39  Identities=18%  Similarity=0.204  Sum_probs=35.0

Q ss_pred             CcccccccCccCChHHHHHHHhh-cCCCCCCCCCCCCCccCc
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQV-HLGVKHECEGGPIPALAL  241 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~-H~~~~~~c~~c~~~~~~~  241 (243)
                      ||.|+.|++.|.+.++|..|++. |.+  +.|+.||++|.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~--~~C~~CgKsF~~l   40 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL--TKCPVCNKSYRRL   40 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC--CccCCCCCEeCCh
Confidence            68999999999999999999984 664  6899999999865


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.28  E-value=4.5e-07  Score=42.37  Aligned_cols=23  Identities=35%  Similarity=0.793  Sum_probs=16.7

Q ss_pred             cccccccCccCChHHHHHHHhhc
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQVH  224 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~~H  224 (243)
                      |.|+.|++.|.+..+|.+|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56777777777777777777654


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.12  E-value=5.3e-06  Score=47.70  Aligned_cols=49  Identities=24%  Similarity=0.537  Sum_probs=25.1

Q ss_pred             cccccccccccChhHHHHHHHHhcC--CCCeeccccccccCChhHHHHHHHHhC
Q psy16829        144 VYCDVCGRGFHQNNEVTLHKIKEHN--AFPFQCEICHKIFTNKSTMWSHKKAHK  195 (243)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~~~~--~k~~~C~~C~~~f~~~~~l~~H~~~h~  195 (243)
                      |.|+.|++. .+...|..|....|.  .+.+.||+|...+.  .+|..|+..+|
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            455666553 334455555554442  23455666655433  25666665544


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.03  E-value=3.8e-06  Score=39.49  Aligned_cols=24  Identities=25%  Similarity=0.682  Sum_probs=14.7

Q ss_pred             cccccccCccCChHHHHHHHhhcC
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQVHL  225 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~~H~  225 (243)
                      |.|++|++.|.+...|..|++.|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            457777777777777777766553


No 29 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.01  E-value=3.5e-06  Score=40.97  Aligned_cols=26  Identities=31%  Similarity=0.841  Sum_probs=20.3

Q ss_pred             CcccccccCccCChHHHHHHHhhcCC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLG  226 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~  226 (243)
                      ||.|..|++.|.+...|..|++.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57788888888888888888877753


No 30 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.95  E-value=7.1e-06  Score=38.18  Aligned_cols=23  Identities=39%  Similarity=0.872  Sum_probs=16.8

Q ss_pred             eeccccccccCChhHHHHHHHHh
Q psy16829        172 FQCEICHKIFTNKSTMWSHKKAH  194 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h  194 (243)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56777777777777777777663


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.79  E-value=2.2e-05  Score=36.73  Aligned_cols=24  Identities=46%  Similarity=0.904  Sum_probs=16.7

Q ss_pred             eeccccccccCChhHHHHHHHHhC
Q psy16829        172 FQCEICHKIFTNKSTMWSHKKAHK  195 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h~  195 (243)
                      |.|++|++.|.+...|..|+++|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            567778888888888888877764


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.72  E-value=2.4e-05  Score=51.34  Aligned_cols=22  Identities=23%  Similarity=0.295  Sum_probs=0.0

Q ss_pred             CCcccccccChHHHHHHHHhhc
Q psy16829        118 CNECEFVGKRLTHLKTHKKIHE  139 (243)
Q Consensus       118 C~~C~~~f~~~~~l~~H~~~~~  139 (243)
                      |..|+..|.+...|..|+...+
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H   23 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKH   23 (100)
T ss_dssp             ----------------------
T ss_pred             cccccccccccccccccccccc
Confidence            4555555555555555554433


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.69  E-value=3.8e-05  Score=50.34  Aligned_cols=21  Identities=19%  Similarity=0.730  Sum_probs=10.7

Q ss_pred             cccccccCccCChHHHHHHHh
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      +.|..|++.|.+...|..|++
T Consensus        51 ~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen   51 FRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             EEBSSSS-EESSHHHHHHHHH
T ss_pred             CCCCccCCCCcCHHHHHHHHc
Confidence            455555555555555555554


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.61  E-value=3.4e-05  Score=37.38  Aligned_cols=25  Identities=40%  Similarity=0.909  Sum_probs=19.2

Q ss_pred             CeeccccccccCChhHHHHHHHHhC
Q psy16829        171 PFQCEICHKIFTNKSTMWSHKKAHK  195 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~  195 (243)
                      ||.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4778888888888888888877665


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.59  E-value=6.7e-05  Score=35.72  Aligned_cols=24  Identities=33%  Similarity=0.797  Sum_probs=18.8

Q ss_pred             cccccccCccCChHHHHHHHhhcC
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQVHL  225 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~~H~  225 (243)
                      |.|+.|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            568888888888888888887664


No 36 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.37  E-value=0.00011  Score=34.50  Aligned_cols=23  Identities=35%  Similarity=0.700  Sum_probs=13.9

Q ss_pred             cccccccCccCChHHHHHHHhhcC
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQVHL  225 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~~H~  225 (243)
                      |.|+.|++... ...|.+|++.|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56777776666 667777766654


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.35  E-value=0.00011  Score=40.29  Aligned_cols=26  Identities=27%  Similarity=0.516  Sum_probs=13.4

Q ss_pred             CcccccccCccCChHHHHHHHhhcCC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLG  226 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~  226 (243)
                      |-.|++|+..+.+..+|.+|+.++++
T Consensus        24 PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCcchhhccchhhHHHHHHHHhc
Confidence            56666666666666666666655544


No 38 
>KOG2231|consensus
Probab=97.28  E-value=0.00091  Score=57.51  Aligned_cols=99  Identities=19%  Similarity=0.337  Sum_probs=64.5

Q ss_pred             ccccccccCChHHHHHHHHhhcCCCCcccCCcccc---------cccChHHHHHHHHhh-cCCC----Cccccccccccc
Q psy16829         89 CDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEF---------VGKRLTHLKTHKKIH-EKVY----GVYCDVCGRGFH  154 (243)
Q Consensus        89 C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~---------~f~~~~~l~~H~~~~-~~~~----~~~C~~C~~~f~  154 (243)
                      |..| -.|.....|+.|+...|   +.+.|.+|-.         ...+...|..|++.- .++.    .-.|..|...|.
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H---~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fl  193 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQH---KLHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFL  193 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhh---hhhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhc
Confidence            4444 33446778888885432   3455555432         334455677777642 1122    246889999999


Q ss_pred             ChhHHHHHHHHhcCCCCeeccccc------cccCChhHHHHHHHHhC
Q psy16829        155 QNNEVTLHKIKEHNAFPFQCEICH------KIFTNKSTMWSHKKAHK  195 (243)
Q Consensus       155 ~~~~l~~H~~~~~~~k~~~C~~C~------~~f~~~~~l~~H~~~h~  195 (243)
                      ....|..|++..|    |.|.+|.      .-|..-..|..|.+.+|
T Consensus       194 d~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  194 DDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            9999999988776    5666663      44677788888888875


No 39 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.23  E-value=0.0001  Score=56.71  Aligned_cols=55  Identities=27%  Similarity=0.659  Sum_probs=43.7

Q ss_pred             CCCCeeccc--cccccCChhHHHHHHHHhCC-----------------CCCCCcccccccCccCChHHHHHHHh
Q psy16829        168 NAFPFQCEI--CHKIFTNKSTMWSHKKAHKP-----------------EDQIPWECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       168 ~~k~~~C~~--C~~~f~~~~~l~~H~~~h~~-----------------~~~~~~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      ++|||.|++  |.+.|.+...|.-|+.-.|-                 -+.+||.|+.|+++++....|+-|++
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            358999987  99999999999988775441                 01249999999999999988888865


No 40 
>KOG2231|consensus
Probab=97.17  E-value=0.00086  Score=57.66  Aligned_cols=121  Identities=24%  Similarity=0.494  Sum_probs=82.1

Q ss_pred             ccccccccccCChHHHHHHHHhhcCCCCcccCCcccccccChHHHHHHHHhhcCCCCcccccc---------cccccChh
Q psy16829         87 HVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVC---------GRGFHQNN  157 (243)
Q Consensus        87 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C---------~~~f~~~~  157 (243)
                      +.|..|++.|.-.             .....|..| ..|.....|+.|+...++.  +.|..|         .....+..
T Consensus       100 ~~C~~C~~~~~~~-------------~~~~~~~~c-~~~~s~~~Lk~H~~~~H~~--~~c~lC~~~~kif~~e~k~Yt~~  163 (669)
T KOG2231|consen  100 HSCHICDRRFRAL-------------YNKKECLHC-TEFKSVENLKNHMRDQHKL--HLCSLCLQNLKIFINERKLYTRA  163 (669)
T ss_pred             hhcCccccchhhh-------------cccCCCccc-cchhHHHHHHHHHHHhhhh--hccccccccceeeeeeeehehHH
Confidence            6788888876321             112457888 7888999999999764432  234333         22334566


Q ss_pred             HHHHHHHHhcC-CCC----eeccccccccCChhHHHHHHHHhCCCCCCCcccccc------cCccCChHHHHHHHhhcCC
Q psy16829        158 EVTLHKIKEHN-AFP----FQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHC------HKVYPNKRSYKRHKQVHLG  226 (243)
Q Consensus       158 ~l~~H~~~~~~-~k~----~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C------~~~f~~~~~l~~H~~~H~~  226 (243)
                      .|..|+..--. +..    -.|..|...|.....|.+|++.+|      |.|..|      +..|.....|..|-|.+| 
T Consensus       164 el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h------~~chfC~~~~~~neyy~~~~dLe~HfR~~H-  236 (669)
T KOG2231|consen  164 ELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH------EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH-  236 (669)
T ss_pred             HHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccce------eheeecCcccccchhcccchHHHHHhhhcC-
Confidence            77777664321 211    369999999999999999998865      445555      566888889999888777 


Q ss_pred             CCCCCC
Q psy16829        227 VKHECE  232 (243)
Q Consensus       227 ~~~~c~  232 (243)
                        |.|+
T Consensus       237 --flCE  240 (669)
T KOG2231|consen  237 --FLCE  240 (669)
T ss_pred             --cccc
Confidence              5665


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.12  E-value=0.00014  Score=56.01  Aligned_cols=25  Identities=32%  Similarity=0.777  Sum_probs=21.6

Q ss_pred             CCCCeeccccccccCChhHHHHHHH
Q psy16829        168 NAFPFQCEICHKIFTNKSTMWSHKK  192 (243)
Q Consensus       168 ~~k~~~C~~C~~~f~~~~~l~~H~~  192 (243)
                      ..|||+|++|++.|.+...|.-|..
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCCceeccccchhhccCccceeccc
Confidence            4699999999999999988887754


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.07  E-value=0.00031  Score=33.20  Aligned_cols=22  Identities=23%  Similarity=0.705  Sum_probs=17.3

Q ss_pred             cccccccCccCChHHHHHHHhh
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQV  223 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~~  223 (243)
                      |.|.+|+..|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5688888888888888888764


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=97.03  E-value=0.00032  Score=49.80  Aligned_cols=36  Identities=22%  Similarity=0.556  Sum_probs=22.0

Q ss_pred             CcccccccCccCChHHHHHHHhhcCCCC-CCCCCCCCCccC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLGVK-HECEGGPIPALA  240 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~-~~c~~c~~~~~~  240 (243)
                      +|.|. |+.   ...++.+|.++|+|++ |.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            56665 664   4555666666666666 666666666543


No 44 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.00  E-value=0.00046  Score=37.96  Aligned_cols=25  Identities=20%  Similarity=0.339  Sum_probs=10.8

Q ss_pred             CcccccccccccCChHHHHHHHHhh
Q psy16829         85 TSHVCDICLEAFPSSDDRDLHFLSH  109 (243)
Q Consensus        85 ~~~~C~~C~~~f~~~~~l~~H~~~h  109 (243)
                      .|.+|+.|+..+....+|++|+...
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~   47 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIR   47 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHH
T ss_pred             CCCCCCcchhhccchhhHHHHHHHH
Confidence            4455555555555555555555443


No 45 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.87  E-value=0.001  Score=31.38  Aligned_cols=24  Identities=33%  Similarity=0.805  Sum_probs=16.0

Q ss_pred             eeccccccccCChhHHHHHHHHhC
Q psy16829        172 FQCEICHKIFTNKSTMWSHKKAHK  195 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h~  195 (243)
                      |.|+.|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            456777777777777777776543


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.87  E-value=0.00081  Score=31.41  Aligned_cols=23  Identities=30%  Similarity=0.583  Sum_probs=16.3

Q ss_pred             eeccccccccCChhHHHHHHHHhC
Q psy16829        172 FQCEICHKIFTNKSTMWSHKKAHK  195 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h~  195 (243)
                      |.|+.|++... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            57888888887 778888887765


No 47 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.59  E-value=0.0012  Score=31.16  Aligned_cols=20  Identities=40%  Similarity=0.740  Sum_probs=9.9

Q ss_pred             eccccchhccChhhHHhhhh
Q psy16829         61 TCVECNEDFINVNDFVSHLR   80 (243)
Q Consensus        61 ~C~~C~~~~~~~~~l~~H~~   80 (243)
                      .|.+|++.|.+...|..|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            44555555555555555544


No 48 
>PRK04860 hypothetical protein; Provisional
Probab=96.55  E-value=0.0018  Score=46.08  Aligned_cols=39  Identities=26%  Similarity=0.748  Sum_probs=31.2

Q ss_pred             CCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCCh
Q psy16829        170 FPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNK  214 (243)
Q Consensus       170 k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~  214 (243)
                      -+|.|. |+.   ....+++|.++|.+++  +|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~--~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEA--VYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCc--cEECCCCCceeEEe
Confidence            468887 886   6667888888888888  89998898887643


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.41  E-value=0.00092  Score=32.24  Aligned_cols=22  Identities=23%  Similarity=0.700  Sum_probs=17.6

Q ss_pred             cccccccCccCChHHHHHHHhh
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQV  223 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~~  223 (243)
                      |-|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888888753


No 50 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.40  E-value=0.0032  Score=29.70  Aligned_cols=21  Identities=19%  Similarity=0.640  Sum_probs=15.5

Q ss_pred             cccccccCccCChHHHHHHHhh
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQV  223 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~~  223 (243)
                      ..|+.|+++| ..+.|.+|+++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4688888888 66778888653


No 51 
>KOG1146|consensus
Probab=96.37  E-value=0.0024  Score=58.46  Aligned_cols=160  Identities=10%  Similarity=0.113  Sum_probs=100.6

Q ss_pred             eeccccchhccChhhHHhhhhccCC--CcccccccccccCChHHHHHHHHhhc------------------------CCC
Q psy16829         60 LTCVECNEDFINVNDFVSHLRGHDS--TSHVCDICLEAFPSSDDRDLHFLSHL------------------------TSD  113 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~l~~H~~~h~~--~~~~C~~C~~~f~~~~~l~~H~~~h~------------------------~~~  113 (243)
                      ..|.-|+..+.....+..|+..-+.  +.++|+.|+..|.....|..|++..|                        .+.
T Consensus       437 ~e~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~  516 (1406)
T KOG1146|consen  437 VELTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPG  516 (1406)
T ss_pred             ccccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCC
Confidence            4566666666666666666554333  67888888888888888888887632                        234


Q ss_pred             CcccCCcccccccChHHHHHHHHhh--cCC----------C----Cc-cccccccccc--ChhHHHHHHHHhcCCCCeec
Q psy16829        114 GLYQCNECEFVGKRLTHLKTHKKIH--EKV----------Y----GV-YCDVCGRGFH--QNNEVTLHKIKEHNAFPFQC  174 (243)
Q Consensus       114 ~~~~C~~C~~~f~~~~~l~~H~~~~--~~~----------~----~~-~C~~C~~~f~--~~~~l~~H~~~~~~~k~~~C  174 (243)
                      ++|.|..|...+....+|.+|+...  ..+          .    +. .+..+...-.  ..+....    .-..-.|.|
T Consensus       517 ~p~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~----pktkP~~~C  592 (1406)
T KOG1146|consen  517 KPYPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSG----PKTKPSWRC  592 (1406)
T ss_pred             CcccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCC----CCCCCCcch
Confidence            5688888888888888888887642  111          0    00 0111100000  0000000    001223789


Q ss_pred             cccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHhhc
Q psy16829        175 EICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVH  224 (243)
Q Consensus       175 ~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H  224 (243)
                      .+|++...-..+|+.|+........ |..|-.++-.+.....+..+.+.+
T Consensus       593 ~vc~yetniarnlrihmtss~~s~~-p~~~Lq~~it~~l~~~~~~~~~lp  641 (1406)
T KOG1146|consen  593 EVCSYETNIARNLRIHMTASPSSSP-PSLVLQQNITSSLASLLGGQGRLP  641 (1406)
T ss_pred             hhhcchhhhhhccccccccCCCCCC-hHHHhhhcchhhccccccCcCCCC
Confidence            9999999888899999887554442 588888888888887777777766


No 52 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.26  E-value=0.0024  Score=30.73  Aligned_cols=22  Identities=23%  Similarity=0.638  Sum_probs=15.6

Q ss_pred             eeccccchhccChhhHHhhhhc
Q psy16829         60 LTCVECNEDFINVNDFVSHLRG   81 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~l~~H~~~   81 (243)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777777654


No 53 
>KOG1146|consensus
Probab=95.50  E-value=0.0019  Score=59.16  Aligned_cols=147  Identities=14%  Similarity=0.205  Sum_probs=90.7

Q ss_pred             ccccccccCChHHHHHHHHhhcCCCCcccCCcccccccChHHHHHHHHhhcCCCCcccccccccccChhHHHHHHHHhcC
Q psy16829         89 CDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHN  168 (243)
Q Consensus        89 C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  168 (243)
                      |..|+..+.+...+--|+..-+...+.++|+.|+..|.....|-.|+++.+.+..-  ..|.. +.....+.+=.....+
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~~-gq~~~~~arg~~~~~~  515 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCKA-GQNHPRLARGEVYRCP  515 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccch--hHhHh-ccccccccccccccCC
Confidence            44555566666666555554335567899999999999999999999974332211  22211 1111111111111225


Q ss_pred             CCCeeccccccccCChhHHHHHHHH--hCCC----------C-----------------------------CCCcccccc
Q psy16829        169 AFPFQCEICHKIFTNKSTMWSHKKA--HKPE----------D-----------------------------QIPWECEHC  207 (243)
Q Consensus       169 ~k~~~C~~C~~~f~~~~~l~~H~~~--h~~~----------~-----------------------------~~~~~C~~C  207 (243)
                      .++|.|..|.+.+....+|.+|+..  |..+          .                             .-++.|.+|
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc  595 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVC  595 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhh
Confidence            6788999999999999999999774  2111          0                             005899999


Q ss_pred             cCccCChHHHHHHHh-hcCCCC-CCCCCCCCCc
Q psy16829        208 HKVYPNKRSYKRHKQ-VHLGVK-HECEGGPIPA  238 (243)
Q Consensus       208 ~~~f~~~~~l~~H~~-~H~~~~-~~c~~c~~~~  238 (243)
                      ++.-.-..+|.-|+. .++-.+ -.|-++..++
T Consensus       596 ~yetniarnlrihmtss~~s~~p~~~Lq~~it~  628 (1406)
T KOG1146|consen  596 SYETNIARNLRIHMTASPSSSPPSLVLQQNITS  628 (1406)
T ss_pred             cchhhhhhccccccccCCCCCChHHHhhhcchh
Confidence            999888889999986 333333 4444444444


No 54 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.32  E-value=0.0029  Score=52.85  Aligned_cols=147  Identities=17%  Similarity=0.198  Sum_probs=86.5

Q ss_pred             cccccccccccCChHHHHHHHH--hhcCCC--CcccCC--cccccccChHHHHHHHHhhcCCCCcccccc--cccccChh
Q psy16829         86 SHVCDICLEAFPSSDDRDLHFL--SHLTSD--GLYQCN--ECEFVGKRLTHLKTHKKIHEKVYGVYCDVC--GRGFHQNN  157 (243)
Q Consensus        86 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C--~~~f~~~~  157 (243)
                      ++.|..|...|.....|.+|..  .| .++  +++.|+  .|++.|.....+..|...+.+..++.+..-  ...+....
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h-~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNH-SGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             CCCCccccCCcccccccccccccccc-ccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            5667777777777777777777  45 666  777777  677777777777777777766665555332  22222111


Q ss_pred             HHHHHHH-----HhcCCCCeecc--ccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHhhcCCCC-C
Q psy16829        158 EVTLHKI-----KEHNAFPFQCE--ICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVK-H  229 (243)
Q Consensus       158 ~l~~H~~-----~~~~~k~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~-~  229 (243)
                      .-..+..     .......+.+.  .|...+.....+..|...|-......+.+..|...|.....+..|++.|.... .
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  447 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAPL  447 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCCce
Confidence            1000000     11122233332  25555666666666666666555335667778888888888888877776655 3


Q ss_pred             CCCC
Q psy16829        230 ECEG  233 (243)
Q Consensus       230 ~c~~  233 (243)
                      .|..
T Consensus       448 ~~~~  451 (467)
T COG5048         448 LCSI  451 (467)
T ss_pred             eecc
Confidence            3333


No 55 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.29  E-value=0.015  Score=29.72  Aligned_cols=22  Identities=18%  Similarity=0.522  Sum_probs=19.8

Q ss_pred             CcccccccCccCChHHHHHHHh
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      +|.|.+|+..|.+..++..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            6889999999999999999975


No 56 
>KOG2482|consensus
Probab=95.09  E-value=0.076  Score=41.87  Aligned_cols=50  Identities=18%  Similarity=0.371  Sum_probs=31.7

Q ss_pred             eccccccccCChhHHHHHHHHhCCCC-------------------------CCCcccccccCccCChHHHHHHHh
Q psy16829        173 QCEICHKIFTNKSTMWSHKKAHKPED-------------------------QIPWECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       173 ~C~~C~~~f~~~~~l~~H~~~h~~~~-------------------------~~~~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      .|-.|...+.+...|..|+..-|.-.                         ...-.|-.|...|-....|..|+.
T Consensus       281 ~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~  355 (423)
T KOG2482|consen  281 VCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMV  355 (423)
T ss_pred             EEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcc
Confidence            56666666666666666666543211                         002457778888888888888875


No 57 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.96  E-value=0.017  Score=29.25  Aligned_cols=24  Identities=29%  Similarity=1.039  Sum_probs=16.6

Q ss_pred             eeccccccccCChhHHHHHHHHhCCCCCCCcccccccC
Q psy16829        172 FQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHK  209 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~  209 (243)
                      |.|.+||+.+....            .  ++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~--~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------A--PWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------C--CCcCcCCCC
Confidence            67888887765432            3  778888874


No 58 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=94.76  E-value=0.064  Score=35.69  Aligned_cols=26  Identities=23%  Similarity=0.630  Sum_probs=23.5

Q ss_pred             Cccc----ccccCccCChHHHHHHHhhcCC
Q psy16829        201 PWEC----EHCHKVYPNKRSYKRHKQVHLG  226 (243)
Q Consensus       201 ~~~C----~~C~~~f~~~~~l~~H~~~H~~  226 (243)
                      .|.|    ..|++.+.+...+.+|.+.++|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            4899    9999999999999999998775


No 59 
>KOG2785|consensus
Probab=94.17  E-value=0.17  Score=40.69  Aligned_cols=52  Identities=17%  Similarity=0.333  Sum_probs=42.9

Q ss_pred             CeeccccccccCChhHHHHHHHHhCCCC---------------------CCCccccccc---CccCChHHHHHHHh
Q psy16829        171 PFQCEICHKIFTNKSTMWSHKKAHKPED---------------------QIPWECEHCH---KVYPNKRSYKRHKQ  222 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~---------------------~~~~~C~~C~---~~f~~~~~l~~H~~  222 (243)
                      |-.|-.|+..+.+...-..|+..+|+--                     .+.|.|-.|+   +.|.+....+.||.
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            3568889999999888889998888632                     1258899999   99999999999986


No 60 
>KOG2482|consensus
Probab=94.14  E-value=0.18  Score=39.87  Aligned_cols=53  Identities=21%  Similarity=0.261  Sum_probs=35.4

Q ss_pred             CcccCCcccccc-cChHHHHHHHHhhcC----------------------CCCcccccccccccChhHHHHHHHHh
Q psy16829        114 GLYQCNECEFVG-KRLTHLKTHKKIHEK----------------------VYGVYCDVCGRGFHQNNEVTLHKIKE  166 (243)
Q Consensus       114 ~~~~C~~C~~~f-~~~~~l~~H~~~~~~----------------------~~~~~C~~C~~~f~~~~~l~~H~~~~  166 (243)
                      ...+|-.|...+ .+.+....|+-.-++                      -..+.|-.|.+.|..+..|+.||+..
T Consensus       143 fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  143 FSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             eeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhc
Confidence            346788887655 455566666532111                      12478888888898888888888754


No 61 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.03  E-value=0.07  Score=42.15  Aligned_cols=130  Identities=22%  Similarity=0.360  Sum_probs=81.4

Q ss_pred             ccccc--cccccCChHHHHHHHHhhcCCCCcccCCcccc---cc------cChHHHHHHHHhhcCCCCc----ccccccc
Q psy16829         87 HVCDI--CLEAFPSSDDRDLHFLSHLTSDGLYQCNECEF---VG------KRLTHLKTHKKIHEKVYGV----YCDVCGR  151 (243)
Q Consensus        87 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~---~f------~~~~~l~~H~~~~~~~~~~----~C~~C~~  151 (243)
                      |.||.  |..+......|..|....|   ..+.|..|..   .|      -+...|..|...-..+..|    .|..|..
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H---~~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~  228 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQH---GFVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKI  228 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhc---CcEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccc
Confidence            66876  7777777788888887543   2355665533   22      2233466665533222222    5888999


Q ss_pred             cccChhHHHHHHHHhcCCCCeeccccc----cccCChhHHHHHHHHhCCCCCCCccccc--cc----CccCChHHHHHHH
Q psy16829        152 GFHQNNEVTLHKIKEHNAFPFQCEICH----KIFTNKSTMWSHKKAHKPEDQIPWECEH--CH----KVYPNKRSYKRHK  221 (243)
Q Consensus       152 ~f~~~~~l~~H~~~~~~~k~~~C~~C~----~~f~~~~~l~~H~~~h~~~~~~~~~C~~--C~----~~f~~~~~l~~H~  221 (243)
                      .|.+...|..|++..|.. -|.|..-+    .-|.+-.+|..|.+.-      -|.|..  |.    ..|.....|+.|+
T Consensus       229 ~FYdDDEL~~HcR~~HE~-ChICD~v~p~~~QYFK~Y~~Le~HF~~~------hy~ct~qtc~~~k~~vf~~~~el~~h~  301 (493)
T COG5236         229 YFYDDDELRRHCRLRHEA-CHICDMVGPIRYQYFKSYEDLEAHFRNA------HYCCTFQTCRVGKCYVFPYHTELLEHL  301 (493)
T ss_pred             eecChHHHHHHHHhhhhh-hhhhhccCccchhhhhCHHHHHHHhhcC------ceEEEEEEEecCcEEEeccHHHHHHHH
Confidence            999999999999987733 23443322    2366667777776542      466643  43    4688999999998


Q ss_pred             hhcCC
Q psy16829        222 QVHLG  226 (243)
Q Consensus       222 ~~H~~  226 (243)
                      ..-+|
T Consensus       302 ~~~h~  306 (493)
T COG5236         302 TRFHK  306 (493)
T ss_pred             HHHhh
Confidence            64443


No 62 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.88  E-value=0.12  Score=34.42  Aligned_cols=25  Identities=28%  Similarity=0.517  Sum_probs=23.4

Q ss_pred             eec----cccccccCChhHHHHHHHHhCC
Q psy16829        172 FQC----EICHKIFTNKSTMWSHKKAHKP  196 (243)
Q Consensus       172 ~~C----~~C~~~f~~~~~l~~H~~~h~~  196 (243)
                      |.|    ..|++.+.+...++.|++.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999999875


No 63 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.41  E-value=0.02  Score=47.77  Aligned_cols=148  Identities=22%  Similarity=0.323  Sum_probs=101.1

Q ss_pred             ceeeccccchhccChhhHHhhhh--ccCCC---ccccc--ccccccCChHHHHHHHHhhcCCCCcccCCc--ccccccCh
Q psy16829         58 LLLTCVECNEDFINVNDFVSHLR--GHDST---SHVCD--ICLEAFPSSDDRDLHFLSHLTSDGLYQCNE--CEFVGKRL  128 (243)
Q Consensus        58 ~~~~C~~C~~~~~~~~~l~~H~~--~h~~~---~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~--C~~~f~~~  128 (243)
                      ..+.|..|...|.....|.+|.+  .|.+.   ++.|+  .|++.|.+...+.+|...| ....++.+..  +...+...
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~  366 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLH-TSISPAKEKLLNSSSKFSPL  366 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccc-cCCCccccccccCccccccc
Confidence            46899999999999999999999  67654   89999  7999999999999999988 6666666654  33333332


Q ss_pred             HHHHHHHH-----hhcCCCCccc--ccccccccChhHHHHHHHHhcCCC--CeeccccccccCChhHHHHHHHHhCCCCC
Q psy16829        129 THLKTHKK-----IHEKVYGVYC--DVCGRGFHQNNEVTLHKIKEHNAF--PFQCEICHKIFTNKSTMWSHKKAHKPEDQ  199 (243)
Q Consensus       129 ~~l~~H~~-----~~~~~~~~~C--~~C~~~f~~~~~l~~H~~~~~~~k--~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  199 (243)
                      ..-..+..     .........+  ..|...+.....+..|...+-...  .+.+..|...+.....+..|.+.+.... 
T Consensus       367 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  445 (467)
T COG5048         367 LNNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHA-  445 (467)
T ss_pred             cCCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCC-
Confidence            22111111     1112222333  224455666666666666655444  3566789999999999999999988776 


Q ss_pred             CCccccccc
Q psy16829        200 IPWECEHCH  208 (243)
Q Consensus       200 ~~~~C~~C~  208 (243)
                       ++.|..+.
T Consensus       446 -~~~~~~~~  453 (467)
T COG5048         446 -PLLCSILK  453 (467)
T ss_pred             -ceeecccc
Confidence             55554444


No 64 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.35  E-value=0.057  Score=27.51  Aligned_cols=21  Identities=29%  Similarity=0.586  Sum_probs=11.4

Q ss_pred             eeccccchhccChhhHHhhhh
Q psy16829         60 LTCVECNEDFINVNDFVSHLR   80 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~l~~H~~   80 (243)
                      +.|.+|++.|.+...+..|++
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             eEccccCCccCCHHHHHHHHC
Confidence            455555555555555555543


No 65 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.29  E-value=0.15  Score=33.70  Aligned_cols=54  Identities=20%  Similarity=0.342  Sum_probs=33.1

Q ss_pred             eccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHhhcCCCCCCCCCCC
Q psy16829        173 QCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGP  235 (243)
Q Consensus       173 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~c~~c~  235 (243)
                      .|-.|...|.......  ...-....  .|.|+.|...|-..-..-.|..+|.     |++|.
T Consensus        57 ~C~~C~~~f~~~~~~~--~~~~~~~~--~y~C~~C~~~FC~dCD~fiHe~Lh~-----CPGC~  110 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSP--FDELKDSH--RYVCAVCKNVFCVDCDVFVHESLHC-----CPGCI  110 (112)
T ss_pred             cccCcCCCCCCccccc--cccccccc--ceeCCCCCCccccccchhhhhhccC-----CcCCC
Confidence            3777777776542100  00011122  6888888888888777777766655     77776


No 66 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.12  E-value=0.33  Score=32.17  Aligned_cols=48  Identities=17%  Similarity=0.517  Sum_probs=24.5

Q ss_pred             ccccccccccChhHHHHHHHHhcCCCCeeccccccccCChhHHHHHHHHh
Q psy16829        145 YCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAH  194 (243)
Q Consensus       145 ~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~~~~~l~~H~~~h  194 (243)
                      .|-.|...|........  ........|.|+.|...|-..-++..|...|
T Consensus        57 ~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             cccCcCCCCCCcccccc--cccccccceeCCCCCCccccccchhhhhhcc
Confidence            36666666654321000  0012234567777777776666666665444


No 67 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.94  E-value=0.087  Score=26.83  Aligned_cols=25  Identities=24%  Similarity=0.676  Sum_probs=16.5

Q ss_pred             CeeccccccccCChhHHHHHHHHhCCCCCCCcccccccC
Q psy16829        171 PFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHK  209 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~  209 (243)
                      .|.|..||+.+....            .  |..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~~------------~--p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGEE------------A--PEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECCc------------C--CCcCcCCCC
Confidence            377888887765321            2  677888874


No 68 
>KOG2893|consensus
Probab=91.89  E-value=0.044  Score=40.91  Aligned_cols=43  Identities=23%  Similarity=0.508  Sum_probs=21.4

Q ss_pred             eccccchhccChhhHHhhhhccCCCcccccccccccCChHHHHHHH
Q psy16829         61 TCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHF  106 (243)
Q Consensus        61 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~  106 (243)
                      .|.+|++.|.....|..|++.   +.|+|.+|.+...+--.|..|.
T Consensus        12 wcwycnrefddekiliqhqka---khfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA---KHFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             eeeecccccchhhhhhhhhhh---ccceeeeehhhhccCCCceeeh
Confidence            455555555555555555543   3355555555444444444443


No 69 
>KOG2893|consensus
Probab=91.62  E-value=0.048  Score=40.70  Aligned_cols=42  Identities=19%  Similarity=0.226  Sum_probs=34.1

Q ss_pred             ccccccccCChHHHHHHHHhhcCCCCcccCCcccccccChHHHHHHH
Q psy16829         89 CDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHK  135 (243)
Q Consensus        89 C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~  135 (243)
                      |.+|++.|.+..-|+.|++..     -|+|.+|.+...+--.|..|-
T Consensus        13 cwycnrefddekiliqhqkak-----hfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAK-----HFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             eeecccccchhhhhhhhhhhc-----cceeeeehhhhccCCCceeeh
Confidence            999999999999999997644     499999988766555666663


No 70 
>KOG4173|consensus
Probab=91.29  E-value=0.15  Score=37.31  Aligned_cols=77  Identities=26%  Similarity=0.470  Sum_probs=58.9

Q ss_pred             eeeccc--cchhccChhhHHhhhhccCCCcccccccccccCChHHHHHHHHhhc---------CCCCcccCCc--ccccc
Q psy16829         59 LLTCVE--CNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHL---------TSDGLYQCNE--CEFVG  125 (243)
Q Consensus        59 ~~~C~~--C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~---------~~~~~~~C~~--C~~~f  125 (243)
                      .+.|++  |...|........|-.+-  ....|..|.+.|++.-.|..|+...|         .+...|.|-+  |+..|
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~--h~~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTL--HGNSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhc--ccchhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            377875  677888888788774433  34579999999999999999996543         3466788854  88889


Q ss_pred             cChHHHHHHHHh
Q psy16829        126 KRLTHLKTHKKI  137 (243)
Q Consensus       126 ~~~~~l~~H~~~  137 (243)
                      .+...-+.|+..
T Consensus       157 kT~r~RkdH~I~  168 (253)
T KOG4173|consen  157 KTSRDRKDHMIR  168 (253)
T ss_pred             hhhhhhhhHHHH
Confidence            888888888764


No 71 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.68  E-value=0.2  Score=33.19  Aligned_cols=15  Identities=13%  Similarity=0.102  Sum_probs=7.7

Q ss_pred             CcccCCcccccccCh
Q psy16829        114 GLYQCNECEFVGKRL  128 (243)
Q Consensus       114 ~~~~C~~C~~~f~~~  128 (243)
                      .|-.|+.|+..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            455555555555443


No 72 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=89.10  E-value=0.16  Score=28.57  Aligned_cols=23  Identities=26%  Similarity=0.634  Sum_probs=12.8

Q ss_pred             CcccccccCccCChHHHHHHHhh
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQV  223 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~  223 (243)
                      -+.||.|+..|....++.+|+..
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhhH
Confidence            45555555555555555555543


No 73 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.89  E-value=0.21  Score=28.09  Aligned_cols=29  Identities=14%  Similarity=0.314  Sum_probs=21.6

Q ss_pred             CCCCeeccccccccCChhHHHHHHHHhCC
Q psy16829        168 NAFPFQCEICHKIFTNKSTMWSHKKAHKP  196 (243)
Q Consensus       168 ~~k~~~C~~C~~~f~~~~~l~~H~~~h~~  196 (243)
                      |+-.+.|+.|+..|....+..+|...-|+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            55667888888888888888888765443


No 74 
>KOG2785|consensus
Probab=88.55  E-value=0.79  Score=37.02  Aligned_cols=28  Identities=11%  Similarity=0.330  Sum_probs=24.1

Q ss_pred             cceeeccccchhccChhhHHhhhhccCC
Q psy16829         57 PLLLTCVECNEDFINVNDFVSHLRGHDS   84 (243)
Q Consensus        57 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~   84 (243)
                      ..|.-|-+|++.+.+...-..||..+|+
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~Hg  191 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHG  191 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccC
Confidence            3347899999999999999999998876


No 75 
>KOG2186|consensus
Probab=88.07  E-value=0.37  Score=36.56  Aligned_cols=47  Identities=19%  Similarity=0.318  Sum_probs=37.5

Q ss_pred             eeeccccchhccChhhHHhhhhccCCCcccccccccccCChHHHHHHHH
Q psy16829         59 LLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFL  107 (243)
Q Consensus        59 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~  107 (243)
                      .|.|..||-...-. .+.+|+-.-++.-|.|..|+..|.. .++..|..
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccCCeeEEeeccccccc-chhhhhhh
Confidence            37899999876644 6777988877788999999999987 67777764


No 76 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=87.99  E-value=0.48  Score=27.19  Aligned_cols=13  Identities=23%  Similarity=0.583  Sum_probs=5.8

Q ss_pred             CcccccccCccCC
Q psy16829        201 PWECEHCHKVYPN  213 (243)
Q Consensus       201 ~~~C~~C~~~f~~  213 (243)
                      .|.|+.||..-..
T Consensus        27 ~F~CPnCGe~~I~   39 (61)
T COG2888          27 KFPCPNCGEVEIY   39 (61)
T ss_pred             EeeCCCCCceeee
Confidence            3445555444333


No 77 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.79  E-value=0.35  Score=32.02  Aligned_cols=30  Identities=33%  Similarity=0.770  Sum_probs=24.4

Q ss_pred             eeccccchhccChhhHHhhhhccCCCcccccccccccCCh
Q psy16829         60 LTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSS   99 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~   99 (243)
                      ..|+.||..|...+          ..|-.||.||..|.-.
T Consensus        10 R~Cp~CG~kFYDLn----------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLN----------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCC----------CCCccCCCCCCccCcc
Confidence            58999999998662          2577899999998766


No 78 
>KOG4173|consensus
Probab=87.75  E-value=0.53  Score=34.52  Aligned_cols=19  Identities=26%  Similarity=0.697  Sum_probs=8.5

Q ss_pred             cccccccccChhHHHHHHH
Q psy16829        146 CDVCGRGFHQNNEVTLHKI  164 (243)
Q Consensus       146 C~~C~~~f~~~~~l~~H~~  164 (243)
                      |..|.+.|.+.-.|..|+.
T Consensus       109 Cs~C~r~~Pt~hLLd~HI~  127 (253)
T KOG4173|consen  109 CSFCKRAFPTGHLLDAHIL  127 (253)
T ss_pred             hHHHHHhCCchhhhhHHHH
Confidence            4444444444444444433


No 79 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=87.47  E-value=0.31  Score=34.86  Aligned_cols=23  Identities=26%  Similarity=0.632  Sum_probs=18.2

Q ss_pred             CeeccccccccCChhHHHHHHHHhCCCCCCCccccccc
Q psy16829        171 PFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCH  208 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~  208 (243)
                      .|.|++||+.+.             ++.  |-.||+|+
T Consensus       134 ~~vC~vCGy~~~-------------ge~--P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTHE-------------GEA--PEVCPICG  156 (166)
T ss_pred             EEEcCCCCCccc-------------CCC--CCcCCCCC
Confidence            599999997653             334  89999998


No 80 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=87.16  E-value=0.43  Score=22.61  Aligned_cols=8  Identities=38%  Similarity=1.132  Sum_probs=4.5

Q ss_pred             cccccCcc
Q psy16829        204 CEHCHKVY  211 (243)
Q Consensus       204 C~~C~~~f  211 (243)
                      |+.||+.|
T Consensus        17 Cp~CG~~F   24 (26)
T PF10571_consen   17 CPHCGYDF   24 (26)
T ss_pred             CCCCCCCC
Confidence            55555555


No 81 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=86.87  E-value=0.49  Score=24.56  Aligned_cols=10  Identities=30%  Similarity=1.042  Sum_probs=4.3

Q ss_pred             eecccccccc
Q psy16829        172 FQCEICHKIF  181 (243)
Q Consensus       172 ~~C~~C~~~f  181 (243)
                      .+|+.|+..|
T Consensus        26 vrC~~C~~~f   35 (37)
T PF13719_consen   26 VRCPKCGHVF   35 (37)
T ss_pred             EECCCCCcEe
Confidence            4444444433


No 82 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=86.65  E-value=0.83  Score=36.37  Aligned_cols=75  Identities=27%  Similarity=0.477  Sum_probs=45.4

Q ss_pred             eeccccchhccChhhHHhhhhccCCCcccccccc----cccCChHHHHHHHHhhcCCCCcccCCc--cc----ccccChH
Q psy16829         60 LTCVECNEDFINVNDFVSHLRGHDSTSHVCDICL----EAFPSSDDRDLHFLSHLTSDGLYQCNE--CE----FVGKRLT  129 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~----~~f~~~~~l~~H~~~h~~~~~~~~C~~--C~----~~f~~~~  129 (243)
                      -.|.+|...|..-..|.+|++.-+.+-|.|..=+    .-|....+|.+|.+..|     |.|.+  |.    .+|....
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h-----y~ct~qtc~~~k~~vf~~~~  295 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFRNAH-----YCCTFQTCRVGKCYVFPYHT  295 (493)
T ss_pred             chhhhccceecChHHHHHHHHhhhhhhhhhhccCccchhhhhCHHHHHHHhhcCc-----eEEEEEEEecCcEEEeccHH
Confidence            4688888778888888888776554444443221    34666677777765432     55533  32    2567777


Q ss_pred             HHHHHHHhhc
Q psy16829        130 HLKTHKKIHE  139 (243)
Q Consensus       130 ~l~~H~~~~~  139 (243)
                      .|+.|+...+
T Consensus       296 el~~h~~~~h  305 (493)
T COG5236         296 ELLEHLTRFH  305 (493)
T ss_pred             HHHHHHHHHh
Confidence            7777765433


No 83 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=86.55  E-value=0.55  Score=24.23  Aligned_cols=11  Identities=18%  Similarity=0.579  Sum_probs=4.8

Q ss_pred             ccccccccccC
Q psy16829        145 YCDVCGRGFHQ  155 (243)
Q Consensus       145 ~C~~C~~~f~~  155 (243)
                      .|+.|+..|.-
T Consensus         4 ~Cp~C~~~y~i   14 (36)
T PF13717_consen    4 TCPNCQAKYEI   14 (36)
T ss_pred             ECCCCCCEEeC
Confidence            34444444433


No 84 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=86.08  E-value=0.51  Score=24.53  Aligned_cols=12  Identities=25%  Similarity=0.595  Sum_probs=5.5

Q ss_pred             ccccccccccCh
Q psy16829        145 YCDVCGRGFHQN  156 (243)
Q Consensus       145 ~C~~C~~~f~~~  156 (243)
                      .|+.|+..|.-.
T Consensus         4 ~CP~C~~~~~v~   15 (38)
T TIGR02098         4 QCPNCKTSFRVV   15 (38)
T ss_pred             ECCCCCCEEEeC
Confidence            445555444333


No 85 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=85.90  E-value=0.14  Score=38.56  Aligned_cols=45  Identities=20%  Similarity=0.415  Sum_probs=24.0

Q ss_pred             CCeeccccccccCChhHHHHHHHHh-C---------CCC---CCCcccccccCccCCh
Q psy16829        170 FPFQCEICHKIFTNKSTMWSHKKAH-K---------PED---QIPWECEHCHKVYPNK  214 (243)
Q Consensus       170 k~~~C~~C~~~f~~~~~l~~H~~~h-~---------~~~---~~~~~C~~C~~~f~~~  214 (243)
                      +.+.||+|+..|....-.....+.- .         +..   -....||.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            4456777777776654444333321 1         111   0135688888887643


No 86 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=85.37  E-value=0.8  Score=32.73  Aligned_cols=33  Identities=18%  Similarity=0.349  Sum_probs=19.3

Q ss_pred             cCCCCcccccccccccChhHHHHHHHHhcCCCCeeccccccc
Q psy16829        139 EKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKI  180 (243)
Q Consensus       139 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~  180 (243)
                      .....|.|+.|+..|+...++.         ..|.|+.||..
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            3445566777766666555442         24667777655


No 87 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=85.30  E-value=0.34  Score=36.88  Aligned_cols=79  Identities=15%  Similarity=0.240  Sum_probs=38.9

Q ss_pred             eeccccch-hccChhhHHhhhhccCCCcccccccccccCChHHHHHHHHhhcCCCCcccCCcccccccChHHHHHHHHhh
Q psy16829         60 LTCVECNE-DFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIH  138 (243)
Q Consensus        60 ~~C~~C~~-~~~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  138 (243)
                      -+|.+|.. ..-.+..|..|.=.-.-..-.|..|.+...           . .+.+.|.|.+|.... -...-..|+.+-
T Consensus        98 aiCDfCEawvCHgrkCl~~HaC~Cpl~da~C~EC~R~vw-----------~-hGGrif~CsfC~~fl-CEDDQFEHQAsC  164 (314)
T PF06524_consen   98 AICDFCEAWVCHGRKCLSTHACTCPLQDAVCIECERGVW-----------D-HGGRIFKCSFCDNFL-CEDDQFEHQASC  164 (314)
T ss_pred             hhhccchhheeccccccccccccCcCCCcEeeeeecccc-----------c-CCCeEEEeecCCCee-eccchhhhhhhh
Confidence            46777753 233334444443221112335666665431           2 456678888777532 233344555432


Q ss_pred             --cCCCCcccccccc
Q psy16829        139 --EKVYGVYCDVCGR  151 (243)
Q Consensus       139 --~~~~~~~C~~C~~  151 (243)
                        .....|+|..|++
T Consensus       165 QvLe~E~~KC~SCNr  179 (314)
T PF06524_consen  165 QVLESETFKCQSCNR  179 (314)
T ss_pred             hhhhccccccccccc
Confidence              2334567776654


No 88 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.68  E-value=1.2  Score=31.85  Aligned_cols=32  Identities=25%  Similarity=0.395  Sum_probs=19.9

Q ss_pred             CCCCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCc
Q psy16829        168 NAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKV  210 (243)
Q Consensus       168 ~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~  210 (243)
                      +..-|.|+.|+..|+....+.         .  -|.|+.||..
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~--~F~Cp~Cg~~  137 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------L--NFTCPRCGAM  137 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------c--CCcCCCCCCE
Confidence            445567777777776655553         2  4777777754


No 89 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=84.32  E-value=0.86  Score=30.78  Aligned_cols=15  Identities=0%  Similarity=-0.589  Sum_probs=7.7

Q ss_pred             CcccCCcccccccCh
Q psy16829        114 GLYQCNECEFVGKRL  128 (243)
Q Consensus       114 ~~~~C~~C~~~f~~~  128 (243)
                      .|-.|+.|+..|...
T Consensus        25 ~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        25 RPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCccCCCcCCccCcc
Confidence            455555555554433


No 90 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=83.82  E-value=0.83  Score=24.78  Aligned_cols=11  Identities=18%  Similarity=0.549  Sum_probs=6.0

Q ss_pred             eeccccccccC
Q psy16829        172 FQCEICHKIFT  182 (243)
Q Consensus       172 ~~C~~C~~~f~  182 (243)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            55555555554


No 91 
>PHA00626 hypothetical protein
Probab=83.71  E-value=0.23  Score=28.06  Aligned_cols=12  Identities=17%  Similarity=0.384  Sum_probs=7.4

Q ss_pred             CcccccccCccC
Q psy16829        201 PWECEHCHKVYP  212 (243)
Q Consensus       201 ~~~C~~C~~~f~  212 (243)
                      .|+|+.|++.|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            566666666664


No 92 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=83.32  E-value=0.36  Score=36.41  Aligned_cols=42  Identities=21%  Similarity=0.302  Sum_probs=27.7

Q ss_pred             ceeeccccchhccChhhHHhhhhcc----------CC-C-----cccccccccccCCh
Q psy16829         58 LLLTCVECNEDFINVNDFVSHLRGH----------DS-T-----SHVCDICLEAFPSS   99 (243)
Q Consensus        58 ~~~~C~~C~~~~~~~~~l~~H~~~h----------~~-~-----~~~C~~C~~~f~~~   99 (243)
                      +.+.||+|+..|.+..-+....+.-          .+ .     ...||.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            4579999999998886655555421          11 1     13688898776544


No 93 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=82.72  E-value=1.3  Score=20.90  Aligned_cols=20  Identities=15%  Similarity=0.375  Sum_probs=14.1

Q ss_pred             cccccccCccCChHHHHHHHh
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      ..||+|++.+ ....+.+|+.
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3588888887 5567777764


No 94 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=82.00  E-value=0.58  Score=24.68  Aligned_cols=31  Identities=19%  Similarity=0.469  Sum_probs=18.3

Q ss_pred             ceeeccccchhccChhhHHhhhhccCCCccccccccc
Q psy16829         58 LLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLE   94 (243)
Q Consensus        58 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~   94 (243)
                      ..|.|..||..|.......      .+....|+.|+.
T Consensus         4 Y~y~C~~Cg~~fe~~~~~~------~~~~~~CP~Cg~   34 (41)
T smart00834        4 YEYRCEDCGHTFEVLQKIS------DDPLATCPECGG   34 (41)
T ss_pred             EEEEcCCCCCEEEEEEecC------CCCCCCCCCCCC
Confidence            3577888887766443221      134556777775


No 95 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=81.17  E-value=1.2  Score=32.48  Aligned_cols=33  Identities=18%  Similarity=0.599  Sum_probs=18.8

Q ss_pred             CCCCcccccccccccChhHHHHHHHHhcCCCCeecccccccc
Q psy16829        140 KVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIF  181 (243)
Q Consensus       140 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f  181 (243)
                      ....|.|+.|+..|+....+.         ..|.|+.||...
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            344566777766665554431         246677776653


No 96 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=81.10  E-value=1.8  Score=31.65  Aligned_cols=34  Identities=29%  Similarity=0.577  Sum_probs=21.6

Q ss_pred             CCCCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccC
Q psy16829        168 NAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYP  212 (243)
Q Consensus       168 ~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~  212 (243)
                      ...-|.|+.|+..|+....+.         .  -|.|+.||....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~--~F~Cp~Cg~~L~  147 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------Y--GFRCPQCGEMLE  147 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------c--CCcCCCCCCCCe
Confidence            345577877877777665442         2  577888876543


No 97 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=80.62  E-value=0.97  Score=24.19  Aligned_cols=31  Identities=19%  Similarity=0.463  Sum_probs=18.2

Q ss_pred             ceeeccccchhccChhhHHhhhhccCCCccccccccc
Q psy16829         58 LLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLE   94 (243)
Q Consensus        58 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~   94 (243)
                      ..|.|..||..|.....+..      .....|+.|+.
T Consensus         4 Yey~C~~Cg~~fe~~~~~~~------~~~~~CP~Cg~   34 (42)
T PF09723_consen    4 YEYRCEECGHEFEVLQSISE------DDPVPCPECGS   34 (42)
T ss_pred             EEEEeCCCCCEEEEEEEcCC------CCCCcCCCCCC
Confidence            34777778777665532211      24556777775


No 98 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=80.58  E-value=0.69  Score=25.98  Aligned_cols=31  Identities=19%  Similarity=0.463  Sum_probs=18.3

Q ss_pred             ceeeccccchhccChhhHHhhhhccCCCccccccccc
Q psy16829         58 LLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLE   94 (243)
Q Consensus        58 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~   94 (243)
                      ..|.|..||..|.....+.      ....-.|+.|+.
T Consensus         4 Yey~C~~Cg~~fe~~~~~~------~~~~~~CP~Cg~   34 (52)
T TIGR02605         4 YEYRCTACGHRFEVLQKMS------DDPLATCPECGG   34 (52)
T ss_pred             EEEEeCCCCCEeEEEEecC------CCCCCCCCCCCC
Confidence            4577888887776542221      124456888775


No 99 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=80.17  E-value=1.2  Score=30.16  Aligned_cols=33  Identities=21%  Similarity=0.382  Sum_probs=25.3

Q ss_pred             eeccccchhccChhhHHhhhhccCCCcccccccccccCChHHH
Q psy16829         60 LTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDR  102 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l  102 (243)
                      ..|+.||+.|....          ..|..|+.||..|.....+
T Consensus        10 r~Cp~cg~kFYDLn----------k~p~vcP~cg~~~~~~~~~   42 (129)
T TIGR02300        10 RICPNTGSKFYDLN----------RRPAVSPYTGEQFPPEEAL   42 (129)
T ss_pred             ccCCCcCccccccC----------CCCccCCCcCCccCcchhh
Confidence            58999999987652          2578899999988766443


No 100
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=80.10  E-value=1.2  Score=24.03  Aligned_cols=21  Identities=33%  Similarity=0.542  Sum_probs=9.7

Q ss_pred             CcccccccCccCCh----HHHHHHH
Q psy16829        201 PWECEHCHKVYPNK----RSYKRHK  221 (243)
Q Consensus       201 ~~~C~~C~~~f~~~----~~l~~H~  221 (243)
                      ...|..|++.+...    ++|.+|+
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            35566666555542    5666666


No 101
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=79.88  E-value=0.97  Score=26.04  Aligned_cols=8  Identities=38%  Similarity=1.385  Sum_probs=4.1

Q ss_pred             Cccccccc
Q psy16829        201 PWECEHCH  208 (243)
Q Consensus       201 ~~~C~~C~  208 (243)
                      +|.|+.||
T Consensus        48 ~Y~CP~CG   55 (59)
T PRK14890         48 PYTCPKCG   55 (59)
T ss_pred             ceECCCCC
Confidence            45555554


No 102
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=79.31  E-value=1.7  Score=24.23  Aligned_cols=21  Identities=24%  Similarity=0.540  Sum_probs=10.3

Q ss_pred             cccccccCccCCh-----HHHHHHHh
Q psy16829        202 WECEHCHKVYPNK-----RSYKRHKQ  222 (243)
Q Consensus       202 ~~C~~C~~~f~~~-----~~l~~H~~  222 (243)
                      -.|..|++.+...     ++|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            3455555544332     45555555


No 103
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=78.06  E-value=1.6  Score=30.06  Aligned_cols=27  Identities=33%  Similarity=0.720  Sum_probs=17.2

Q ss_pred             CCcceeeccccchhccChhhHHhhhhccCC
Q psy16829         55 DKPLLLTCVECNEDFINVNDFVSHLRGHDS   84 (243)
Q Consensus        55 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~   84 (243)
                      ..+..+.|-+||+.|...   .+|++.|++
T Consensus        68 I~~d~i~clecGk~~k~L---krHL~~~~g   94 (132)
T PF05443_consen   68 ITPDYIICLECGKKFKTL---KRHLRTHHG   94 (132)
T ss_dssp             B-SS-EE-TBT--EESBH---HHHHHHTT-
T ss_pred             cccCeeEEccCCcccchH---HHHHHHccC
Confidence            345568999999998854   999999976


No 104
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=77.88  E-value=2.6  Score=29.72  Aligned_cols=37  Identities=14%  Similarity=0.358  Sum_probs=18.7

Q ss_pred             CCCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCcc
Q psy16829        169 AFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVY  211 (243)
Q Consensus       169 ~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f  211 (243)
                      ...|.|+.|+..|.....+..    .....  .|.|+.||...
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~----~d~~~--~f~Cp~Cg~~l  133 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL----LDMDG--TFTCPRCGEEL  133 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh----cCCCC--cEECCCCCCEE
Confidence            345677777776664322211    01122  47777776543


No 105
>PF14353 CpXC:  CpXC protein
Probab=77.75  E-value=1.9  Score=29.56  Aligned_cols=40  Identities=23%  Similarity=0.383  Sum_probs=21.4

Q ss_pred             eeccccchhccChhh----------HHhhhhccCC--CcccccccccccCChHH
Q psy16829         60 LTCVECNEDFINVND----------FVSHLRGHDS--TSHVCDICLEAFPSSDD  101 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~----------l~~H~~~h~~--~~~~C~~C~~~f~~~~~  101 (243)
                      ++|+.|+..|.....          |+.-+.  .+  -.+.||.||..|.-...
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il--~g~l~~~~CP~Cg~~~~~~~p   53 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKIL--DGSLFSFTCPSCGHKFRLEYP   53 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHH--cCCcCEEECCCCCCceecCCC
Confidence            478888876643321          222221  22  45678888777654333


No 106
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=77.70  E-value=1.5  Score=31.40  Aligned_cols=24  Identities=21%  Similarity=0.469  Sum_probs=14.6

Q ss_pred             cccccccccccCChHHHHHHHHhhcCCCCcccCCcccc
Q psy16829         86 SHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEF  123 (243)
Q Consensus        86 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  123 (243)
                      .|.|+.||..+              .++.|-.|++|+.
T Consensus       134 ~~vC~vCGy~~--------------~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTH--------------EGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcc--------------cCCCCCcCCCCCC
Confidence            36677776544              4455666666663


No 107
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=77.45  E-value=0.72  Score=22.67  Aligned_cols=9  Identities=22%  Similarity=0.637  Sum_probs=5.0

Q ss_pred             CcccccccC
Q psy16829        201 PWECEHCHK  209 (243)
Q Consensus       201 ~~~C~~C~~  209 (243)
                      .|.|+.|+.
T Consensus        19 ~~vCp~C~~   27 (30)
T PF08274_consen   19 LLVCPECGH   27 (30)
T ss_dssp             SEEETTTTE
T ss_pred             EEeCCcccc
Confidence            455665553


No 108
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=77.41  E-value=2.4  Score=29.91  Aligned_cols=38  Identities=16%  Similarity=0.248  Sum_probs=23.0

Q ss_pred             CCCCcccccccccccChhHHHHHHHHhcCCCCeecccccccc
Q psy16829        140 KVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIF  181 (243)
Q Consensus       140 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f  181 (243)
                      ....|.|+.|+..|.....+..   .. ....|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~---~d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL---LD-MDGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh---cC-CCCcEECCCCCCEE
Confidence            4456888888888775433222   01 13338888888765


No 109
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=77.41  E-value=1.9  Score=23.12  Aligned_cols=23  Identities=17%  Similarity=0.362  Sum_probs=19.9

Q ss_pred             CcccccccCccCChHHHHHHHhh
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQV  223 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~  223 (243)
                      .|+|-.|..+..-+++|-.|++-
T Consensus        20 ~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             cceeecCCcccchHHHHHHHHHH
Confidence            47899999999999999999873


No 110
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=77.22  E-value=0.43  Score=33.83  Aligned_cols=12  Identities=42%  Similarity=0.758  Sum_probs=5.3

Q ss_pred             eeccccccccCC
Q psy16829        172 FQCEICHKIFTN  183 (243)
Q Consensus       172 ~~C~~C~~~f~~  183 (243)
                      ++|+.||+.|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            444444444443


No 111
>KOG2807|consensus
Probab=76.48  E-value=4.7  Score=32.07  Aligned_cols=30  Identities=27%  Similarity=0.590  Sum_probs=23.2

Q ss_pred             CcccccccCccCChHHHHHHHhhcCCCCCCCCCCC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGP  235 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~c~~c~  235 (243)
                      .|.|..|...|-..-+.-.|...|.     |++|.
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh~-----CpgCe  374 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLHN-----CPGCE  374 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhhc-----CCCcC
Confidence            6889999999988877777766554     77775


No 112
>PRK04023 DNA polymerase II large subunit; Validated
Probab=75.48  E-value=3.9  Score=37.79  Aligned_cols=12  Identities=25%  Similarity=0.302  Sum_probs=7.5

Q ss_pred             CCCCCCCCCccC
Q psy16829        229 HECEGGPIPALA  240 (243)
Q Consensus       229 ~~c~~c~~~~~~  240 (243)
                      +.|+.||.....
T Consensus       664 y~CPKCG~El~~  675 (1121)
T PRK04023        664 DECEKCGREPTP  675 (1121)
T ss_pred             CcCCCCCCCCCc
Confidence            667777765543


No 113
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=74.70  E-value=1.7  Score=23.68  Aligned_cols=9  Identities=22%  Similarity=1.003  Sum_probs=4.1

Q ss_pred             eeccccchh
Q psy16829         60 LTCVECNED   68 (243)
Q Consensus        60 ~~C~~C~~~   68 (243)
                      |.|+.||..
T Consensus         4 y~C~~CG~~   12 (46)
T PRK00398          4 YKCARCGRE   12 (46)
T ss_pred             EECCCCCCE
Confidence            444444443


No 114
>KOG2186|consensus
Probab=74.23  E-value=2.8  Score=31.99  Aligned_cols=46  Identities=30%  Similarity=0.573  Sum_probs=26.6

Q ss_pred             cccccccccccChhHHHHHHHHhcCCCCeeccccccccCChhHHHHHHH
Q psy16829        144 VYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKK  192 (243)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~~~~~l~~H~~  192 (243)
                      |.|..||....- ..+..|+-.-++ ..|.|-.|+..|.. .+...|..
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            566667665543 345556655555 34666667776665 45555544


No 115
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=73.91  E-value=1.9  Score=21.57  Aligned_cols=9  Identities=33%  Similarity=1.047  Sum_probs=4.5

Q ss_pred             CcccccccC
Q psy16829        201 PWECEHCHK  209 (243)
Q Consensus       201 ~~~C~~C~~  209 (243)
                      +..|+.||.
T Consensus        17 ~irC~~CG~   25 (32)
T PF03604_consen   17 PIRCPECGH   25 (32)
T ss_dssp             TSSBSSSS-
T ss_pred             cEECCcCCC
Confidence            455666654


No 116
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=73.36  E-value=1.9  Score=26.96  Aligned_cols=12  Identities=25%  Similarity=1.074  Sum_probs=7.2

Q ss_pred             CcccccccCccC
Q psy16829        201 PWECEHCHKVYP  212 (243)
Q Consensus       201 ~~~C~~C~~~f~  212 (243)
                      .+.|..|+..|+
T Consensus        53 IW~C~kCg~~fA   64 (89)
T COG1997          53 IWKCRKCGAKFA   64 (89)
T ss_pred             eEEcCCCCCeec
Confidence            466666666654


No 117
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=73.10  E-value=2.2  Score=24.57  Aligned_cols=40  Identities=23%  Similarity=0.599  Sum_probs=20.2

Q ss_pred             CCeeccc--cccccCChhHHHHHHHHhCCCCCCCccccc----ccCccC
Q psy16829        170 FPFQCEI--CHKIFTNKSTMWSHKKAHKPEDQIPWECEH----CHKVYP  212 (243)
Q Consensus       170 k~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~----C~~~f~  212 (243)
                      .+..|+.  |...+ .+..|..|+...-..+  +..|+.    |+..+.
T Consensus         8 ~~v~C~~~cc~~~i-~r~~l~~H~~~~C~~~--~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMI-PRKELDDHLENECPKR--PVPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEE-ECCCHHHHHHTTSTTS--EEE-SS----S--EEE
T ss_pred             CEeeCCCCCcccce-eHHHHHHHHHccCCCC--cEECCCCCCCCCCccc
Confidence            3455665  33333 3456777777655555  667777    766654


No 118
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=72.91  E-value=0.74  Score=27.94  Aligned_cols=39  Identities=15%  Similarity=0.556  Sum_probs=18.2

Q ss_pred             eeccccccccCChhHHHHHHHHhCCCCCCCcccc--cccCccCCh
Q psy16829        172 FQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECE--HCHKVYPNK  214 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~--~C~~~f~~~  214 (243)
                      +.|+.||....-..+-.....  ..+.  -+.|.  .||.+|...
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~--~~~~--Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDT--TKER--YHQCQNVNCSATFITY   42 (72)
T ss_pred             ccCCCCCCccEEEEChhcChh--hhee--eeecCCCCCCCEEEEE
Confidence            356666655433222221111  2222  56666  677666543


No 119
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=72.34  E-value=2.2  Score=29.34  Aligned_cols=25  Identities=32%  Similarity=0.587  Sum_probs=13.6

Q ss_pred             CcccccccCccCChHHHHHHHhhcCCCC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLGVK  228 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~  228 (243)
                      -..|-+||+.|..   |.+|++.|+|..
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S-
T ss_pred             eeEEccCCcccch---HHHHHHHccCCC
Confidence            3567788877764   478888777653


No 120
>PRK04023 DNA polymerase II large subunit; Validated
Probab=71.46  E-value=4.6  Score=37.36  Aligned_cols=10  Identities=40%  Similarity=0.817  Sum_probs=6.9

Q ss_pred             CcccccccCc
Q psy16829        201 PWECEHCHKV  210 (243)
Q Consensus       201 ~~~C~~C~~~  210 (243)
                      ++.|+.|+..
T Consensus       663 ~y~CPKCG~E  672 (1121)
T PRK04023        663 EDECEKCGRE  672 (1121)
T ss_pred             CCcCCCCCCC
Confidence            5668888754


No 121
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=67.16  E-value=5.1  Score=22.27  Aligned_cols=39  Identities=21%  Similarity=0.335  Sum_probs=20.1

Q ss_pred             CCCeeccccccccCChhHHHHHHHHhCCCCCCCccccccc
Q psy16829        169 AFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCH  208 (243)
Q Consensus       169 ~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~  208 (243)
                      ++.+.|..||..|.....=+..... -|-.+.|-.|+.|.
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~e-Kgf~n~p~RC~~CR   40 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYAE-KGFDNEPKRCPSCR   40 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHHh-cCCcCCCccCHHHH
Confidence            4556777777776554433333332 22222266677665


No 122
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=66.58  E-value=1.7  Score=24.43  Aligned_cols=30  Identities=20%  Similarity=0.537  Sum_probs=13.1

Q ss_pred             CcccccccCccCChHHHHHHHhhcCCCCCCCCCCC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGP  235 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~c~~c~  235 (243)
                      .|.|+.|...|-..-.+-.|..+|     .|++|.
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~LH-----~CPGC~   50 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHETLH-----NCPGCE   50 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTTS------SSSTT-
T ss_pred             eEECCCCCCccccCcChhhhcccc-----CCcCCC
Confidence            577777777776555554444333     366653


No 123
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=66.47  E-value=3.5  Score=22.86  Aligned_cols=12  Identities=17%  Similarity=0.755  Sum_probs=7.6

Q ss_pred             ceeeccccchhc
Q psy16829         58 LLLTCVECNEDF   69 (243)
Q Consensus        58 ~~~~C~~C~~~~   69 (243)
                      ..|.|..||+.|
T Consensus         5 ~~Y~C~~Cg~~~   16 (49)
T COG1996           5 MEYKCARCGREV   16 (49)
T ss_pred             EEEEhhhcCCee
Confidence            346677776665


No 124
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=63.36  E-value=5.7  Score=31.37  Aligned_cols=30  Identities=23%  Similarity=0.613  Sum_probs=24.0

Q ss_pred             CcccccccCccCChHHHHHHHhhcCCCCCCCCCCC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGP  235 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~c~~c~  235 (243)
                      .|.|+.|...|-...+.-.|...|.     |.+|.
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~Lh~-----C~gCe  417 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETLHF-----CIGCE  417 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHHhh-----CCCCc
Confidence            6999999999999888888877665     55554


No 125
>KOG2593|consensus
Probab=62.42  E-value=10  Score=31.56  Aligned_cols=40  Identities=20%  Similarity=0.508  Sum_probs=25.6

Q ss_pred             cCCCCcccccccccccChhHHHHHHHHhcCCCCeecccccccc
Q psy16829        139 EKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIF  181 (243)
Q Consensus       139 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f  181 (243)
                      .....|.|+.|.+.|.....+.   ..-.....|.|..|+-..
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGGEL  163 (436)
T ss_pred             cccccccCCccccchhhhHHHH---hhcccCceEEEecCCCch
Confidence            4456788998888887654432   223335568888887543


No 126
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=60.29  E-value=11  Score=36.00  Aligned_cols=30  Identities=20%  Similarity=0.474  Sum_probs=16.1

Q ss_pred             CcccccccCccCChHHHHHHHhhcCCCCCCCCCCCCCccC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGPIPALA  240 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~c~~c~~~~~~  240 (243)
                      +|.|+.|+......         -++ ...|+.||.+...
T Consensus       692 vy~CPsCGaev~~d---------es~-a~~CP~CGtplv~  721 (1337)
T PRK14714        692 VYVCPDCGAEVPPD---------ESG-RVECPRCDVELTP  721 (1337)
T ss_pred             ceeCccCCCccCCC---------ccc-cccCCCCCCcccc
Confidence            56777777643321         011 2467777766543


No 127
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=59.17  E-value=4.2  Score=18.80  Aligned_cols=8  Identities=38%  Similarity=1.373  Sum_probs=5.3

Q ss_pred             Cccccccc
Q psy16829        201 PWECEHCH  208 (243)
Q Consensus       201 ~~~C~~C~  208 (243)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            56666665


No 128
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=58.94  E-value=7.1  Score=24.69  Aligned_cols=30  Identities=17%  Similarity=0.317  Sum_probs=18.9

Q ss_pred             CcccccccccccCChHHHHHHHHhhcCCCCcccCCcccccc
Q psy16829         85 TSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVG  125 (243)
Q Consensus        85 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  125 (243)
                      .|-.|..||..|.+.           ...+|..|+.|...+
T Consensus        57 ~Pa~CkkCGfef~~~-----------~ik~pSRCP~CKSE~   86 (97)
T COG3357          57 RPARCKKCGFEFRDD-----------KIKKPSRCPKCKSEW   86 (97)
T ss_pred             cChhhcccCcccccc-----------ccCCcccCCcchhhc
Confidence            566788888877541           234467777776543


No 129
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=58.37  E-value=5.9  Score=25.98  Aligned_cols=26  Identities=12%  Similarity=0.190  Sum_probs=14.0

Q ss_pred             eccccchhccChhhHHhhhhccCCCccccccccccc
Q psy16829         61 TCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAF   96 (243)
Q Consensus        61 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f   96 (243)
                      +|+.||+.|...          ...|..||.||++|
T Consensus        11 idPetg~KFYDL----------NrdPiVsPytG~s~   36 (129)
T COG4530          11 IDPETGKKFYDL----------NRDPIVSPYTGKSY   36 (129)
T ss_pred             cCccccchhhcc----------CCCccccCcccccc
Confidence            556666555433          12455566666665


No 130
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=58.36  E-value=20  Score=24.61  Aligned_cols=25  Identities=28%  Similarity=0.526  Sum_probs=20.6

Q ss_pred             cceeeccccchhccChhhHHhhhhccCC
Q psy16829         57 PLLLTCVECNEDFINVNDFVSHLRGHDS   84 (243)
Q Consensus        57 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~   84 (243)
                      +.-+.|-.+|+.|+   +|.+|+.+|.+
T Consensus        74 pD~IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          74 PDYIICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             CCeEEEeccCcchH---HHHHHHhcccC
Confidence            33478999999987   68999999876


No 131
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=57.93  E-value=11  Score=20.47  Aligned_cols=8  Identities=25%  Similarity=1.149  Sum_probs=3.8

Q ss_pred             Cccccccc
Q psy16829        201 PWECEHCH  208 (243)
Q Consensus       201 ~~~C~~C~  208 (243)
                      .|+|..|+
T Consensus        37 ~~~C~~C~   44 (46)
T PF12760_consen   37 RYRCKACR   44 (46)
T ss_pred             eEECCCCC
Confidence            44454444


No 132
>PF12907 zf-met2:  Zinc-binding
Probab=56.87  E-value=7.4  Score=20.58  Aligned_cols=8  Identities=13%  Similarity=-0.139  Sum_probs=3.5

Q ss_pred             HHHHHHHH
Q psy16829        100 DDRDLHFL  107 (243)
Q Consensus       100 ~~l~~H~~  107 (243)
                      ..|..|..
T Consensus        18 ~~L~eH~e   25 (40)
T PF12907_consen   18 PQLKEHAE   25 (40)
T ss_pred             HHHHHHHH
Confidence            33444444


No 133
>KOG3408|consensus
Probab=56.38  E-value=6.1  Score=26.49  Aligned_cols=22  Identities=18%  Similarity=0.569  Sum_probs=19.3

Q ss_pred             CcccccccCccCChHHHHHHHh
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      -|-|-.|.+.|.+...|+.|.+
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHh
Confidence            4889999999999999999976


No 134
>KOG2907|consensus
Probab=55.51  E-value=6.2  Score=26.09  Aligned_cols=39  Identities=13%  Similarity=0.327  Sum_probs=23.0

Q ss_pred             eeccccchhccChhhHHhhhhccCC-CcccccccccccCC
Q psy16829         60 LTCVECNEDFINVNDFVSHLRGHDS-TSHVCDICLEAFPS   98 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~l~~H~~~h~~-~~~~C~~C~~~f~~   98 (243)
                      .+|+.||..=-.++.|+.--..... .=|.|+.|+..|..
T Consensus        75 ~kCpkCghe~m~Y~T~QlRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQLRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhhcccccCCceEEEEcCccceeeec
Confidence            5788888754444444433222222 45888888887753


No 135
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=54.91  E-value=7  Score=21.62  Aligned_cols=8  Identities=38%  Similarity=1.394  Sum_probs=3.8

Q ss_pred             cccccccC
Q psy16829        202 WECEHCHK  209 (243)
Q Consensus       202 ~~C~~C~~  209 (243)
                      +.|..|++
T Consensus        38 ~~CGkCgy   45 (51)
T COG1998          38 WACGKCGY   45 (51)
T ss_pred             eEeccccc
Confidence            44544443


No 136
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=54.73  E-value=2.5  Score=21.80  Aligned_cols=10  Identities=30%  Similarity=0.952  Sum_probs=5.6

Q ss_pred             eccccccccC
Q psy16829        173 QCEICHKIFT  182 (243)
Q Consensus       173 ~C~~C~~~f~  182 (243)
                      .|+.||..|.
T Consensus         3 ~C~~Cg~~Yh   12 (36)
T PF05191_consen    3 ICPKCGRIYH   12 (36)
T ss_dssp             EETTTTEEEE
T ss_pred             CcCCCCCccc
Confidence            4556665553


No 137
>KOG3408|consensus
Probab=53.41  E-value=20  Score=24.15  Aligned_cols=31  Identities=23%  Similarity=0.476  Sum_probs=24.0

Q ss_pred             CCCCCCcceeeccccchhccChhhHHhhhhc
Q psy16829         51 DDGEDKPLLLTCVECNEDFINVNDFVSHLRG   81 (243)
Q Consensus        51 ~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~   81 (243)
                      .....+-..|-|..|.+.|.+...|..|.++
T Consensus        49 D~dlPG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   49 DPDLPGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCCCCCceeehhhhhhhhcchHHHHHHHhc
Confidence            3444556668899999999999999998764


No 138
>KOG4167|consensus
Probab=53.32  E-value=4.6  Score=35.79  Aligned_cols=27  Identities=22%  Similarity=0.604  Sum_probs=16.8

Q ss_pred             cceeeccccchhccChhhHHhhhhccC
Q psy16829         57 PLLLTCVECNEDFINVNDFVSHLRGHD   83 (243)
Q Consensus        57 ~~~~~C~~C~~~~~~~~~l~~H~~~h~   83 (243)
                      ...|.|..|++.|.....+..||++|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            334666666666666666666666664


No 139
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=53.22  E-value=4.1  Score=28.23  Aligned_cols=12  Identities=25%  Similarity=0.780  Sum_probs=6.3

Q ss_pred             cccccccccccC
Q psy16829        144 VYCDVCGRGFHQ  155 (243)
Q Consensus       144 ~~C~~C~~~f~~  155 (243)
                      +.|..||..|..
T Consensus        71 ~~C~~CG~~~~~   82 (135)
T PRK03824         71 LKCRNCGNEWSL   82 (135)
T ss_pred             EECCCCCCEEec
Confidence            555555555443


No 140
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=52.70  E-value=15  Score=19.46  Aligned_cols=22  Identities=32%  Similarity=0.673  Sum_probs=9.5

Q ss_pred             ccccccCccC--ChHHHHHHHhhc
Q psy16829        203 ECEHCHKVYP--NKRSYKRHKQVH  224 (243)
Q Consensus       203 ~C~~C~~~f~--~~~~l~~H~~~H  224 (243)
                      .|+.|+-.|.  ....-..|.+.|
T Consensus        15 ~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   15 TCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CCCCCCCEECCCCHHHHHHHHHHH
Confidence            4555554433  234444444443


No 141
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=52.68  E-value=9.6  Score=34.43  Aligned_cols=46  Identities=22%  Similarity=0.285  Sum_probs=28.0

Q ss_pred             eeccccchhccChh---hHHhhhhccCCCcccccccccccCChHHHHHHHHhhcCCCCcccCCccccc
Q psy16829         60 LTCVECNEDFINVN---DFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFV  124 (243)
Q Consensus        60 ~~C~~C~~~~~~~~---~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  124 (243)
                      ..|..||..+....   .|.-|+..   ....|.+||.                ....|..|+.|+..
T Consensus       436 l~C~~Cg~v~~Cp~Cd~~lt~H~~~---~~L~CH~Cg~----------------~~~~p~~Cp~Cgs~  484 (730)
T COG1198         436 LLCRDCGYIAECPNCDSPLTLHKAT---GQLRCHYCGY----------------QEPIPQSCPECGSE  484 (730)
T ss_pred             eecccCCCcccCCCCCcceEEecCC---CeeEeCCCCC----------------CCCCCCCCCCCCCC
Confidence            56777777665442   23334322   4567888876                34557888888764


No 142
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=52.66  E-value=13  Score=25.55  Aligned_cols=58  Identities=16%  Similarity=0.377  Sum_probs=32.7

Q ss_pred             cCCCCcccccccccccChhHHHHHHHHhcCCCCeeccccccccCC--hhHHHHHHHHhCCCCCCCcccccccCccCChH
Q psy16829        139 EKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTN--KSTMWSHKKAHKPEDQIPWECEHCHKVYPNKR  215 (243)
Q Consensus       139 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~~--~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~  215 (243)
                      ...+.|+|.+|......+.-          -||-.|  ||+..-.  -..|+.|-..|.       .||.|.-+|++.+
T Consensus        76 ~d~~lYeCnIC~etS~ee~F----------LKPneC--CgY~iCn~Cya~LWK~~~~yp-------vCPvCkTSFKss~  135 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEERF----------LKPNEC--CGYSICNACYANLWKFCNLYP-------VCPVCKTSFKSSS  135 (140)
T ss_pred             cCCCceeccCcccccchhhc----------CCcccc--cchHHHHHHHHHHHHHcccCC-------CCCcccccccccc
Confidence            44567888888765443321          234344  4433211  245666654332       4899998888764


No 143
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=51.99  E-value=4.6  Score=23.00  Aligned_cols=12  Identities=25%  Similarity=0.578  Sum_probs=7.2

Q ss_pred             eeccccccccCC
Q psy16829        172 FQCEICHKIFTN  183 (243)
Q Consensus       172 ~~C~~C~~~f~~  183 (243)
                      |.|+.||..+.-
T Consensus         3 ~~CP~CG~~iev   14 (54)
T TIGR01206         3 FECPDCGAEIEL   14 (54)
T ss_pred             cCCCCCCCEEec
Confidence            467777765543


No 144
>KOG2807|consensus
Probab=50.72  E-value=18  Score=28.95  Aligned_cols=88  Identities=19%  Similarity=0.275  Sum_probs=50.7

Q ss_pred             ceeeccccchhccChhhHHhhhhccCCCcccccccccccCChHHHHHHHHhhcCC-----CCc-------ccCCcccccc
Q psy16829         58 LLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTS-----DGL-------YQCNECEFVG  125 (243)
Q Consensus        58 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-----~~~-------~~C~~C~~~f  125 (243)
                      ..|.|+.|...             +-.-|..|+.|+-.......|.+-..-- ..     +.|       --|-.|+.  
T Consensus       275 ~Gy~CP~Ckak-------------vCsLP~eCpiC~ltLVss~hLARSyhhL-~PL~~F~Eip~~~~~~~~~Cf~C~~--  338 (378)
T KOG2807|consen  275 GGYFCPQCKAK-------------VCSLPIECPICSLTLVSSPHLARSYHHL-FPLKPFVEIPETEYNGSRFCFACQG--  338 (378)
T ss_pred             CceeCCcccCe-------------eecCCccCCccceeEecchHHHHHHHhh-cCCcchhhccccccCCCcceeeecc--
Confidence            34788887642             2235777888888777777765532110 01     111       11444421  


Q ss_pred             cChHHHHHHHHhhcCCCCcccccccccccChhHHHHHHHHhcCCCCeeccccc
Q psy16829        126 KRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICH  178 (243)
Q Consensus       126 ~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~  178 (243)
                                 ...+...|.|..|...|-..-+...|...|      .|+.|.
T Consensus       339 -----------~~~~~~~y~C~~Ck~~FCldCDv~iHesLh------~CpgCe  374 (378)
T KOG2807|consen  339 -----------ELLSSGRYRCESCKNVFCLDCDVFIHESLH------NCPGCE  374 (378)
T ss_pred             -----------ccCCCCcEEchhccceeeccchHHHHhhhh------cCCCcC
Confidence                       123344688888888888887777777665      366554


No 145
>KOG1280|consensus
Probab=50.57  E-value=15  Score=29.68  Aligned_cols=36  Identities=19%  Similarity=0.469  Sum_probs=19.1

Q ss_pred             CcccccccccccChhHHHHHHHHhcCCCC--eeccccc
Q psy16829        143 GVYCDVCGRGFHQNNEVTLHKIKEHNAFP--FQCEICH  178 (243)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~~~~~k~--~~C~~C~  178 (243)
                      .|.|+.|+..-.+...+..|....|.+-+  ..|++|+
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            56666666555555566666555553322  2345444


No 146
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=50.39  E-value=8.1  Score=20.26  Aligned_cols=14  Identities=21%  Similarity=0.890  Sum_probs=12.1

Q ss_pred             CcccccccCccCCh
Q psy16829        201 PWECEHCHKVYPNK  214 (243)
Q Consensus       201 ~~~C~~C~~~f~~~  214 (243)
                      ||.|..|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            89999999999754


No 147
>KOG2593|consensus
Probab=49.76  E-value=16  Score=30.52  Aligned_cols=16  Identities=25%  Similarity=0.590  Sum_probs=8.5

Q ss_pred             CCeeccccccccCChh
Q psy16829        170 FPFQCEICHKIFTNKS  185 (243)
Q Consensus       170 k~~~C~~C~~~f~~~~  185 (243)
                      ..|.|+.|.+.|....
T Consensus       127 ~~Y~Cp~C~kkyt~Le  142 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLE  142 (436)
T ss_pred             ccccCCccccchhhhH
Confidence            3455666665555443


No 148
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=49.57  E-value=6.8  Score=26.20  Aligned_cols=12  Identities=25%  Similarity=0.592  Sum_probs=6.7

Q ss_pred             eeccccccccCC
Q psy16829        172 FQCEICHKIFTN  183 (243)
Q Consensus       172 ~~C~~C~~~f~~  183 (243)
                      +.|..||..|.-
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            456666666654


No 149
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=49.01  E-value=19  Score=27.79  Aligned_cols=85  Identities=15%  Similarity=0.270  Sum_probs=42.4

Q ss_pred             cCCCCcccccccccccChhHHHHHHHHh--cCCCCeeccccccccCCh------hHHHHHHHHh--CCCCCCCccccccc
Q psy16829        139 EKVYGVYCDVCGRGFHQNNEVTLHKIKE--HNAFPFQCEICHKIFTNK------STMWSHKKAH--KPEDQIPWECEHCH  208 (243)
Q Consensus       139 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~--~~~k~~~C~~C~~~f~~~------~~l~~H~~~h--~~~~~~~~~C~~C~  208 (243)
                      ++.+.|+|..|....- ...--.|+..-  .....|+|..|++.=...      .--..|++.-  .-++.+++.||.|+
T Consensus       138 hGGrif~CsfC~~flC-EDDQFEHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg  216 (314)
T PF06524_consen  138 HGGRIFKCSFCDNFLC-EDDQFEHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKCG  216 (314)
T ss_pred             CCCeEEEeecCCCeee-ccchhhhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCCC
Confidence            5677788888875433 33333444322  234557777776542211      0112344431  11222377788887


Q ss_pred             CccCChHHHHHHHhhc
Q psy16829        209 KVYPNKRSYKRHKQVH  224 (243)
Q Consensus       209 ~~f~~~~~l~~H~~~H  224 (243)
                      .--.....|..=.|.|
T Consensus       217 ~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  217 YETQETKDLSMSTRSH  232 (314)
T ss_pred             Ccccccccceeeeecc
Confidence            6665555554444443


No 150
>KOG2272|consensus
Probab=48.85  E-value=13  Score=28.51  Aligned_cols=14  Identities=7%  Similarity=-0.059  Sum_probs=10.3

Q ss_pred             CCCCCCCCCccCcC
Q psy16829        229 HECEGGPIPALALF  242 (243)
Q Consensus       229 ~~c~~c~~~~~~~~  242 (243)
                      |.|..|++..++|.
T Consensus       281 f~Cs~Cdkkl~~K~  294 (332)
T KOG2272|consen  281 FSCSTCDKKLTQKN  294 (332)
T ss_pred             cccccccccccccc
Confidence            67788888777664


No 151
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=48.68  E-value=98  Score=22.14  Aligned_cols=54  Identities=19%  Similarity=0.142  Sum_probs=26.4

Q ss_pred             ceeecccc-chhccCh--hhHHhhhhccCCCcccccc--cccccCChHHHHHHHHhhcCCCCc
Q psy16829         58 LLLTCVEC-NEDFINV--NDFVSHLRGHDSTSHVCDI--CLEAFPSSDDRDLHFLSHLTSDGL  115 (243)
Q Consensus        58 ~~~~C~~C-~~~~~~~--~~l~~H~~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~  115 (243)
                      ....|++| |..+...  ..-+.+|.   .++..|..  |..+ .+...|+.|.+..|...+|
T Consensus        79 ~~L~CPLCRG~V~GWtvve~AR~~LN---~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~rP  137 (162)
T PF07800_consen   79 PELACPLCRGEVKGWTVVEPARRFLN---AKKRSCSQESCSFS-GTYSELRKHARSEHPSARP  137 (162)
T ss_pred             ccccCccccCceeceEEchHHHHHhc---cCCccCcccccccc-cCHHHHHHHHHhhCCCCCC
Confidence            34688888 4332211  22223332   24444543  4432 3456677777765555544


No 152
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=48.15  E-value=10  Score=20.25  Aligned_cols=11  Identities=18%  Similarity=-0.016  Sum_probs=7.8

Q ss_pred             CCCCCCCCccC
Q psy16829        230 ECEGGPIPALA  240 (243)
Q Consensus       230 ~c~~c~~~~~~  240 (243)
                      .|..||++|+.
T Consensus        10 ~C~~C~rpf~W   20 (42)
T PF10013_consen   10 ICPVCGRPFTW   20 (42)
T ss_pred             cCcccCCcchH
Confidence            57777777764


No 153
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=47.98  E-value=9.2  Score=25.60  Aligned_cols=12  Identities=17%  Similarity=0.321  Sum_probs=7.2

Q ss_pred             eeccccccccCC
Q psy16829        172 FQCEICHKIFTN  183 (243)
Q Consensus       172 ~~C~~C~~~f~~  183 (243)
                      +.|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PRK12380         71 AWCWDCSQVVEI   82 (113)
T ss_pred             EEcccCCCEEec
Confidence            566677765543


No 154
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=46.39  E-value=8.5  Score=29.02  Aligned_cols=22  Identities=23%  Similarity=0.611  Sum_probs=9.7

Q ss_pred             eeccccccccCChhHHHHHHHH
Q psy16829        172 FQCEICHKIFTNKSTMWSHKKA  193 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~  193 (243)
                      |.|+.|++.|.-..-+..|+..
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHH
T ss_pred             ECCCCCCcccCChHHHHHHHhh
Confidence            4455555555444444444443


No 155
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=46.03  E-value=9.9  Score=28.66  Aligned_cols=29  Identities=24%  Similarity=0.405  Sum_probs=22.4

Q ss_pred             CCCCcccccccccccChhHHHHHHHHhcC
Q psy16829        140 KVYGVYCDVCGRGFHQNNEVTLHKIKEHN  168 (243)
Q Consensus       140 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  168 (243)
                      .+..|.|+.|++.|....-+.+|+...|.
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            44569999999999999999999987764


No 156
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=45.93  E-value=9.7  Score=20.07  Aligned_cols=19  Identities=11%  Similarity=0.324  Sum_probs=10.5

Q ss_pred             CcccccccCccCChHHHHH
Q psy16829        201 PWECEHCHKVYPNKRSYKR  219 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~  219 (243)
                      .+.|+.|+-.|-....|.+
T Consensus        19 id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEECCCCCeEEccHHHHHH
Confidence            3556666666555555543


No 157
>KOG4167|consensus
Probab=45.22  E-value=5.1  Score=35.52  Aligned_cols=23  Identities=26%  Similarity=0.525  Sum_probs=21.9

Q ss_pred             ccccccccccCChHHHHHHHHhh
Q psy16829         87 HVCDICLEAFPSSDDRDLHFLSH  109 (243)
Q Consensus        87 ~~C~~C~~~f~~~~~l~~H~~~h  109 (243)
                      |.|..|++.|.....+..||++|
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHH
Confidence            78999999999999999999988


No 158
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=44.38  E-value=12  Score=20.91  Aligned_cols=8  Identities=25%  Similarity=0.891  Sum_probs=3.5

Q ss_pred             eecccccc
Q psy16829        172 FQCEICHK  179 (243)
Q Consensus       172 ~~C~~C~~  179 (243)
                      +.|..||+
T Consensus        38 ~~C~~Cgy   45 (50)
T PRK00432         38 WHCGKCGY   45 (50)
T ss_pred             EECCCcCC
Confidence            34444443


No 159
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=44.22  E-value=9.2  Score=24.34  Aligned_cols=12  Identities=25%  Similarity=0.905  Sum_probs=6.4

Q ss_pred             CcccCCcccccc
Q psy16829        114 GLYQCNECEFVG  125 (243)
Q Consensus       114 ~~~~C~~C~~~f  125 (243)
                      ..+.|..|+..|
T Consensus        53 GIW~C~~C~~~~   64 (90)
T PTZ00255         53 GIWRCKGCKKTV   64 (90)
T ss_pred             EEEEcCCCCCEE
Confidence            345555555544


No 160
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=43.67  E-value=5.7  Score=25.27  Aligned_cols=11  Identities=18%  Similarity=0.582  Sum_probs=5.8

Q ss_pred             Ccccccccccc
Q psy16829         85 TSHVCDICLEA   95 (243)
Q Consensus        85 ~~~~C~~C~~~   95 (243)
                      ..|.|+.|++.
T Consensus        34 ~ky~Cp~Cgk~   44 (90)
T PF01780_consen   34 AKYTCPFCGKT   44 (90)
T ss_dssp             S-BEESSSSSS
T ss_pred             CCCcCCCCCCc
Confidence            45666666653


No 161
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=43.09  E-value=8.7  Score=22.00  Aligned_cols=12  Identities=17%  Similarity=0.548  Sum_probs=7.3

Q ss_pred             eeccccchhccC
Q psy16829         60 LTCVECNEDFIN   71 (243)
Q Consensus        60 ~~C~~C~~~~~~   71 (243)
                      ++|.+|++.+..
T Consensus         3 vkC~lCdk~~~I   14 (56)
T PF09963_consen    3 VKCILCDKKEEI   14 (56)
T ss_pred             eEEEecCCEEEe
Confidence            467777765543


No 162
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=42.44  E-value=3.2  Score=32.95  Aligned_cols=35  Identities=20%  Similarity=0.467  Sum_probs=12.6

Q ss_pred             ccccccccccChhHHHHHHHHhcCCCCeeccccccccC
Q psy16829        145 YCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFT  182 (243)
Q Consensus       145 ~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~  182 (243)
                      .|++||.. ...+.+..-..  .|.+...|..|+..+.
T Consensus       174 ~CPvCGs~-P~~s~l~~~~~--~G~R~L~Cs~C~t~W~  208 (290)
T PF04216_consen  174 YCPVCGSP-PVLSVLRGGER--EGKRYLHCSLCGTEWR  208 (290)
T ss_dssp             S-TTT----EEEEEEE--------EEEEEETTT--EEE
T ss_pred             cCCCCCCc-CceEEEecCCC--CccEEEEcCCCCCeee
Confidence            68888754 22222211111  2556667777776654


No 163
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=41.28  E-value=14  Score=24.97  Aligned_cols=11  Identities=27%  Similarity=1.050  Sum_probs=6.0

Q ss_pred             eeccccccccC
Q psy16829        172 FQCEICHKIFT  182 (243)
Q Consensus       172 ~~C~~C~~~f~  182 (243)
                      +.|..||..|.
T Consensus        72 ~~C~~Cg~~~~   82 (117)
T PRK00564         72 LECKDCSHVFK   82 (117)
T ss_pred             EEhhhCCCccc
Confidence            45666665554


No 164
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=41.17  E-value=14  Score=29.22  Aligned_cols=26  Identities=19%  Similarity=0.439  Sum_probs=18.8

Q ss_pred             CCCcccccccccccChhHHHHHHHHh
Q psy16829        141 VYGVYCDVCGRGFHQNNEVTLHKIKE  166 (243)
Q Consensus       141 ~~~~~C~~C~~~f~~~~~l~~H~~~~  166 (243)
                      ...|.|..|...|....+...|...|
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHh
Confidence            34577888887787777777777655


No 165
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=41.14  E-value=20  Score=20.23  Aligned_cols=12  Identities=17%  Similarity=0.706  Sum_probs=5.9

Q ss_pred             eeccccccccCC
Q psy16829        172 FQCEICHKIFTN  183 (243)
Q Consensus       172 ~~C~~C~~~f~~  183 (243)
                      ++|+.||..|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            455555554443


No 166
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=41.14  E-value=5.5  Score=25.71  Aligned_cols=8  Identities=38%  Similarity=1.094  Sum_probs=3.5

Q ss_pred             eecccccc
Q psy16829        172 FQCEICHK  179 (243)
Q Consensus       172 ~~C~~C~~  179 (243)
                      |.|+.||.
T Consensus        23 FtCp~Cgh   30 (104)
T COG4888          23 FTCPRCGH   30 (104)
T ss_pred             EecCccCC
Confidence            44444443


No 167
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=40.48  E-value=9.7  Score=18.35  Aligned_cols=9  Identities=44%  Similarity=1.630  Sum_probs=4.9

Q ss_pred             eccccchhc
Q psy16829         61 TCVECNEDF   69 (243)
Q Consensus        61 ~C~~C~~~~   69 (243)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            455555555


No 168
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=39.91  E-value=9.9  Score=24.24  Aligned_cols=12  Identities=25%  Similarity=0.778  Sum_probs=6.3

Q ss_pred             CcccCCcccccc
Q psy16829        114 GLYQCNECEFVG  125 (243)
Q Consensus       114 ~~~~C~~C~~~f  125 (243)
                      ..+.|..|+..|
T Consensus        52 GIW~C~~C~~~~   63 (91)
T TIGR00280        52 GIWTCRKCGAKF   63 (91)
T ss_pred             EEEEcCCCCCEE
Confidence            345555555544


No 169
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=39.72  E-value=3.5  Score=21.62  Aligned_cols=9  Identities=33%  Similarity=0.504  Sum_probs=4.7

Q ss_pred             ccccccccc
Q psy16829         87 HVCDICLEA   95 (243)
Q Consensus        87 ~~C~~C~~~   95 (243)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            455555543


No 170
>COG1773 Rubredoxin [Energy production and conversion]
Probab=39.69  E-value=15  Score=21.00  Aligned_cols=14  Identities=14%  Similarity=0.845  Sum_probs=11.4

Q ss_pred             CeeccccccccCCh
Q psy16829        171 PFQCEICHKIFTNK  184 (243)
Q Consensus       171 ~~~C~~C~~~f~~~  184 (243)
                      .|+|..||+.|.-.
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            58899999998754


No 171
>PRK10220 hypothetical protein; Provisional
Probab=39.20  E-value=19  Score=23.76  Aligned_cols=12  Identities=33%  Similarity=0.811  Sum_probs=5.8

Q ss_pred             cccCCccccccc
Q psy16829        115 LYQCNECEFVGK  126 (243)
Q Consensus       115 ~~~C~~C~~~f~  126 (243)
                      .|.|+.|+..+.
T Consensus        20 ~~vCpeC~hEW~   31 (111)
T PRK10220         20 MYICPECAHEWN   31 (111)
T ss_pred             eEECCcccCcCC
Confidence            355555554443


No 172
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=38.67  E-value=7.5  Score=20.50  Aligned_cols=9  Identities=33%  Similarity=0.648  Sum_probs=4.5

Q ss_pred             ccccccccc
Q psy16829         87 HVCDICLEA   95 (243)
Q Consensus        87 ~~C~~C~~~   95 (243)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            455555543


No 173
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=38.48  E-value=9  Score=20.50  Aligned_cols=14  Identities=43%  Similarity=1.084  Sum_probs=9.4

Q ss_pred             CcccccccCccCCh
Q psy16829        201 PWECEHCHKVYPNK  214 (243)
Q Consensus       201 ~~~C~~C~~~f~~~  214 (243)
                      ||.|+.|+..|-..
T Consensus        13 ~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   13 PFKCKHCGKSFCLK   26 (43)
T ss_dssp             HEE-TTTS-EE-TT
T ss_pred             CeECCCCCcccCcc
Confidence            89999999998754


No 174
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=38.14  E-value=18  Score=24.32  Aligned_cols=28  Identities=21%  Similarity=0.490  Sum_probs=18.2

Q ss_pred             CcceeeccccchhccChhhHHhhhhccCCCccccccccc
Q psy16829         56 KPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLE   94 (243)
Q Consensus        56 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~   94 (243)
                      .+....|..|+..|....           ..+.||.|+.
T Consensus        67 ~p~~~~C~~Cg~~~~~~~-----------~~~~CP~Cgs   94 (115)
T TIGR00100        67 EPVECECEDCSEEVSPEI-----------DLYRCPKCHG   94 (115)
T ss_pred             eCcEEEcccCCCEEecCC-----------cCccCcCCcC
Confidence            344578888887765432           1356888874


No 175
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=38.12  E-value=17  Score=23.92  Aligned_cols=12  Identities=17%  Similarity=0.445  Sum_probs=5.8

Q ss_pred             cccCCccccccc
Q psy16829        115 LYQCNECEFVGK  126 (243)
Q Consensus       115 ~~~C~~C~~~f~  126 (243)
                      .|.|+.|+..+.
T Consensus        19 ~~iCpeC~~EW~   30 (109)
T TIGR00686        19 QLICPSCLYEWN   30 (109)
T ss_pred             eeECcccccccc
Confidence            345555554443


No 176
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=37.65  E-value=16  Score=24.47  Aligned_cols=11  Identities=36%  Similarity=0.821  Sum_probs=6.5

Q ss_pred             eeccccccccC
Q psy16829        172 FQCEICHKIFT  182 (243)
Q Consensus       172 ~~C~~C~~~f~  182 (243)
                      +.|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (114)
T PRK03681         71 CWCETCQQYVT   81 (114)
T ss_pred             EEcccCCCeee
Confidence            45666665553


No 177
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=37.39  E-value=18  Score=31.27  Aligned_cols=10  Identities=20%  Similarity=0.378  Sum_probs=6.1

Q ss_pred             CcccCCcccc
Q psy16829        114 GLYQCNECEF  123 (243)
Q Consensus       114 ~~~~C~~C~~  123 (243)
                      .|..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            3566777665


No 178
>KOG0717|consensus
Probab=36.68  E-value=20  Score=30.27  Aligned_cols=21  Identities=24%  Similarity=0.635  Sum_probs=19.5

Q ss_pred             cccccccCccCChHHHHHHHh
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      +-|.+|+++|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999999999974


No 179
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=36.50  E-value=13  Score=18.93  Aligned_cols=9  Identities=22%  Similarity=0.586  Sum_probs=2.7

Q ss_pred             CCCCCCCcc
Q psy16829        231 CEGGPIPAL  239 (243)
Q Consensus       231 c~~c~~~~~  239 (243)
                      |.+|++.|.
T Consensus         6 C~eC~~~f~   14 (34)
T PF01286_consen    6 CDECGKPFM   14 (34)
T ss_dssp             -TTT--EES
T ss_pred             HhHhCCHHH
Confidence            444444443


No 180
>PRK04351 hypothetical protein; Provisional
Probab=36.16  E-value=16  Score=25.86  Aligned_cols=10  Identities=10%  Similarity=-0.044  Sum_probs=4.6

Q ss_pred             CCCCCCCCCc
Q psy16829        229 HECEGGPIPA  238 (243)
Q Consensus       229 ~~c~~c~~~~  238 (243)
                      |.|..|+-.+
T Consensus       133 yrCg~C~g~L  142 (149)
T PRK04351        133 YRCGKCRGKL  142 (149)
T ss_pred             EEeCCCCcEe
Confidence            4555544433


No 181
>KOG1280|consensus
Probab=36.03  E-value=36  Score=27.59  Aligned_cols=37  Identities=27%  Similarity=0.542  Sum_probs=26.9

Q ss_pred             cceeeccccchhccChhhHHhhhhccCC---Ccccccccc
Q psy16829         57 PLLLTCVECNEDFINVNDFVSHLRGHDS---TSHVCDICL   93 (243)
Q Consensus        57 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~---~~~~C~~C~   93 (243)
                      +..|.|++|+..=.+...|..|+..-+.   ....|++|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3369999999887888889999876544   334567665


No 182
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=35.83  E-value=40  Score=24.62  Aligned_cols=34  Identities=15%  Similarity=0.351  Sum_probs=18.8

Q ss_pred             cCCCCcccccccccccChhHHHHHHHHhcCCCCeecccccccc
Q psy16829        139 EKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIF  181 (243)
Q Consensus       139 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f  181 (243)
                      .....|.|+.|.-.++...+..      .   .|.|+.||...
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~~------~---~F~Cp~Cg~~L  142 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAME------L---GFTCPKCGEDL  142 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHHH------h---CCCCCCCCchh
Confidence            4455677777765554433211      1   16777777653


No 183
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=35.67  E-value=28  Score=31.64  Aligned_cols=9  Identities=11%  Similarity=0.213  Sum_probs=4.9

Q ss_pred             CCCCCCCCC
Q psy16829        229 HECEGGPIP  237 (243)
Q Consensus       229 ~~c~~c~~~  237 (243)
                      ..|+.||-.
T Consensus       476 ~~Cp~Cgs~  484 (730)
T COG1198         476 QSCPECGSE  484 (730)
T ss_pred             CCCCCCCCC
Confidence            555555543


No 184
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=35.59  E-value=24  Score=28.33  Aligned_cols=15  Identities=13%  Similarity=0.467  Sum_probs=8.8

Q ss_pred             cCCCCeecccccccc
Q psy16829        167 HNAFPFQCEICHKIF  181 (243)
Q Consensus       167 ~~~k~~~C~~C~~~f  181 (243)
                      .|.+...|..|+-.+
T Consensus       206 ~G~RyL~CslC~teW  220 (305)
T TIGR01562       206 TGLRYLSCSLCATEW  220 (305)
T ss_pred             CCceEEEcCCCCCcc
Confidence            345556677776544


No 185
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=35.50  E-value=18  Score=28.99  Aligned_cols=15  Identities=13%  Similarity=0.565  Sum_probs=8.2

Q ss_pred             cCCCCeecccccccc
Q psy16829        167 HNAFPFQCEICHKIF  181 (243)
Q Consensus       167 ~~~k~~~C~~C~~~f  181 (243)
                      .|.+...|..|+-.+
T Consensus       208 ~G~RyL~CslC~teW  222 (309)
T PRK03564        208 QGLRYLHCNLCESEW  222 (309)
T ss_pred             CCceEEEcCCCCCcc
Confidence            345555666666444


No 186
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=35.30  E-value=25  Score=20.83  Aligned_cols=7  Identities=43%  Similarity=1.203  Sum_probs=2.7

Q ss_pred             eeccccc
Q psy16829        172 FQCEICH  178 (243)
Q Consensus       172 ~~C~~C~  178 (243)
                      |.|+.||
T Consensus        47 ~~C~~Cg   53 (69)
T PF07282_consen   47 FTCPNCG   53 (69)
T ss_pred             EEcCCCC
Confidence            3333333


No 187
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=35.12  E-value=12  Score=23.80  Aligned_cols=12  Identities=25%  Similarity=0.825  Sum_probs=6.3

Q ss_pred             CcccCCcccccc
Q psy16829        114 GLYQCNECEFVG  125 (243)
Q Consensus       114 ~~~~C~~C~~~f  125 (243)
                      ..+.|..|+..|
T Consensus        53 GIW~C~~C~~~~   64 (90)
T PRK03976         53 GIWECRKCGAKF   64 (90)
T ss_pred             EEEEcCCCCCEE
Confidence            345555555544


No 188
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=34.36  E-value=24  Score=20.89  Aligned_cols=8  Identities=50%  Similarity=1.593  Sum_probs=1.8

Q ss_pred             cccccccc
Q psy16829        146 CDVCGRGF  153 (243)
Q Consensus       146 C~~C~~~f  153 (243)
                      |..|++.|
T Consensus        12 C~~C~~~F   19 (69)
T PF01363_consen   12 CMICGKKF   19 (69)
T ss_dssp             -TTT--B-
T ss_pred             CcCcCCcC
Confidence            44444444


No 189
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=34.04  E-value=30  Score=29.50  Aligned_cols=21  Identities=29%  Similarity=0.782  Sum_probs=10.2

Q ss_pred             cccccccCccCChHHHHHHHh
Q psy16829        202 WECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       202 ~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      +.|+.|.+.|.....+..|+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            344445555555555555543


No 190
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=34.03  E-value=17  Score=25.66  Aligned_cols=10  Identities=30%  Similarity=1.481  Sum_probs=4.7

Q ss_pred             Ceecccccccc
Q psy16829        171 PFQCEICHKIF  181 (243)
Q Consensus       171 ~~~C~~C~~~f  181 (243)
                      +|.|. |+..|
T Consensus       117 ~Y~C~-C~q~~  126 (156)
T COG3091         117 PYRCQ-CQQHY  126 (156)
T ss_pred             eEEee-cCCcc
Confidence            34554 55443


No 191
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.78  E-value=29  Score=20.19  Aligned_cols=8  Identities=25%  Similarity=1.036  Sum_probs=3.5

Q ss_pred             eecccccc
Q psy16829        172 FQCEICHK  179 (243)
Q Consensus       172 ~~C~~C~~  179 (243)
                      |.|+.|..
T Consensus        32 ymC~eC~~   39 (68)
T COG4896          32 YMCPECEH   39 (68)
T ss_pred             EechhhHh
Confidence            44444443


No 192
>KOG0978|consensus
Probab=33.74  E-value=13  Score=33.12  Aligned_cols=47  Identities=26%  Similarity=0.518  Sum_probs=25.3

Q ss_pred             eeeccccchhccChhhHH-hhh------hc-cCCCcccccccccccCChHHHHHH
Q psy16829         59 LLTCVECNEDFINVNDFV-SHL------RG-HDSTSHVCDICLEAFPSSDDRDLH  105 (243)
Q Consensus        59 ~~~C~~C~~~~~~~~~l~-~H~------~~-h~~~~~~C~~C~~~f~~~~~l~~H  105 (243)
                      ..+|+.|...+....-.. -|.      +. ...+.-+||.|+..|.....+..|
T Consensus       643 ~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  643 LLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             ceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCcccccccC
Confidence            479999985544332111 121      11 111456788888888766554443


No 193
>KOG1842|consensus
Probab=33.21  E-value=25  Score=29.46  Aligned_cols=26  Identities=27%  Similarity=0.392  Sum_probs=17.1

Q ss_pred             CeeccccccccCChhHHHHHHHHhCC
Q psy16829        171 PFQCEICHKIFTNKSTMWSHKKAHKP  196 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~  196 (243)
                      .|.||+|...|.+...|..|...-|+
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcc
Confidence            36677777777777777777665443


No 194
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=33.12  E-value=20  Score=18.96  Aligned_cols=12  Identities=17%  Similarity=0.520  Sum_probs=9.8

Q ss_pred             ceeeccccchhc
Q psy16829         58 LLLTCVECNEDF   69 (243)
Q Consensus        58 ~~~~C~~C~~~~   69 (243)
                      ....|+.|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            358999999876


No 195
>KOG3214|consensus
Probab=33.11  E-value=11  Score=24.36  Aligned_cols=12  Identities=17%  Similarity=0.661  Sum_probs=6.5

Q ss_pred             cccccccCccCC
Q psy16829        202 WECEHCHKVYPN  213 (243)
Q Consensus       202 ~~C~~C~~~f~~  213 (243)
                      ..|.+|+.+|.+
T Consensus        48 ~sC~iC~esFqt   59 (109)
T KOG3214|consen   48 ASCRICEESFQT   59 (109)
T ss_pred             eeeeehhhhhcc
Confidence            345555555554


No 196
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=32.42  E-value=36  Score=17.47  Aligned_cols=11  Identities=27%  Similarity=0.582  Sum_probs=5.4

Q ss_pred             ccccccCccCC
Q psy16829        203 ECEHCHKVYPN  213 (243)
Q Consensus       203 ~C~~C~~~f~~  213 (243)
                      .|+.|++.|..
T Consensus         4 ~CprC~kg~Hw   14 (36)
T PF14787_consen    4 LCPRCGKGFHW   14 (36)
T ss_dssp             C-TTTSSSCS-
T ss_pred             cCcccCCCcch
Confidence            46666666543


No 197
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=32.17  E-value=7.8  Score=34.46  Aligned_cols=29  Identities=24%  Similarity=0.644  Sum_probs=15.5

Q ss_pred             eccccccccCChhHHHHHHHHhCCCCCCCcccccccC
Q psy16829        173 QCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHK  209 (243)
Q Consensus       173 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~  209 (243)
                      .|+.|.+.|.+..+-+-|     . .  |..|+.||-
T Consensus       153 lC~~C~~EY~dP~nRRfH-----A-Q--p~aCp~CGP  181 (750)
T COG0068         153 LCPFCDKEYKDPLNRRFH-----A-Q--PIACPKCGP  181 (750)
T ss_pred             CCHHHHHHhcCccccccc-----c-c--cccCcccCC
Confidence            466666666655443322     1 1  566666664


No 198
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.08  E-value=13  Score=20.42  Aligned_cols=11  Identities=18%  Similarity=0.003  Sum_probs=8.0

Q ss_pred             CCCCCCCCccC
Q psy16829        230 ECEGGPIPALA  240 (243)
Q Consensus       230 ~c~~c~~~~~~  240 (243)
                      .|+.|+++|+.
T Consensus        14 ICpvCqRPFsW   24 (54)
T COG4338          14 ICPVCQRPFSW   24 (54)
T ss_pred             hhhhhcCchHH
Confidence            57778888764


No 199
>PRK12496 hypothetical protein; Provisional
Probab=31.82  E-value=28  Score=25.06  Aligned_cols=11  Identities=27%  Similarity=0.661  Sum_probs=6.8

Q ss_pred             eeccccccccC
Q psy16829        172 FQCEICHKIFT  182 (243)
Q Consensus       172 ~~C~~C~~~f~  182 (243)
                      |.|+-|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            45666666664


No 200
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=31.47  E-value=24  Score=23.17  Aligned_cols=10  Identities=20%  Similarity=0.577  Sum_probs=6.5

Q ss_pred             eeeccccchh
Q psy16829         59 LLTCVECNED   68 (243)
Q Consensus        59 ~~~C~~C~~~   68 (243)
                      +..|+.||..
T Consensus         2 p~~CpYCg~~   11 (102)
T PF11672_consen    2 PIICPYCGGP   11 (102)
T ss_pred             CcccCCCCCe
Confidence            4577777653


No 201
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=31.34  E-value=12  Score=26.51  Aligned_cols=10  Identities=20%  Similarity=1.032  Sum_probs=4.8

Q ss_pred             eecccccccc
Q psy16829        172 FQCEICHKIF  181 (243)
Q Consensus       172 ~~C~~C~~~f  181 (243)
                      |.|+.|+..+
T Consensus       124 ~~C~~C~~~~  133 (157)
T PF10263_consen  124 YRCPSCGREY  133 (157)
T ss_pred             EEcCCCCCEe
Confidence            4455555444


No 202
>KOG0782|consensus
Probab=31.10  E-value=5.4  Score=34.36  Aligned_cols=25  Identities=28%  Similarity=0.547  Sum_probs=11.5

Q ss_pred             hHHhhhhccCC-CcccccccccccCC
Q psy16829         74 DFVSHLRGHDS-TSHVCDICLEAFPS   98 (243)
Q Consensus        74 ~l~~H~~~h~~-~~~~C~~C~~~f~~   98 (243)
                      .|.+|...|.. ..-+|..|+++|-.
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQ  265 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQ  265 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhh
Confidence            34444444433 33455555555533


No 203
>PRK14873 primosome assembly protein PriA; Provisional
Probab=31.02  E-value=35  Score=30.75  Aligned_cols=47  Identities=19%  Similarity=0.350  Sum_probs=25.1

Q ss_pred             eeccccchhccChhhHHhhhhccCC-CcccccccccccCChHHHHHHHHhhcCCCCcccCCccccc
Q psy16829         60 LTCVECNEDFINVNDFVSHLRGHDS-TSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFV  124 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~l~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  124 (243)
                      +.|..||..+..... ...+..|.. ....|..||..                . .|+.|+.|+..
T Consensus       384 l~C~~Cg~~~~C~~C-~~~L~~h~~~~~l~Ch~CG~~----------------~-~p~~Cp~Cgs~  431 (665)
T PRK14873        384 LACARCRTPARCRHC-TGPLGLPSAGGTPRCRWCGRA----------------A-PDWRCPRCGSD  431 (665)
T ss_pred             eEhhhCcCeeECCCC-CCceeEecCCCeeECCCCcCC----------------C-cCccCCCCcCC
Confidence            467777765544321 011122222 45678888752                2 36788888764


No 204
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=30.93  E-value=27  Score=22.66  Aligned_cols=16  Identities=25%  Similarity=0.625  Sum_probs=12.3

Q ss_pred             CCCCeeccccccccCC
Q psy16829        168 NAFPFQCEICHKIFTN  183 (243)
Q Consensus       168 ~~k~~~C~~C~~~f~~  183 (243)
                      ..++.+|+.||..|..
T Consensus        76 ~g~~~rC~eCG~~fkL   91 (97)
T cd00924          76 KGKPKRCPECGHVFKL   91 (97)
T ss_pred             CCCceeCCCCCcEEEE
Confidence            3478889999988864


No 205
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=30.52  E-value=17  Score=20.48  Aligned_cols=9  Identities=22%  Similarity=0.634  Sum_probs=2.8

Q ss_pred             ccccccCcc
Q psy16829        203 ECEHCHKVY  211 (243)
Q Consensus       203 ~C~~C~~~f  211 (243)
                      .||+|++.|
T Consensus        22 ~CPlC~r~l   30 (54)
T PF04423_consen   22 CCPLCGRPL   30 (54)
T ss_dssp             E-TTT--EE
T ss_pred             cCCCCCCCC
Confidence            455555443


No 206
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=30.48  E-value=21  Score=17.20  Aligned_cols=10  Identities=20%  Similarity=0.617  Sum_probs=3.8

Q ss_pred             CcccccccCc
Q psy16829        201 PWECEHCHKV  210 (243)
Q Consensus       201 ~~~C~~C~~~  210 (243)
                      .|.|..|+..
T Consensus        15 ~Y~C~~Cdf~   24 (30)
T PF07649_consen   15 FYRCSECDFD   24 (30)
T ss_dssp             EEE-TTT---
T ss_pred             eEECccCCCc
Confidence            5666666543


No 207
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.42  E-value=25  Score=20.50  Aligned_cols=15  Identities=13%  Similarity=0.363  Sum_probs=11.4

Q ss_pred             Ccceeeccccchhcc
Q psy16829         56 KPLLLTCVECNEDFI   70 (243)
Q Consensus        56 ~~~~~~C~~C~~~~~   70 (243)
                      .+....|++|+..|.
T Consensus        45 ~~gev~CPYC~t~y~   59 (62)
T COG4391          45 DEGEVVCPYCSTRYR   59 (62)
T ss_pred             CCCcEecCccccEEE
Confidence            344589999998775


No 208
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.37  E-value=26  Score=21.44  Aligned_cols=37  Identities=22%  Similarity=0.458  Sum_probs=22.3

Q ss_pred             CCCcceeeccccchhccChhhHHhhhhccCCCccccccccccc
Q psy16829         54 EDKPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAF   96 (243)
Q Consensus        54 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f   96 (243)
                      ..+...|.|..|+..|.    +..++.  ......|+.|+..+
T Consensus         7 lMPtY~Y~c~~cg~~~d----vvq~~~--ddplt~ce~c~a~~   43 (82)
T COG2331           7 LMPTYSYECTECGNRFD----VVQAMT--DDPLTTCEECGARL   43 (82)
T ss_pred             cccceEEeecccchHHH----HHHhcc--cCccccChhhChHH
Confidence            34556688888887653    344443  22455788887643


No 209
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=29.89  E-value=36  Score=23.94  Aligned_cols=16  Identities=31%  Similarity=0.592  Sum_probs=9.9

Q ss_pred             CeeccccccccCChhH
Q psy16829        171 PFQCEICHKIFTNKST  186 (243)
Q Consensus       171 ~~~C~~C~~~f~~~~~  186 (243)
                      -+.|+.||+.|-.-+.
T Consensus       124 f~~C~~C~kiyW~GsH  139 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSH  139 (147)
T ss_pred             EEECCCCCCEeccccc
Confidence            4667777777655443


No 210
>KOG4602|consensus
Probab=29.85  E-value=91  Score=24.17  Aligned_cols=37  Identities=30%  Similarity=0.474  Sum_probs=23.1

Q ss_pred             ceeeccccchhccChhhHHhhhhcc-CC-------Cccccccccc
Q psy16829         58 LLLTCVECNEDFINVNDFVSHLRGH-DS-------TSHVCDICLE   94 (243)
Q Consensus        58 ~~~~C~~C~~~~~~~~~l~~H~~~h-~~-------~~~~C~~C~~   94 (243)
                      .+.-|.+|...-.....+..|...- .+       +.|.|++||.
T Consensus       232 r~l~CvFC~nN~E~~A~y~tH~lkd~dgRVLCPkLR~YVCPiCGA  276 (318)
T KOG4602|consen  232 RPLCCVFCFNNAEEFARYHTHPLKDKDGRVLCPKLRSYVCPICGA  276 (318)
T ss_pred             CceeEEeecCCCchhhheecccccCCCCcEechhHhhhcCccccc
Confidence            3467888976655556666665422 12       3577888875


No 211
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=29.70  E-value=13  Score=19.53  Aligned_cols=12  Identities=17%  Similarity=0.639  Sum_probs=5.5

Q ss_pred             CCCCeecccccc
Q psy16829        168 NAFPFQCEICHK  179 (243)
Q Consensus       168 ~~k~~~C~~C~~  179 (243)
                      +.+.|.|++|+.
T Consensus        21 ~~~~w~C~~C~~   32 (40)
T PF04810_consen   21 GGKTWICNFCGT   32 (40)
T ss_dssp             TTTEEEETTT--
T ss_pred             CCCEEECcCCCC
Confidence            344566666654


No 212
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=29.66  E-value=44  Score=28.55  Aligned_cols=23  Identities=26%  Similarity=0.599  Sum_probs=13.1

Q ss_pred             eeccccccccCChhHHHHHHHHh
Q psy16829        172 FQCEICHKIFTNKSTMWSHKKAH  194 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h  194 (243)
                      +.|+.|.+.|.....+..|+...
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~e   80 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQE   80 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHh
Confidence            45555655565555555555543


No 213
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=29.37  E-value=25  Score=19.36  Aligned_cols=13  Identities=23%  Similarity=0.984  Sum_probs=10.3

Q ss_pred             eeccccccccCCh
Q psy16829        172 FQCEICHKIFTNK  184 (243)
Q Consensus       172 ~~C~~C~~~f~~~  184 (243)
                      |+|..|++.|.-.
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            7888999888654


No 214
>KOG2636|consensus
Probab=29.30  E-value=42  Score=28.23  Aligned_cols=44  Identities=14%  Similarity=0.190  Sum_probs=29.4

Q ss_pred             eeeccccchhccChhhHHhhhhccCCCcccccccccccCChHHHHHHHH
Q psy16829         59 LLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFL  107 (243)
Q Consensus        59 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~  107 (243)
                      .+.|..|++.+.....|..|...     -.|+.|++.|.+++.-..|+.
T Consensus       249 el~~~g~erlk~al~alglk~gG-----t~~~ra~rlf~Tk~~~l~~L~  292 (497)
T KOG2636|consen  249 ELYCLGCERLKSALTALGLKCGG-----TLHERAQRLFSTKSKSLSHLD  292 (497)
T ss_pred             HHHhhchhHHHHHHHHHHHhcCC-----eecHHHHhhhhhcCcchhhhh
Confidence            36788888887777677766532     236677777877766655554


No 215
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=28.89  E-value=13  Score=30.19  Aligned_cols=40  Identities=20%  Similarity=0.352  Sum_probs=15.4

Q ss_pred             eeccccccccCChhHHHH---HH-HHhCCCCCCCcccccccCccC
Q psy16829        172 FQCEICHKIFTNKSTMWS---HK-KAHKPEDQIPWECEHCHKVYP  212 (243)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~---H~-~~h~~~~~~~~~C~~C~~~f~  212 (243)
                      +.|..|.+.+......-.   |. ..|.+.+ +=|+|..|++...
T Consensus       253 v~C~~C~yt~~~~~~~C~~~~H~l~~~~a~K-RFFkC~~C~~Rt~  296 (344)
T PF09332_consen  253 VTCKQCKYTAFKPSDRCKEEGHPLKWHDAVK-RFFKCKDCGNRTI  296 (344)
T ss_dssp             EEETTT--EESS--HHHHHTT--EEEEEEE--EEEE-T-TS-EEE
T ss_pred             EEcCCCCCcccCcchhHHhcCCceEEeeeee-eeEECCCCCCeee
Confidence            668888777555443321   11 0111111 2477888887654


No 216
>KOG1842|consensus
Probab=28.82  E-value=36  Score=28.63  Aligned_cols=27  Identities=22%  Similarity=0.263  Sum_probs=20.8

Q ss_pred             ceeeccccchhccChhhHHhhhhccCC
Q psy16829         58 LLLTCVECNEDFINVNDFVSHLRGHDS   84 (243)
Q Consensus        58 ~~~~C~~C~~~~~~~~~l~~H~~~h~~   84 (243)
                      ..|.||+|...|.+...|..|...-|.
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcc
Confidence            347888888888888888888765443


No 217
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=28.74  E-value=24  Score=19.69  Aligned_cols=13  Identities=31%  Similarity=0.986  Sum_probs=10.5

Q ss_pred             eeccccccccCCh
Q psy16829        172 FQCEICHKIFTNK  184 (243)
Q Consensus       172 ~~C~~C~~~f~~~  184 (243)
                      |+|..||+.|.-.
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            7899999988753


No 218
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=28.05  E-value=34  Score=19.22  Aligned_cols=9  Identities=56%  Similarity=0.933  Sum_probs=3.7

Q ss_pred             ccccccccC
Q psy16829        174 CEICHKIFT  182 (243)
Q Consensus       174 C~~C~~~f~  182 (243)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            334444443


No 219
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=27.66  E-value=24  Score=24.86  Aligned_cols=32  Identities=22%  Similarity=0.395  Sum_probs=19.6

Q ss_pred             CCcceeeccccchhccChhhHHhhhhccCCCcccccccccc
Q psy16829         55 DKPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEA   95 (243)
Q Consensus        55 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~   95 (243)
                      .+...+.|..||.....         .+.+..-.|+.|+..
T Consensus       108 ~g~G~l~C~~Cg~~~~~---------~~~~~l~~Cp~C~~~  139 (146)
T PF07295_consen  108 VGPGTLVCENCGHEVEL---------THPERLPPCPKCGHT  139 (146)
T ss_pred             ecCceEecccCCCEEEe---------cCCCcCCCCCCCCCC
Confidence            34556889999875321         123345578888754


No 220
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=27.63  E-value=27  Score=19.95  Aligned_cols=11  Identities=36%  Similarity=0.646  Sum_probs=7.1

Q ss_pred             CCCCCCCCCcc
Q psy16829        229 HECEGGPIPAL  239 (243)
Q Consensus       229 ~~c~~c~~~~~  239 (243)
                      |+|+.||.++-
T Consensus        15 ~~Cp~cGipth   25 (55)
T PF13824_consen   15 FECPDCGIPTH   25 (55)
T ss_pred             CcCCCCCCcCc
Confidence            66777766653


No 221
>PF14369 zf-RING_3:  zinc-finger
Probab=27.29  E-value=47  Score=16.86  Aligned_cols=8  Identities=38%  Similarity=1.028  Sum_probs=4.0

Q ss_pred             cccccccc
Q psy16829         89 CDICLEAF   96 (243)
Q Consensus        89 C~~C~~~f   96 (243)
                      ||.|+-+|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            55555444


No 222
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=27.26  E-value=56  Score=25.18  Aligned_cols=39  Identities=13%  Similarity=0.264  Sum_probs=19.8

Q ss_pred             CCcccCCcccccccChHHHHHHHHhhcCCCCcccccccccccCh
Q psy16829        113 DGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQN  156 (243)
Q Consensus       113 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~  156 (243)
                      .....|.-|.+.|.-...     ..--|..-|.|+.|+..|.--
T Consensus       130 KeVSRCr~C~~rYDPVP~-----dkmwG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  130 KEVSRCRKCRKRYDPVPC-----DKMWGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             cccccccccccccCCCcc-----ccccceeeeecccccccchhh
Confidence            334567666665533221     001123346777777777643


No 223
>PLN02294 cytochrome c oxidase subunit Vb
Probab=27.23  E-value=33  Score=24.73  Aligned_cols=17  Identities=24%  Similarity=0.751  Sum_probs=13.6

Q ss_pred             CCCCeeccccccccCCh
Q psy16829        168 NAFPFQCEICHKIFTNK  184 (243)
Q Consensus       168 ~~k~~~C~~C~~~f~~~  184 (243)
                      ..+|.+|++||..|...
T Consensus       138 kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        138 KGKSFECPVCTQYFELE  154 (174)
T ss_pred             CCCceeCCCCCCEEEEE
Confidence            46788999999988653


No 224
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=27.20  E-value=42  Score=19.10  Aligned_cols=8  Identities=25%  Similarity=0.895  Sum_probs=3.4

Q ss_pred             eccccchh
Q psy16829         61 TCVECNED   68 (243)
Q Consensus        61 ~C~~C~~~   68 (243)
                      +|+.||+.
T Consensus         7 ~C~~Cg~~   14 (54)
T PF14446_consen    7 KCPVCGKK   14 (54)
T ss_pred             cChhhCCc
Confidence            34444443


No 225
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.13  E-value=10  Score=28.72  Aligned_cols=9  Identities=22%  Similarity=0.431  Sum_probs=6.0

Q ss_pred             cccccccCc
Q psy16829        202 WECEHCHKV  210 (243)
Q Consensus       202 ~~C~~C~~~  210 (243)
                      ..||.|..+
T Consensus        63 vvCP~C~yA   71 (267)
T COG1655          63 VVCPICYYA   71 (267)
T ss_pred             EEcchhhHH
Confidence            457777754


No 226
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=25.94  E-value=22  Score=17.76  Aligned_cols=9  Identities=22%  Similarity=0.619  Sum_probs=4.0

Q ss_pred             ccccccccc
Q psy16829         87 HVCDICLEA   95 (243)
Q Consensus        87 ~~C~~C~~~   95 (243)
                      +.|..|++.
T Consensus        28 f~C~~C~~~   36 (39)
T smart00132       28 FKCSKCGKP   36 (39)
T ss_pred             CCCcccCCc
Confidence            444444443


No 227
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=25.29  E-value=16  Score=24.43  Aligned_cols=10  Identities=20%  Similarity=0.826  Sum_probs=4.6

Q ss_pred             eecccccccc
Q psy16829        172 FQCEICHKIF  181 (243)
Q Consensus       172 ~~C~~C~~~f  181 (243)
                      |.|..||+.|
T Consensus       101 y~C~~Cg~~w  110 (113)
T COG1594         101 YKCTRCGYRW  110 (113)
T ss_pred             EEecccCCEe
Confidence            4444444443


No 228
>PRK05580 primosome assembly protein PriA; Validated
Probab=25.22  E-value=50  Score=29.91  Aligned_cols=10  Identities=30%  Similarity=0.577  Sum_probs=5.6

Q ss_pred             eeccccchhc
Q psy16829         60 LTCVECNEDF   69 (243)
Q Consensus        60 ~~C~~C~~~~   69 (243)
                      +.|..||...
T Consensus       382 ~~C~~Cg~~~  391 (679)
T PRK05580        382 LLCRDCGWVA  391 (679)
T ss_pred             eEhhhCcCcc
Confidence            4566666544


No 229
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.06  E-value=52  Score=26.09  Aligned_cols=11  Identities=27%  Similarity=1.047  Sum_probs=5.7

Q ss_pred             eeccccccccC
Q psy16829        172 FQCEICHKIFT  182 (243)
Q Consensus       172 ~~C~~C~~~f~  182 (243)
                      |.|+.|.-.|-
T Consensus       256 yvCs~Clsi~C  266 (279)
T TIGR00627       256 FVCSVCLSVLC  266 (279)
T ss_pred             EECCCccCCcC
Confidence            55555555443


No 230
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=24.90  E-value=19  Score=23.43  Aligned_cols=13  Identities=15%  Similarity=0.227  Sum_probs=8.8

Q ss_pred             CcccccccCccCC
Q psy16829        201 PWECEHCHKVYPN  213 (243)
Q Consensus       201 ~~~C~~C~~~f~~  213 (243)
                      -..|+.|+..+..
T Consensus        42 h~~C~~CG~y~~~   54 (99)
T PRK14892         42 IITCGNCGLYTEF   54 (99)
T ss_pred             eEECCCCCCccCE
Confidence            4568888877653


No 231
>KOG3362|consensus
Probab=24.87  E-value=24  Score=24.54  Aligned_cols=22  Identities=27%  Similarity=0.655  Sum_probs=17.0

Q ss_pred             CcccccccCccCChHHHHHHHh
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      +|.|.-||-.+-+...|..|..
T Consensus       129 ~ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             hhHHHhcCCceeechhhhhccc
Confidence            6788888888888877777743


No 232
>KOG2071|consensus
Probab=24.61  E-value=36  Score=29.73  Aligned_cols=24  Identities=21%  Similarity=0.382  Sum_probs=11.4

Q ss_pred             eeeccccchhccChhhHHhhhhcc
Q psy16829         59 LLTCVECNEDFINVNDFVSHLRGH   82 (243)
Q Consensus        59 ~~~C~~C~~~~~~~~~l~~H~~~h   82 (243)
                      +-.|..||..|.+......||..|
T Consensus       418 pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  418 PNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             cchhcccccccccchhhhhHhhhh
Confidence            344555555554444444444443


No 233
>KOG4317|consensus
Probab=24.58  E-value=18  Score=28.77  Aligned_cols=13  Identities=15%  Similarity=0.782  Sum_probs=7.4

Q ss_pred             eeccccccccCCh
Q psy16829        172 FQCEICHKIFTNK  184 (243)
Q Consensus       172 ~~C~~C~~~f~~~  184 (243)
                      |.|+.|+..|-+.
T Consensus        20 YtCPRCn~~YCsl   32 (383)
T KOG4317|consen   20 YTCPRCNLLYCSL   32 (383)
T ss_pred             ccCCCCCccceee
Confidence            6666666555443


No 234
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=24.46  E-value=86  Score=17.80  Aligned_cols=35  Identities=14%  Similarity=0.250  Sum_probs=18.0

Q ss_pred             CCcceeeccccchhccChhhHHhhhhccCCCccccccccc
Q psy16829         55 DKPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLE   94 (243)
Q Consensus        55 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~   94 (243)
                      .....+.|..|...-...    . ...-....|.|+.|+.
T Consensus        18 ~~r~aLIC~~C~~hNGla----~-~~~~~~i~y~C~~Cg~   52 (54)
T PF10058_consen   18 SNRYALICSKCFSHNGLA----P-KEEFEEIQYRCPYCGA   52 (54)
T ss_pred             cCceeEECcccchhhccc----c-cccCCceEEEcCCCCC
Confidence            344567888886542221    1 1111114577887764


No 235
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=24.30  E-value=50  Score=27.75  Aligned_cols=14  Identities=14%  Similarity=0.584  Sum_probs=7.3

Q ss_pred             cccCCcccccccCh
Q psy16829        115 LYQCNECEFVGKRL  128 (243)
Q Consensus       115 ~~~C~~C~~~f~~~  128 (243)
                      -|.|+-|+..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            45565555554433


No 236
>PTZ00448 hypothetical protein; Provisional
Probab=23.89  E-value=60  Score=26.69  Aligned_cols=22  Identities=18%  Similarity=0.496  Sum_probs=18.8

Q ss_pred             CcccccccCccCChHHHHHHHh
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      .|.|..|+..|.+....+.|.+
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~K  335 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYR  335 (373)
T ss_pred             CccccccccccCCHHHHHHHhh
Confidence            5789999999988888888877


No 237
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=23.18  E-value=78  Score=15.91  Aligned_cols=8  Identities=25%  Similarity=0.837  Sum_probs=2.9

Q ss_pred             eccccccc
Q psy16829        173 QCEICHKI  180 (243)
Q Consensus       173 ~C~~C~~~  180 (243)
                      .|+.|++.
T Consensus         6 ~C~nC~R~   13 (33)
T PF08209_consen    6 ECPNCGRP   13 (33)
T ss_dssp             E-TTTSSE
T ss_pred             ECCCCcCC
Confidence            34444443


No 238
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=23.18  E-value=39  Score=23.20  Aligned_cols=15  Identities=27%  Similarity=0.662  Sum_probs=11.4

Q ss_pred             cccccccccccCChH
Q psy16829         86 SHVCDICLEAFPSSD  100 (243)
Q Consensus        86 ~~~C~~C~~~f~~~~  100 (243)
                      |++|..|++.|.+.+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            567888888887654


No 239
>KOG2071|consensus
Probab=22.98  E-value=50  Score=28.89  Aligned_cols=27  Identities=19%  Similarity=0.502  Sum_probs=21.9

Q ss_pred             CcccccccCccCChHHHHHHHhhcCCC
Q psy16829        201 PWECEHCHKVYPNKRSYKRHKQVHLGV  227 (243)
Q Consensus       201 ~~~C~~C~~~f~~~~~l~~H~~~H~~~  227 (243)
                      |.+|..||.+|........|+-.|...
T Consensus       418 pnqC~~CG~R~~~~ee~sk~md~H~dw  444 (579)
T KOG2071|consen  418 PNQCKSCGLRFDDSEERSKHMDIHDDW  444 (579)
T ss_pred             cchhcccccccccchhhhhHhhhhhhh
Confidence            788999999999988877777766544


No 240
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=22.32  E-value=37  Score=20.48  Aligned_cols=55  Identities=16%  Similarity=0.271  Sum_probs=22.0

Q ss_pred             eeccccchhccChhh---HHhhhhccCC-CcccccccccccCChHHHHHHHHhhcCCCCcccCCcccc
Q psy16829         60 LTCVECNEDFINVND---FVSHLRGHDS-TSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEF  123 (243)
Q Consensus        60 ~~C~~C~~~~~~~~~---l~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  123 (243)
                      ++++-|++.|.-..-   +..|...... ....|..|+........      .  .+ ..+.|+.|+.
T Consensus        11 ~~~~cC~~~y~C~~CHde~~~H~~~~~~~~~v~Cg~C~~~~~~~~~------~--c~-~~~~C~~C~~   69 (71)
T PF05495_consen   11 IRFPCCGKYYPCRFCHDELEDHPFDRWPVKRVICGKCRTEQPIDEY------S--CG-ADYFCPICGL   69 (71)
T ss_dssp             EEETTTTEEESSHHHHHHCSSS---TTT--EEEETTT--EEES-SB------T--T---SEEETTTTE
T ss_pred             EECCcccCeecHHHHHHHhccCccccccccCeECCCCCCccChhhh------h--cC-CCccCcCcCC
Confidence            455556555544421   2222221111 35567777665544322      0  11 3466766654


No 242
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=22.24  E-value=52  Score=18.04  Aligned_cols=9  Identities=33%  Similarity=0.622  Sum_probs=4.3

Q ss_pred             ccccccccc
Q psy16829         87 HVCDICLEA   95 (243)
Q Consensus        87 ~~C~~C~~~   95 (243)
                      +.|+.|+..
T Consensus        21 ~vC~~Cg~~   29 (52)
T smart00661       21 FVCRKCGYE   29 (52)
T ss_pred             EECCcCCCe
Confidence            445555543


No 243
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=21.77  E-value=28  Score=19.80  Aligned_cols=9  Identities=33%  Similarity=1.088  Sum_probs=5.2

Q ss_pred             CcccccccC
Q psy16829        201 PWECEHCHK  209 (243)
Q Consensus       201 ~~~C~~C~~  209 (243)
                      |.-|+.|.+
T Consensus        28 PlyCpKCK~   36 (55)
T PF14205_consen   28 PLYCPKCKQ   36 (55)
T ss_pred             cccCCCCCc
Confidence            555666654


No 244
>KOG4377|consensus
Probab=21.62  E-value=42  Score=27.90  Aligned_cols=22  Identities=18%  Similarity=0.230  Sum_probs=17.3

Q ss_pred             cccCccCChHHHHHHHhhcCCC
Q psy16829        206 HCHKVYPNKRSYKRHKQVHLGV  227 (243)
Q Consensus       206 ~C~~~f~~~~~l~~H~~~H~~~  227 (243)
                      -|+.++.+.+.+..|.|.|.+.
T Consensus       408 Gc~~tl~s~sqm~shkrkheRq  429 (480)
T KOG4377|consen  408 GCEATLYSVSQMASHKRKHERQ  429 (480)
T ss_pred             CCceEEEehhhhhhhhhhhhhh
Confidence            3888888888888888877654


No 245
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=21.48  E-value=29  Score=24.29  Aligned_cols=11  Identities=36%  Similarity=1.195  Sum_probs=5.3

Q ss_pred             CcccccccCcc
Q psy16829        201 PWECEHCHKVY  211 (243)
Q Consensus       201 ~~~C~~C~~~f  211 (243)
                      .|.|..|+..+
T Consensus       112 ~y~C~~C~~~~  122 (146)
T smart00731      112 PYRCTGCGQRY  122 (146)
T ss_pred             EEECCCCCCCC
Confidence            45555555443


No 246
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=20.96  E-value=44  Score=17.05  Aligned_cols=30  Identities=13%  Similarity=0.460  Sum_probs=11.4

Q ss_pred             ccccchhccChhhHHhhhhccCCCccccccccccc
Q psy16829         62 CVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAF   96 (243)
Q Consensus        62 C~~C~~~~~~~~~l~~H~~~h~~~~~~C~~C~~~f   96 (243)
                      |+.|.+.+.+..+-     ..+.....|..||-.+
T Consensus         2 C~~C~~Ey~~p~~R-----R~~~~~isC~~CGPr~   31 (35)
T PF07503_consen    2 CDDCLKEYFDPSNR-----RFHYQFISCTNCGPRY   31 (35)
T ss_dssp             -HHHHHHHCSTTST-----TTT-TT--BTTCC-SC
T ss_pred             CHHHHHHHcCCCCC-----cccCcCccCCCCCCCE
Confidence            45555555444321     1122344566666443


No 247
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=20.95  E-value=1.1e+02  Score=27.53  Aligned_cols=11  Identities=27%  Similarity=0.591  Sum_probs=5.1

Q ss_pred             ccccccccccC
Q psy16829        145 YCDVCGRGFHQ  155 (243)
Q Consensus       145 ~C~~C~~~f~~  155 (243)
                      -|+.||.....
T Consensus        43 fC~~CG~~~~~   53 (645)
T PRK14559         43 HCPNCGAETGT   53 (645)
T ss_pred             cccccCCcccc
Confidence            35555544433


No 248
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=20.82  E-value=36  Score=19.48  Aligned_cols=8  Identities=50%  Similarity=0.962  Sum_probs=1.6

Q ss_pred             cccccccc
Q psy16829         87 HVCDICLE   94 (243)
Q Consensus        87 ~~C~~C~~   94 (243)
                      |.|++|+.
T Consensus        34 y~Cp~CgA   41 (55)
T PF05741_consen   34 YVCPICGA   41 (55)
T ss_dssp             ---TTT--
T ss_pred             CcCCCCcC
Confidence            45555543


No 249
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=20.23  E-value=65  Score=18.21  Aligned_cols=8  Identities=25%  Similarity=0.887  Sum_probs=3.5

Q ss_pred             cccCCccc
Q psy16829        115 LYQCNECE  122 (243)
Q Consensus       115 ~~~C~~C~  122 (243)
                      ...|+.|+
T Consensus        46 i~~Cp~Cg   53 (56)
T PF02591_consen   46 IVFCPNCG   53 (56)
T ss_pred             eEECcCCC
Confidence            34444444


Done!