Query         psy16846
Match_columns 253
No_of_seqs    51 out of 53
Neff          2.1 
Searched_HMMs 46136
Date          Fri Aug 16 23:33:24 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16846.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16846hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08926 DUF1908:  Domain of un  99.8   8E-23 1.7E-27  184.8   0.0   60  187-252     1-63  (282)
  2 PF06832 BiPBP_C:  Penicillin-B  69.7     5.9 0.00013   29.1   3.1   32   68-99     44-84  (89)
  3 cd00736 bacteriophage_lambda_l  33.5      19 0.00042   30.9   0.9   14  221-236   122-135 (151)
  4 PF08115 Toxin_28:  SFI toxin f  22.7      33 0.00071   23.8   0.3   11   25-35     25-35  (35)
  5 KOG2265|consensus               16.3      68  0.0015   28.8   0.9   64   33-99     23-89  (179)
  6 cd05875 Ig6_hNeurofascin_like   14.5   2E+02  0.0044   20.3   2.9   26   68-93     14-44  (77)
  7 PF00722 Glyco_hydro_16:  Glyco  14.4 1.4E+02   0.003   23.7   2.2   29   53-81    116-144 (185)
  8 KOG1324|consensus               14.2      86  0.0019   28.4   1.0   17   76-92     41-57  (190)
  9 cd05757 Ig2_IL1R_like Second i  14.2 1.7E+02  0.0038   21.8   2.5   27   68-94     31-58  (92)
 10 PRK11240 penicillin-binding pr  14.1 2.7E+02  0.0058   29.1   4.6   32   68-99    726-764 (772)

No 1  
>PF08926 DUF1908:  Domain of unknown function (DUF1908);  InterPro: IPR015022 This domain is found in microtubule-associated serine/threonine-protein kinases. ; GO: 0000287 magnesium ion binding, 0004674 protein serine/threonine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 1V9V_A.
Probab=99.85  E-value=8e-23  Score=184.84  Aligned_cols=60  Identities=53%  Similarity=0.736  Sum_probs=0.0

Q ss_pred             CCCCCCCCC---CCCCCCCCCCCCCCCCCcccCCCCcccceecccCCCCCCCCCCCCcccccccccccc
Q psy16846        187 PLESPRVAS---NQHFPFIPMKRPFNHLNTDCRSDGTRRWSVASLPSSGYGTTPGSSNVSSIFEIGEFK  252 (253)
Q Consensus       187 PldSPRn~s---~~hFpF~p~kR~~r~~~~~~~~DgtRRWSvASLPSSGYGT~~pSS~vSSscSSQEr~  252 (253)
                      |+||||||+   ++||+|++..+     .....+|| ||||||||||||||||||||++||+|||||++
T Consensus         1 p~dsprn~~~~~~~~f~f~~~~~-----~~~~~~D~-RRWSlASLPSSGYgT~~~sS~vSSscSSQE~L   63 (282)
T PF08926_consen    1 PLDSPRNFSPNSPAHFSFASSHV-----PRSDRADG-RRWSLASLPSSGYGTNTPSSTVSSSCSSQERL   63 (282)
T ss_dssp             ---------------------------------------------------------------------
T ss_pred             CCCCCCCCCCCCccCcccccccc-----ccccccCC-CccccccCCCCCCCcCCCCCeeecchhhHHHh
Confidence            899999998   48999976322     11235899 99999999999999999999999999999997


No 2  
>PF06832 BiPBP_C:  Penicillin-Binding Protein C-terminus Family;  InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs). A variable length loop region separates this region from the transpeptidase unit (IPR001460 from INTERPRO). It is predicted to be a beta fold.
Probab=69.69  E-value=5.9  Score=29.11  Aligned_cols=32  Identities=28%  Similarity=0.541  Sum_probs=21.1

Q ss_pred             EEEEeeccccc--ceeceeEe-------eceeeeecCCCcc
Q psy16846         68 VVEWYLDGSVE--SKVNRVIM-------DKKLWVEDDGGRR   99 (253)
Q Consensus        68 ~~~~~~~~~~~--~~~~~~~~-------~~~~~~~~~~~~~   99 (253)
                      -+.|||||..-  .+..+-+.       .-.|.|.|+.||.
T Consensus        44 ~~~W~vdg~~~g~~~~~~~~~~~~~~~G~h~l~vvD~~G~~   84 (89)
T PF06832_consen   44 PVYWFVDGEPLGTTQPGHQLFWQPDRPGEHTLTVVDAQGRS   84 (89)
T ss_pred             cEEEEECCEEcccCCCCCeEEeCCCCCeeEEEEEEcCCCCE
Confidence            57999999876  33333221       2357888888875


No 3  
>cd00736 bacteriophage_lambda_lysozyme The lysozyme from bacteriophage lambda hydrolyses the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc), as do other lysozymes.  But unlike other lysozymes, bacteriophage lambda does not produce a reducing end upon cleavage of the peptidoglycan but rather uses the 6-OH of the same MurNAc residue to produce a 1,6-anhydromuramic acid terminal residue and is therefore a lytic transglycosylase. An identical 1,6-anhydro bond is formed in bacterial peptidoglycans by the action of the lytic transglycosylases of E. coli. However, they differ structurally.
Probab=33.54  E-value=19  Score=30.86  Aligned_cols=14  Identities=57%  Similarity=1.206  Sum_probs=12.0

Q ss_pred             ccceecccCCCCCCCC
Q psy16846        221 RRWSVASLPSSGYGTT  236 (253)
Q Consensus       221 RRWSvASLPSSGYGT~  236 (253)
                      +-|  ||||.+|||-.
T Consensus       122 ~~W--ASLPg~gYGQ~  135 (151)
T cd00736         122 NIW--ASLPGAGYGQE  135 (151)
T ss_pred             hhc--cCCCCcCCCCC
Confidence            578  89999999974


No 4  
>PF08115 Toxin_28:  SFI toxin family;  InterPro: IPR012633 This family consists of the SFI family of spider toxins. This family of toxins might share structural, evolutionary and functional relationships with other small, highly structurally constrained spider neurotoxins. These toxins are highly selective agonists/antagonists of different voltage-dependent calcium channels and are extremely valuable reagents in the analysis of neuromuscular function.; GO: 0009405 pathogenesis, 0005576 extracellular region
Probab=22.69  E-value=33  Score=23.78  Aligned_cols=11  Identities=45%  Similarity=0.960  Sum_probs=9.4

Q ss_pred             ccCCcccchhh
Q psy16846         25 YKKPIRAPWEM   35 (253)
Q Consensus        25 ~~~~~~~~~~~   35 (253)
                      -+.|+..||||
T Consensus        25 ~~~~~A~PWEm   35 (35)
T PF08115_consen   25 SNGPHARPWEM   35 (35)
T ss_pred             cCCccCCcccC
Confidence            36799999998


No 5  
>KOG2265|consensus
Probab=16.31  E-value=68  Score=28.76  Aligned_cols=64  Identities=23%  Similarity=0.473  Sum_probs=40.5

Q ss_pred             hhhhhhhhhhcccccCCC---CcccccccccceeeeEEEEEEeecccccceeceeEeeceeeeecCCCcc
Q psy16846         33 WEMVLEVFFLTEPLAKGD---STLNTPVHNRSLKLSLSVVEWYLDGSVESKVNRVIMDKKLWVEDDGGRR   99 (253)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   99 (253)
                      |.--|+-.++.-|+.+|.   ..+..-++.+.+++++---.-||||....   +|..|.-.|+.+|+-.-
T Consensus        23 W~QtL~EV~i~i~vp~~~~ksk~v~~~Iq~~hI~V~~kg~~~ildG~L~~---~vk~des~WtiEd~k~i   89 (179)
T KOG2265|consen   23 WDQTLEEVEIQIPVPPGTAKSKDVHCSIQSKHIKVGLKGQPPILDGELSH---SVKVDESTWTIEDGKMI   89 (179)
T ss_pred             eeeehhheEEEeecCCCCcccceEEEEeeeeEEEEecCCCCceecCcccc---ccccccceEEecCCEEE
Confidence            555566666667888877   22333344455555554445699998864   55678888988776543


No 6  
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=14.51  E-value=2e+02  Score=20.26  Aligned_cols=26  Identities=27%  Similarity=0.473  Sum_probs=14.7

Q ss_pred             EEEEeecccc--cceeceeEe---eceeeee
Q psy16846         68 VVEWYLDGSV--ESKVNRVIM---DKKLWVE   93 (253)
Q Consensus        68 ~~~~~~~~~~--~~~~~~~~~---~~~~~~~   93 (253)
                      .|.||-||..  ..+-.+++|   +..|.+.
T Consensus        14 ~v~W~k~g~~~~~~~~~~~~~~~~~~~L~i~   44 (77)
T cd05875          14 TFQWTRNGKFFNVAKDPRVSMRRRSGTLVID   44 (77)
T ss_pred             EEEEEECCEEccCcCCCcEEEeCCCceEEEe
Confidence            5899999963  123344544   2345544


No 7  
>PF00722 Glyco_hydro_16:  Glycosyl hydrolases family 16;  InterPro: IPR000757 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 16 GH16 from CAZY comprises enzymes with a number of known activities; lichenase (3.2.1.73 from EC); xyloglucan xyloglucosyltransferase (2.4.1.207 from EC); agarase (3.2.1.81 from EC); kappa-carrageenase (3.2.1.83 from EC); endo-beta-1,3-glucanase (3.2.1.39 from EC); endo-beta-1,3-1,4-glucanase (3.2.1.6 from EC); endo-beta-galactosidase (3.2.1.103 from EC).; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3DGT_A 2CL2_A 2WLQ_A 2WNE_A 2W39_A 2W52_A 3ILN_A 4DFS_A 1UMZ_A 1UN1_B ....
Probab=14.37  E-value=1.4e+02  Score=23.73  Aligned_cols=29  Identities=21%  Similarity=0.439  Sum_probs=20.6

Q ss_pred             ccccccccceeeeEEEEEEeeccccccee
Q psy16846         53 LNTPVHNRSLKLSLSVVEWYLDGSVESKV   81 (253)
Q Consensus        53 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (253)
                      ..+-.|.-.+.-.-.-++||+||.+-..+
T Consensus       116 ~~~~~h~y~~~W~~~~i~fyiDg~~~~~~  144 (185)
T PF00722_consen  116 PSTDFHTYGFEWTPDRIRFYIDGKLVRTV  144 (185)
T ss_dssp             TTTSEEEEEEEEETTEEEEEETTEEEEEE
T ss_pred             cCCCcEEEEEEEecCeEEEEECCEEEEEE
Confidence            34556777777777789999999655444


No 8  
>KOG1324|consensus
Probab=14.21  E-value=86  Score=28.41  Aligned_cols=17  Identities=53%  Similarity=0.675  Sum_probs=15.6

Q ss_pred             cccceeceeEeeceeee
Q psy16846         76 SVESKVNRVIMDKKLWV   92 (253)
Q Consensus        76 ~~~~~~~~~~~~~~~~~   92 (253)
                      +..+|-|.|||.+|-|-
T Consensus        41 sd~~k~NaViMGRKtwe   57 (190)
T KOG1324|consen   41 SDPSKKNAVIMGRKTWE   57 (190)
T ss_pred             CCcccceeEEecccccc
Confidence            77899999999999994


No 9  
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=14.17  E-value=1.7e+02  Score=21.81  Aligned_cols=27  Identities=22%  Similarity=0.439  Sum_probs=15.4

Q ss_pred             EEEEeecccccceeceeE-eeceeeeec
Q psy16846         68 VVEWYLDGSVESKVNRVI-MDKKLWVED   94 (253)
Q Consensus        68 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~   94 (253)
                      -|.||-||.--..-++.+ ....||+.+
T Consensus        31 ~i~Wyk~~~~i~~~~~~~~~~~~L~I~~   58 (92)
T cd05757          31 PVQWYKDCKLLEGDRKRFVKGSKLLIQN   58 (92)
T ss_pred             cEEEeECCEECCCCccEEecCCEEEEee
Confidence            478999996433323333 445566543


No 10 
>PRK11240 penicillin-binding protein 1C; Provisional
Probab=14.06  E-value=2.7e+02  Score=29.09  Aligned_cols=32  Identities=28%  Similarity=0.509  Sum_probs=19.5

Q ss_pred             EEEEeecccccceece-eEee------ceeeeecCCCcc
Q psy16846         68 VVEWYLDGSVESKVNR-VIMD------KKLWVEDDGGRR   99 (253)
Q Consensus        68 ~~~~~~~~~~~~~~~~-~~~~------~~~~~~~~~~~~   99 (253)
                      .+.|||||..-.+-+. ....      -+|=|.||.|+.
T Consensus       726 ~~~W~~d~~~~~~~~~~~~~~~~~~G~~~l~v~d~~G~~  764 (772)
T PRK11240        726 RRWWFLNGEPLTERGRNVTLHLTDPGRYQLLVMDESGQI  764 (772)
T ss_pred             eEEEEECCEEccCCCcceeeccCCCccEEEEEECCCCCE
Confidence            4899999987653311 1111      246677887764


Done!