Diaphorina citri psyllid: psy16875

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----

MVDFELNVDYLIQRLLEARGCRPGKTVQMSEAEVRGLCLKSREIFLQQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQMMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLHNHDLDLICRAHQVVDDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYTGNSSRPSTPQHNPPKKK

cccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEccccEEEccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccEEECccccccccccccccHHHHHHHHccHHHHHHHHHHcccccccEEEcccEEEEccccccccccHHHHHHccccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHHccccEEEEccccccccHHccccccEEEEEccccccccccccEEEEEEcccccEEEEEEccccccccccccccccccccccccccccc

***FELNVDYLIQRLLEARGCRPGKTVQMSEAEVRGLCLKSREIFLQQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQMMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLHNHDLDLICRAHQVVDDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILK****************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein phosphatase PP1-beta catalytic subunit	Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.	very confident	P61292
Serine/threonine-protein phosphatase beta isoform	Required for cell adhesion in non-muscle tissues and in maintenance of muscle attachment. Vital for larval development.	very confident	P48462
Serine/threonine-protein phosphatase PP1-beta catalytic subunit	Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.	very confident	P62143

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0017018 [MF]	myosin phosphatase activity	very confident	GO:0016787, GO:0016791, GO:0004722, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788
GO:0072357 [CC]	PTW/PP1 phosphatase complex	very confident	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005575
GO:0000164 [CC]	protein phosphatase type 1 complex	very confident	GO:0005737, GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044463 [CC]	cell projection part	very confident	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0044763 [BP]	single-organism cellular process	very confident	GO:0009987, GO:0008150, GO:0044699
GO:0016020 [CC]	membrane	very confident	GO:0005575
GO:0048731 [BP]	system development	very confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0042587 [CC]	glycogen granule	very confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005979 [BP]	regulation of glycogen biosynthetic process	very confident	GO:0032881, GO:0043255, GO:0009889, GO:0080090, GO:0043467, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0050794, GO:0010906, GO:0050789, GO:0010556, GO:0065007, GO:0010675, GO:0008150, GO:0032885, GO:0070873, GO:0006109, GO:0019222, GO:0010962
GO:0006470 [BP]	protein dephosphorylation	very confident	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005935 [CC]	cellular bud neck	very confident	GO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0030155 [BP]	regulation of cell adhesion	very confident	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005730 [CC]	nucleolus	very confident	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005981 [BP]	regulation of glycogen catabolic process	very confident	GO:0043470, GO:0043471, GO:0043467, GO:0031329, GO:0060255, GO:0031323, GO:0009894, GO:0050794, GO:0010906, GO:0065007, GO:0010675, GO:0008150, GO:0019222, GO:0070873, GO:0006109, GO:0050789, GO:0032881, GO:0080090
GO:0070688 [CC]	MLL5-L complex	very confident	GO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0005694 [CC]	chromosome	very confident	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0050115 [MF]	myosin-light-chain-phosphatase activity	very confident	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0044281 [BP]	small molecule metabolic process	confident	GO:0044710, GO:0008150, GO:0008152
GO:0043204 [CC]	perikaryon	confident	GO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0001889 [BP]	liver development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0061008, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007476 [BP]	imaginal disc-derived wing morphogenesis	confident	GO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0007312 [BP]	oocyte nucleus migration involved in oocyte dorsal/ventral axis specification	confident	GO:0048610, GO:0009994, GO:0022412, GO:0048468, GO:0007569, GO:0007292, GO:0009798, GO:0007308, GO:0007309, GO:0051656, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0022414, GO:0000003, GO:0051649, GO:0040023, GO:0048869, GO:0030722, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0003006, GO:0051663, GO:0008150, GO:0003002, GO:0007310, GO:0051647, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0044767, GO:0044702, GO:0009953, GO:0044707, GO:0009950, GO:0048856, GO:0030154, GO:0044763, GO:0007097
GO:0007179 [BP]	transforming growth factor beta receptor signaling pathway	confident	GO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0005829 [CC]	cytosol	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0046329 [BP]	negative regulation of JNK cascade	confident	GO:0048585, GO:0048583, GO:0023057, GO:0010648, GO:0023051, GO:0046328, GO:0010646, GO:0010627, GO:0050789, GO:0043409, GO:0043408, GO:0009968, GO:0009966, GO:0065007, GO:0048519, GO:0010741, GO:0070302, GO:0070303, GO:0050794, GO:0032872, GO:0032873, GO:0008150, GO:0080134, GO:0080135, GO:0048523
GO:0005741 [CC]	mitochondrial outer membrane	confident	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0006364 [BP]	rRNA processing	confident	GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0000778 [CC]	condensed nuclear chromosome kinetochore	confident	GO:0031974, GO:0000780, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000779, GO:0000794, GO:0000775, GO:0000776, GO:0000777, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0000793, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0014706 [BP]	striated muscle tissue development	confident	GO:0032502, GO:0048856, GO:0008150, GO:0009888, GO:0060537
GO:0005977 [BP]	glycogen metabolic process	confident	GO:0044042, GO:0044238, GO:0044264, GO:0044262, GO:0015980, GO:0044260, GO:0005976, GO:0009987, GO:0044710, GO:0044237, GO:0043170, GO:0008152, GO:0071704, GO:0006112, GO:0008150, GO:0006073, GO:0005975, GO:0006091, GO:0055114
GO:0019901 [MF]	protein kinase binding	confident	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0046872 [MF]	metal ion binding	confident	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0000077 [BP]	DNA damage checkpoint	confident	GO:0051716, GO:0031570, GO:0000075, GO:0008150, GO:0050789, GO:0050896, GO:0009987, GO:0010564, GO:0010948, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0065007, GO:0044763, GO:0044699, GO:0033554, GO:0048519, GO:0048523, GO:0051726, GO:1901988
GO:0030428 [CC]	cell septum	confident	GO:0005575, GO:0044464, GO:0005623
GO:0005816 [CC]	spindle pole body	confident	GO:0043234, GO:0005575, GO:0005819, GO:0032991, GO:0005622, GO:0043232, GO:0005856, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630
GO:0031965 [CC]	nuclear membrane	confident	GO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030512 [BP]	negative regulation of transforming growth factor beta receptor signaling pathway	confident	GO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0005700 [CC]	polytene chromosome	confident	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0019433 [BP]	triglyceride catabolic process	confident	GO:0044238, GO:1901575, GO:0009987, GO:0006629, GO:0006641, GO:0009056, GO:0006639, GO:0006638, GO:0044710, GO:0044237, GO:0016042, GO:0044248, GO:0071704, GO:0044242, GO:0008150, GO:0008152, GO:0046464, GO:0044255, GO:0046486, GO:0046503, GO:0046461
GO:0005847 [CC]	mRNA cleavage and polyadenylation specificity factor complex	confident	GO:0005849, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0001400 [CC]	mating projection base	confident	GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0043197 [CC]	dendritic spine	confident	GO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0007301 [BP]	female germline ring canal formation	confident	GO:0048610, GO:0019953, GO:0007292, GO:0007293, GO:0009653, GO:0044699, GO:0000003, GO:0030725, GO:0071840, GO:0016043, GO:0007276, GO:0043063, GO:0043062, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0006810, GO:0044767, GO:0022414, GO:0044765, GO:0008150, GO:0022412, GO:0051234, GO:0051179, GO:0007300, GO:0044702, GO:0003006, GO:0048856, GO:0044763, GO:0009987
GO:0045132 [BP]	meiotic chromosome segregation	confident	GO:0007126, GO:0048610, GO:0051321, GO:0000003, GO:0022402, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0007059, GO:0007049
GO:0007080 [BP]	mitotic metaphase plate congression	confident	GO:0022402, GO:0007067, GO:0051656, GO:0051303, GO:0044699, GO:0071840, GO:0000280, GO:0016043, GO:0007049, GO:0000278, GO:0009987, GO:0044763, GO:0051649, GO:0051310, GO:0007059, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0006996, GO:0000070, GO:0000819, GO:0051276, GO:0050000, GO:0048285, GO:0008150
GO:0007084 [BP]	mitotic nuclear envelope reassembly	confident	GO:0006996, GO:0006997, GO:0000278, GO:0008150, GO:0016044, GO:0071840, GO:0009987, GO:0006998, GO:0031468, GO:0061024, GO:0044763, GO:0044699, GO:0022402, GO:0007049, GO:0016043
GO:0016607 [CC]	nuclear speck	confident	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0000903 [BP]	regulation of cell shape during vegetative growth phase	confident	GO:0022604, GO:0072690, GO:0022603, GO:0050793, GO:0009987, GO:0051128, GO:0008150, GO:0008360, GO:0044763, GO:0050794, GO:0065007, GO:0065008, GO:0050789, GO:0044699
GO:0043021 [MF]	ribonucleoprotein complex binding	confident	GO:0003674, GO:0005488
GO:0000236 [BP]	mitotic prometaphase	confident	GO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007067, GO:0007049, GO:0022403
GO:0007498 [BP]	mesoderm development	confident	GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0006873 [BP]	cellular ion homeostasis	confident	GO:0019725, GO:0050801, GO:0009987, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0008355 [BP]	olfactory learning	confident	GO:0032501, GO:0007635, GO:0044707, GO:0042048, GO:0044708, GO:0050896, GO:0007612, GO:0007610, GO:0007611, GO:0008306, GO:0008150, GO:0050890, GO:0050877, GO:0042221, GO:0044699, GO:0003008
GO:0051315 [BP]	attachment of spindle microtubules to kinetochore involved in mitotic sister chromatid segregation	confident	GO:0033036, GO:0008104, GO:0008608, GO:0000226, GO:0007067, GO:0051651, GO:0044699, GO:0032507, GO:0070727, GO:0071840, GO:0000280, GO:0016043, GO:0065007, GO:0007049, GO:0065008, GO:0007010, GO:0034453, GO:0034613, GO:0000278, GO:0009987, GO:0045185, GO:0007017, GO:0008150, GO:0007059, GO:0051235, GO:0051179, GO:0051641, GO:0006996, GO:0000070, GO:0000819, GO:0051276, GO:0022402, GO:0048285, GO:0044763
GO:0006417 [BP]	regulation of translation	confident	GO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0031297 [BP]	replication fork processing	confident	GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:1901360, GO:0071704, GO:0006260, GO:0006261, GO:1901576, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0009059, GO:0044763, GO:0008152, GO:0046483, GO:0045005, GO:0044238, GO:0050896, GO:0009058, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0016203 [BP]	muscle attachment	confident	GO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0061061, GO:0048513, GO:0008150, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0030847 [BP]	termination of RNA polymerase II transcription, exosome-dependent	confident	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0006369, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0030846 [BP]	termination of RNA polymerase II transcription, poly(A)-coupled	confident	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0006369, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0030289 [CC]	protein phosphatase 4 complex	confident	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0007411 [BP]	axon guidance	confident	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0002168 [BP]	instar larval development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002165, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0000087 [BP]	M phase of mitotic cell cycle	confident	GO:0044699, GO:0000279, GO:0000278, GO:0009987, GO:0008150, GO:0044763, GO:0022403, GO:0022402, GO:0007049
GO:0002119 [BP]	nematode larval development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0046822 [BP]	regulation of nucleocytoplasmic transport	confident	GO:0060341, GO:0051049, GO:0032386, GO:0050794, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0033047 [BP]	regulation of mitotic sister chromatid segregation	confident	GO:0033044, GO:0033045, GO:0007346, GO:0033043, GO:0051726, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0007088, GO:0050789, GO:0051983
GO:0030324 [BP]	lung development	confident	GO:0060541, GO:0032502, GO:0030323, GO:0044707, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0007275, GO:0044699
GO:0001525 [BP]	angiogenesis	confident	GO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0051225 [BP]	spindle assembly	confident	GO:0006996, GO:0022607, GO:0007010, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0044763, GO:0016043, GO:0065003, GO:0007051, GO:0044085, GO:0000226, GO:0044699, GO:0008150, GO:0022402, GO:0009987, GO:0070925, GO:0007049, GO:0007017
GO:0030437 [BP]	ascospore formation	confident	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0043935, GO:0043934, GO:0022402, GO:0009653, GO:0044699, GO:0000003, GO:0003006, GO:0048869, GO:0034293, GO:0007049, GO:0048646, GO:0032502, GO:0032505, GO:0009987, GO:0044767, GO:0022414, GO:0044763, GO:0022413, GO:0030435, GO:0048856, GO:0008150
GO:0008344 [BP]	adult locomotory behavior	confident	GO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0032154 [CC]	cleavage furrow	confident	GO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0005813 [CC]	centrosome	confident	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0046692 [BP]	sperm competition	confident	GO:0044703, GO:0032501, GO:0048609, GO:0032504, GO:0007620, GO:0007618, GO:0044706, GO:0022414, GO:0008150, GO:0000003, GO:0007320, GO:0051704
GO:0000022 [BP]	mitotic spindle elongation	confident	GO:0006996, GO:0044699, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0000226, GO:0008150, GO:0007051, GO:0007052, GO:0022402, GO:0007049, GO:0044763, GO:0051231, GO:0016043
GO:0030010 [BP]	establishment of cell polarity	confident	GO:0008150, GO:0009987, GO:0007163, GO:0044763, GO:0044699
GO:0008542 [BP]	visual learning	confident	GO:0007632, GO:0009314, GO:0007612, GO:0007610, GO:0007611, GO:0009416, GO:0044699, GO:0000003, GO:0032501, GO:0019098, GO:0050877, GO:0022414, GO:0008306, GO:0008150, GO:0003008, GO:0009628, GO:0044702, GO:0044704, GO:0044707, GO:0044708, GO:0050896, GO:0050890
GO:0007143 [BP]	female meiosis	confident	GO:0007126, GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0030496 [CC]	midbody	confident	GO:0005575, GO:0044464, GO:0005623
GO:0034501 [BP]	protein localization to kinetochore	confident	GO:0008104, GO:0034502, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0007094 [BP]	mitotic spindle assembly checkpoint	confident	GO:0045841, GO:0033043, GO:0051129, GO:0051128, GO:0010948, GO:0022402, GO:1901990, GO:0030071, GO:0044699, GO:0031577, GO:0007346, GO:0045786, GO:0010564, GO:0050789, GO:0008150, GO:0065007, GO:0007049, GO:0045839, GO:0007088, GO:0071174, GO:0071173, GO:1902100, GO:0009987, GO:0050794, GO:1901987, GO:0044763, GO:0048519, GO:1902099, GO:1901988, GO:0000075, GO:0051726, GO:0010639, GO:0051783, GO:0051784, GO:1901991, GO:0048523, GO:0007093
GO:0018991 [BP]	oviposition	confident	GO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0000910 [BP]	cytokinesis	confident	GO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0018996 [BP]	molting cycle, collagen and cuticulin-based cuticle	confident	GO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0051211 [BP]	anisotropic cell growth	confident	GO:0016049, GO:0040007, GO:0009987, GO:0008150, GO:0044763, GO:0044699
GO:0006911 [BP]	phagocytosis, engulfment	confident	GO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0060629 [BP]	regulation of homologous chromosome segregation	confident	GO:0051445, GO:0040020, GO:0051726, GO:2000241, GO:0010564, GO:0060631, GO:0050794, GO:0065007, GO:0008150, GO:0050789, GO:0051983
GO:0007114 [BP]	cell budding	confident	GO:0000003, GO:0032505, GO:0019954, GO:0009987, GO:0044763, GO:0051301, GO:0008150, GO:0044699
GO:0048754 [BP]	branching morphogenesis of an epithelial tube	confident	GO:0032502, GO:0002009, GO:0032501, GO:0035239, GO:0044707, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0001763, GO:0008150, GO:0048729, GO:0060562, GO:0035295, GO:0009653, GO:0007275, GO:0044699, GO:0048856
GO:0009792 [BP]	embryo development ending in birth or egg hatching	confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005886 [CC]	plasma membrane	confident	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007155 [BP]	cell adhesion	confident	GO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0044351 [BP]	macropinocytosis	probable	GO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0000159 [CC]	protein phosphatase type 2A complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0031034 [BP]	myosin filament assembly	probable	GO:0006996, GO:0022607, GO:0031033, GO:0030029, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0030036, GO:0065003, GO:0044085, GO:0044763, GO:0016043, GO:0008150, GO:0034622, GO:0007010, GO:0009987, GO:0043623, GO:0044699
GO:0009738 [BP]	abscisic acid mediated signaling pathway	probable	GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0044699, GO:0009755, GO:0051716, GO:0009737, GO:0033993, GO:0071310, GO:0065007, GO:0071215, GO:0071495, GO:0009719, GO:1901701, GO:0009987, GO:0071396, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0010033, GO:1901700, GO:0044700, GO:0009725, GO:0050896, GO:0008150, GO:0097305, GO:0097306
GO:0044295 [CC]	axonal growth cone	probable	GO:0044464, GO:0044463, GO:0030427, GO:0030426, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0010228 [BP]	vegetative to reproductive phase transition of meristem	probable	GO:0032502, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0009791, GO:0003006, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0010200 [BP]	response to chitin	probable	GO:1901700, GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:1901698
GO:0003869 [MF]	4-nitrophenylphosphatase activity	probable	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0006397 [BP]	mRNA processing	probable	GO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006468 [BP]	protein phosphorylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0016576 [BP]	histone dephosphorylation	probable	GO:0016311, GO:0006470, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0008150, GO:0016568, GO:0016569
GO:0030968 [BP]	endoplasmic reticulum unfolded protein response	probable	GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0006984, GO:0051716, GO:0006986, GO:0071310, GO:0065007, GO:0009987, GO:0050794, GO:0006950, GO:0044763, GO:0042221, GO:0010033, GO:0044700, GO:0050896, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0034976, GO:0034620
GO:0046580 [BP]	negative regulation of Ras protein signal transduction	probable	GO:0051056, GO:0009968, GO:0050794, GO:0009966, GO:0048583, GO:0048585, GO:0046578, GO:0051058, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000076 [BP]	DNA replication checkpoint	probable	GO:0031570, GO:0000075, GO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:0048523, GO:0048519, GO:0050789, GO:1901988
GO:0005814 [CC]	centriole	probable	GO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0005813, GO:0044464, GO:0044444, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044450, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0051604 [BP]	protein maturation	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0031929 [BP]	TOR signaling cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0016926 [BP]	protein desumoylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0019208 [MF]	phosphatase regulator activity	probable	GO:0030234, GO:0003674
GO:0006499 [BP]	N-terminal protein myristoylation	probable	GO:0031365, GO:0044249, GO:0042157, GO:0034645, GO:1901576, GO:0042158, GO:0043170, GO:0043543, GO:0044260, GO:0018377, GO:0071704, GO:0044267, GO:0009987, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0006497, GO:0044238, GO:0019538, GO:0043412, GO:0044237, GO:0006498, GO:0009059
GO:0050665 [BP]	hydrogen peroxide biosynthetic process	probable	GO:0009987, GO:0044237, GO:0044249, GO:0009058, GO:0042743, GO:0072593, GO:0008152, GO:0008150
GO:0007406 [BP]	negative regulation of neuroblast proliferation	probable	GO:0032502, GO:0030154, GO:0060284, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0050768, GO:0007275, GO:2000177, GO:0065007, GO:0010721, GO:0048519, GO:2000178, GO:0072091, GO:0042127, GO:0008285, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:2000647, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0090162 [BP]	establishment of epithelial cell polarity	probable	GO:0009987, GO:0007163, GO:0008150, GO:0030010, GO:0044763, GO:0044699
GO:0070262 [BP]	peptidyl-serine dephosphorylation	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0051299 [BP]	centrosome separation	probable	GO:0006996, GO:0031023, GO:0007010, GO:0051297, GO:0009987, GO:0007098, GO:0016043, GO:0008150, GO:0000226, GO:0007017, GO:0044763, GO:0044699, GO:0071840, GO:0022402, GO:0007049
GO:0051298 [BP]	centrosome duplication	probable	GO:0006996, GO:0031023, GO:0007010, GO:0051297, GO:0009987, GO:0007098, GO:0016043, GO:0008150, GO:0000226, GO:0007017, GO:0044763, GO:0044699, GO:0071840, GO:0022402, GO:0007049
GO:0036178 [BP]	filamentous growth of a population of unicellular organisms in response to neutral pH	probable	GO:0009628, GO:0040007, GO:0030447, GO:0044182, GO:0008150, GO:0009268, GO:0036177, GO:0036176, GO:0050896, GO:0044699
GO:0031952 [BP]	regulation of protein autophosphorylation	probable	GO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0001932, GO:0050789
GO:0051229 [BP]	meiotic spindle disassembly	probable	GO:0048610, GO:0043933, GO:0000226, GO:0043241, GO:0044699, GO:0032984, GO:0051321, GO:0000003, GO:0071822, GO:0071840, GO:0016043, GO:0007049, GO:0000212, GO:0009987, GO:0007051, GO:0044763, GO:0051230, GO:0006996, GO:0007017, GO:0007010, GO:0022402, GO:0008150, GO:0022411
GO:2000765 [BP]	regulation of cytoplasmic translation	probable	GO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0006417, GO:0008150, GO:0010468
GO:0071902 [BP]	positive regulation of protein serine/threonine kinase activity	probable	GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0045860, GO:0071900, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:2000012 [BP]	regulation of auxin polar transport	probable	GO:0008150, GO:0051049, GO:0032879, GO:0065007, GO:0050789
GO:0006883 [BP]	cellular sodium ion homeostasis	probable	GO:0019725, GO:0008150, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0055065, GO:0055080, GO:0055078, GO:0055082, GO:0065008, GO:0044699
GO:0070208 [BP]	protein heterotrimerization	probable	GO:0051259, GO:0022607, GO:0070206, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051291, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0000235 [CC]	astral microtubule	probable	GO:0043229, GO:0043228, GO:0005874, GO:0043226, GO:0005876, GO:0005737, GO:0044446, GO:0005818, GO:0005819, GO:0044430, GO:0005856, GO:0015630, GO:0005881, GO:0043234, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0035307 [BP]	positive regulation of protein dephosphorylation	probable	GO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0035303, GO:0035304, GO:0035306, GO:0032268, GO:0031401, GO:0048522
GO:0008022 [MF]	protein C-terminus binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0042176 [BP]	regulation of protein catabolic process	probable	GO:0009894, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0065007, GO:0008150, GO:0050789
GO:1900436 [BP]	positive regulation of filamentous growth of a population of unicellular organisms in response to starvation	probable	GO:0032106, GO:1900430, GO:0032104, GO:0040008, GO:0090033, GO:0032107, GO:0045927, GO:1900428, GO:0032101, GO:0048583, GO:0048584, GO:0032109, GO:0050789, GO:0032103, GO:0008150, GO:0048518, GO:0065007, GO:0010570, GO:0080134, GO:1900434
GO:1900439 [BP]	positive regulation of filamentous growth of a population of unicellular organisms in response to chemical stimulus	probable	GO:1900430, GO:0040008, GO:0090033, GO:1900437, GO:1900428, GO:0048584, GO:0048583, GO:0010570, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0045927
GO:0046331 [BP]	lateral inhibition	probable	GO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:1900486 [BP]	positive regulation of isopentenyl diphosphate biosynthetic process, mevalonate pathway	probable	GO:2001210, GO:0019220, GO:0080090, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0046890, GO:0050789, GO:0009893, GO:0010562, GO:0009891, GO:0045834, GO:0048518, GO:0065007, GO:0071073, GO:0071071, GO:0019747, GO:0045937, GO:0019216, GO:0009889, GO:0050794, GO:0051174, GO:0008150, GO:0046889, GO:0051196, GO:0051197, GO:0051194, GO:0051193, GO:0048522
GO:0045880 [BP]	positive regulation of smoothened signaling pathway	probable	GO:0008589, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0036244 [BP]	cellular response to neutral pH	probable	GO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0071467, GO:0044763, GO:0009268, GO:0036176, GO:0071214, GO:0044699
GO:1900442 [BP]	positive regulation of filamentous growth of a population of unicellular organisms in response to neutral pH	probable	GO:1900440, GO:0040008, GO:0090033, GO:1900430, GO:1900428, GO:0048584, GO:0048583, GO:0010570, GO:1900743, GO:1900741, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0045927
GO:0031505 [BP]	fungal-type cell wall organization	probable	GO:0008150, GO:0009987, GO:0016043, GO:0071554, GO:0071555, GO:0044763, GO:0044699, GO:0045229, GO:0071840, GO:0071852
GO:0055059 [BP]	asymmetric neuroblast division	probable	GO:0030154, GO:0055057, GO:0048103, GO:0007405, GO:0007275, GO:0051301, GO:0048869, GO:0008150, GO:0044699, GO:0061351, GO:0032502, GO:0032501, GO:0008283, GO:0009987, GO:0044763, GO:0022008, GO:0017145, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0048731, GO:0072089
GO:0060070 [BP]	canonical Wnt receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0010719 [BP]	negative regulation of epithelial to mesenchymal transition	probable	GO:0022604, GO:2000736, GO:0022603, GO:0051129, GO:0051128, GO:0050789, GO:0044699, GO:0060284, GO:0010769, GO:0065007, GO:0010721, GO:0048519, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0051239, GO:0051093, GO:0010717, GO:2000026, GO:0010771, GO:0008150, GO:0048523
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0019897 [CC]	extrinsic to plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0071473 [BP]	cellular response to cation stress	probable	GO:0009628, GO:0051716, GO:0009987, GO:0071472, GO:0050896, GO:0071470, GO:0044763, GO:0006950, GO:0008150, GO:0043157, GO:0006970, GO:0033554, GO:0009651, GO:0071214, GO:0044699
GO:0021952 [BP]	central nervous system projection neuron axonogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0007417, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0008150, GO:0071840, GO:0021955, GO:0021954, GO:0021953, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0048731
GO:0009903 [BP]	chloroplast avoidance movement	probable	GO:0006996, GO:0044699, GO:0051234, GO:0009987, GO:0071840, GO:0051649, GO:0051641, GO:0009658, GO:0044763, GO:0016043, GO:0009902, GO:0051667, GO:0008150, GO:0051644, GO:0051656, GO:0051179, GO:0051640, GO:0009657
GO:0009405 [BP]	pathogenesis	probable	GO:0008150, GO:0051704
GO:1900490 [BP]	positive regulation of hydroxymethylglutaryl-CoA reductase (NADPH) activity	probable	GO:0051341, GO:0019222, GO:2001215, GO:0050790, GO:0051353, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0002098 [BP]	tRNA wobble uridine modification	probable	GO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0034470, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006400, GO:0008033, GO:0009987, GO:0006725, GO:0002097, GO:0043412, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0006399, GO:0006396
GO:0007465 [BP]	R7 cell fate commitment	probable	GO:0046552, GO:0048749, GO:0044707, GO:0030154, GO:0045466, GO:0009653, GO:0042706, GO:0044699, GO:0001745, GO:0048869, GO:0007275, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0048663, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0001752, GO:0048699, GO:0045165, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150
GO:0030007 [BP]	cellular potassium ion homeostasis	probable	GO:0019725, GO:0008150, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0030004, GO:0065007, GO:0055075, GO:0055067, GO:0030003, GO:0055065, GO:0055080, GO:0044763, GO:0055082, GO:0065008, GO:0044699
GO:0040026 [BP]	positive regulation of vulval development	probable	GO:0051094, GO:0050793, GO:0040028, GO:0048580, GO:0008150, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0061062, GO:0050789
GO:0018985 [BP]	pronuclear envelope synthesis	probable	GO:0006996, GO:0006997, GO:0048610, GO:0000003, GO:0022414, GO:0016044, GO:0071840, GO:0009987, GO:0009566, GO:0019953, GO:0006998, GO:0061024, GO:0044702, GO:0044763, GO:0007338, GO:0008150, GO:0044699, GO:0016043
GO:0035188 [BP]	hatching	probable	GO:0071684, GO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0000082 [BP]	G1/S transition of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0001302 [BP]	replicative cell aging	probable	GO:0032502, GO:0007568, GO:0007569, GO:0009987, GO:0044767, GO:0044763, GO:0008150, GO:0044699
GO:0000724 [BP]	double-strand break repair via homologous recombination	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0006302, GO:0000725, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0044260, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0071216 [BP]	cellular response to biotic stimulus	probable	GO:0051716, GO:0009607, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0007420 [BP]	brain development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0000184 [BP]	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0046677 [BP]	response to antibiotic	probable	GO:0008150, GO:0042221, GO:0050896, GO:0009636
GO:0008543 [BP]	fibroblast growth factor receptor signaling pathway	probable	GO:0007166, GO:0007167, GO:0070848, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0007169, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0044344, GO:0071310, GO:0065007, GO:0071495, GO:0009987, GO:0050794, GO:0044763, GO:0007154, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0071774, GO:0008150
GO:0017151 [MF]	DEAD/H-box RNA helicase binding	probable	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0043462 [BP]	regulation of ATPase activity	probable	GO:0051336, GO:0051174, GO:0033121, GO:1900542, GO:0019220, GO:0080090, GO:0031329, GO:0008150, GO:0019219, GO:0050790, GO:0031323, GO:0009894, GO:0030811, GO:0050789, GO:0065007, GO:0051171, GO:0006140, GO:0019222, GO:0009118, GO:0065009, GO:0050794
GO:0006917 [BP]	induction of apoptosis	probable	GO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0051173 [BP]	positive regulation of nitrogen compound metabolic process	probable	GO:0009893, GO:0019222, GO:0065007, GO:0051171, GO:0048518, GO:0008150, GO:0050789
GO:0034599 [BP]	cellular response to oxidative stress	probable	GO:0051716, GO:0033554, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0070887, GO:0042221, GO:0006979, GO:0044699
GO:0000072 [BP]	M phase specific microtubule process	probable	GO:0044699, GO:0007017, GO:0000279, GO:0009987, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0036168 [BP]	filamentous growth of a population of unicellular organisms in response to heat	probable	GO:0009628, GO:0040007, GO:0030447, GO:0044182, GO:0006950, GO:0008150, GO:0009266, GO:0009408, GO:0050896, GO:0044699
GO:0050920 [BP]	regulation of chemotaxis	probable	GO:0040012, GO:0032101, GO:0048583, GO:0050795, GO:0065007, GO:0008150, GO:0050789
GO:0010569 [BP]	regulation of double-strand break repair via homologous recombination	probable	GO:0006282, GO:0051052, GO:0019222, GO:0060255, GO:0048583, GO:0080134, GO:0080135, GO:0031323, GO:0000018, GO:0050794, GO:0008150, GO:0019219, GO:0065007, GO:0051171, GO:2000779, GO:2001020, GO:0050789, GO:0080090
GO:2000002 [BP]	negative regulation of DNA damage checkpoint	probable	GO:0045786, GO:0051726, GO:0048583, GO:0048585, GO:0080135, GO:0010564, GO:0050794, GO:0050789, GO:0080134, GO:0010948, GO:0065007, GO:2000001, GO:0008150, GO:0048519, GO:2001021, GO:2001020, GO:1901977, GO:1901976, GO:0048523
GO:0043161 [BP]	proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0030261 [BP]	chromosome condensation	probable	GO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0071840, GO:0006139, GO:0044260, GO:0006323, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0044699, GO:0051276, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0072462 [BP]	signal transduction involved in meiotic recombination checkpoint	probable	GO:0048610, GO:0044700, GO:2000242, GO:0007128, GO:2000241, GO:0010948, GO:0022402, GO:0007165, GO:0007154, GO:0035556, GO:0050789, GO:0007049, GO:0051324, GO:0007126, GO:0007127, GO:0051321, GO:0000003, GO:0072395, GO:0010564, GO:0065007, GO:0045835, GO:0048519, GO:0000279, GO:0033313, GO:0009987, GO:0051716, GO:0050794, GO:1901987, GO:0008150, GO:0023052, GO:0072411, GO:0051598, GO:1901988, GO:0040020, GO:0051445, GO:0044699, GO:0000075, GO:0051726, GO:0050896, GO:0044763, GO:0048523, GO:0022403
GO:0042542 [BP]	response to hydrogen peroxide	probable	GO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0007243 [BP]	intracellular protein kinase cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0036170 [BP]	filamentous growth of a population of unicellular organisms in response to starvation	probable	GO:0009991, GO:0040007, GO:0009605, GO:0030447, GO:0044182, GO:0031667, GO:0006950, GO:0008150, GO:0042594, GO:0050896, GO:0044699
GO:0036180 [BP]	filamentous growth of a population of unicellular organisms in response to biotic stimulus	probable	GO:0009607, GO:0040007, GO:0050896, GO:0044182, GO:0008150, GO:0030447, GO:0044699
GO:0010972 [BP]	negative regulation of G2/M transition of mitotic cell cycle	probable	GO:0045930, GO:0007346, GO:0045786, GO:0051726, GO:0008150, GO:0010564, GO:0050794, GO:0050789, GO:1901987, GO:0010948, GO:0065007, GO:1901991, GO:1901990, GO:0048519, GO:0048523, GO:0010389, GO:1901988
GO:0009992 [BP]	cellular water homeostasis	probable	GO:0019725, GO:0006884, GO:0009987, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0030104, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0010469 [BP]	regulation of receptor activity	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0065009, GO:0010646, GO:0050789
GO:0007015 [BP]	actin filament organization	probable	GO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.3.-	Phosphoric monoester hydrolases.	probable
3.1.3.16	Phosphoprotein phosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E7A, chain A
Confidence level:very confident
Coverage over the Query: 6-298
View the alignment between query and template
View the model in PyMOL

Template: 1FJM, chain A
Confidence level:very confident
Coverage over the Query: 6-299
View the alignment between query and template
View the model in PyMOL