Diaphorina citri psyllid: psy16889


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
AVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLTSDHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCILKICDFGLARVEEPDPNKAMTQEVVTQYYRAPEILMGARHYSAAVDVWSVGCIFAELLGRRILFQAQSPVQQLGLITDL
cccccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEcccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcc
*V*D*RDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLTSDHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCILKICDFGLARVEEPDPNKAMTQEVVTQYYRAPEILMGARHYSAAVDVWSVGCIFAELLGRRILFQAQSPVQQLGLITDL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLTSDHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCILKICDFGLARVEEPDPNKAMTQEVVTQYYRAPEILMGARHYSAAVDVWSVGCIFAELLGRRILFQAQSPVQQLGLITDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase NLK Serine/threonine-protein kinase that regulates a number of transcription factors with key roles in cell fate determination. Positive effector of the non-canonical Wnt signaling pathway, acting downstream of WNT5A, MAP3K7/TAK1 and HIPK2. Activation of this pathway causes binding to and phosphorylation of the histone methyltransferase SETDB1. The NLK-SETDB1 complex subsequently interacts with PPARG, leading to methylation of PPARG target promoters at histone H3K9 and transcriptional silencing. The resulting loss of PPARG target gene transcription inhibits adipogenesis and promotes osteoblastogenesis in mesenchymal stem cells (MSCs). Negative regulator of the canonical Wnt/beta-catenin signaling pathway. Binds to and phosphorylates TCF7L2/TCF4 and LEF1, promoting the dissociation of the TCF7L2/LEF1/beta-catenin complex from DNA, as well as the ubiquitination and subsequent proteolysis of LEF1. Together these effects inhibit the transcriptional activation of canonical Wnt/beta-catenin target genes. Negative regulator of the Notch signaling pathway. Binds to and phosphorylates NOTCH1, thereby preventing the formation of a transcriptionally active ternary complex of NOTCH1, RBPJ/RBPSUH and MAML1. Negative regulator of the MYB family of transcription factors. Phosphorylation of MYB leads to its subsequent proteolysis while phosphorylation of MYBL1 and MYBL2 inhibits their interaction with the coactivator CREBBP. Other transcription factors may also be inhibited by direct phosphorylation of CREBBP itself. Acts downstream of IL6 and MAP3K7/TAK1 to phosphorylate STAT3, which is in turn required for activation of NLK by MAP3K7/TAK1.confidentO54949
Serine/threonine-protein kinase NLK Serine/threonine-protein kinase that regulates a number of transcription factors with key roles in cell fate determination. Positive effector of the non-canonical Wnt signaling pathway, acting downstream of WNT5A, MAP3K7/TAK1 and HIPK2. Activation of this pathway causes binding to and phosphorylation of the histone methyltransferase SETDB1. The NLK-SETDB1 complex subsequently interacts with PPARG, leading to methylation of PPARG target promoters at histone H3K9 and transcriptional silencing. The resulting loss of PPARG target gene transcription inhibits adipogenesis and promotes osteoblastogenesis in mesenchymal stem cells (MSCs). Negative regulator of the canonical Wnt/beta-catenin signaling pathway. Binds to and phosphorylates TCF7L2/TCF4 and LEF1, promoting the dissociation of the TCF7L2/LEF1/beta-catenin complex from DNA, as well as the ubiquitination and subsequent proteolysis of LEF1. Together these effects inhibit the transcriptional activation of canonical Wnt/beta-catenin target genes. Negative regulator of the Notch signaling pathway. Binds to and phosphorylates NOTCH1, thereby preventing the formation of a transcriptionally active ternary complex of NOTCH1, RBPJ/RBPSUH and MAML1. Negative regulator of the MYB family of transcription factors. Phosphorylation of MYB leads to its subsequent proteolysis while phosphorylation of MYBL1 and MYBL2 inhibits their interaction with the coactivator CREBBP. Other transcription factors may also be inhibited by direct phosphorylation of CREBBP itself. Acts downstream of IL6 and MAP3K7/TAK1 to phosphorylate STAT3, which is in turn required for activation of NLK by MAP3K7/TAK1.confidentD3ZSZ3
Serine/threonine-protein kinase NLK Serine/threonine-protein kinase that regulates a number of transcription factors with key roles in cell fate determination. Positive effector of the non-canonical Wnt signaling pathway, acting downstream of WNT5A, MAP3K7/TAK1 and HIPK2. Activation of this pathway causes binding to and phosphorylation of the histone methyltransferase SETDB1. The NLK-SETDB1 complex subsequently interacts with PPARG, leading to methylation of PPARG target promoters at histone H3K9 and transcriptional silencing. The resulting loss of PPARG target gene transcription inhibits adipogenesis and promotes osteoblastogenesis in mesenchymal stem cells (MSCs). Negative regulator of the canonical Wnt/beta-catenin signaling pathway. Binds to and phosphorylates TCF7L2/TCF4 and LEF1, promoting the dissociation of the TCF7L2/LEF1/beta-catenin complex from DNA, as well as the ubiquitination and subsequent proteolysis of LEF1. Together these effects inhibit the transcriptional activation of canonical Wnt/beta-catenin target genes. Negative regulator of the Notch signaling pathway. Binds to and phosphorylates NOTCH1, thereby preventing the formation of a transcriptionally active ternary complex of NOTCH1, RBPJ/RBPSUH and MAML1. Negative regulator of the MYB family of transcription factors. Phosphorylation of MYB leads to its subsequent proteolysis while phosphorylation of MYBL1 and MYBL2 inhibits their interaction with the coactivator CREBBP. Other transcription factors may also be inhibited by direct phosphorylation of CREBBP itself. Acts downstream of IL6 and MAP3K7/TAK1 to phosphorylate STAT3, which is in turn required for activation of NLK by MAP3K7/TAK1.confidentE2QWQ2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0018107 [BP]peptidyl-threonine phosphorylationconfidentGO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0004672 [MF]protein kinase activityconfidentGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0001736 [BP]establishment of planar polarityprobableGO:0032502, GO:0002009, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0001738, GO:0007164, GO:0048729, GO:0008150, GO:0009653, GO:0044699
GO:0007179 [BP]transforming growth factor beta receptor signaling pathwayprobableGO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0033136 [BP]serine phosphorylation of STAT3 proteinprobableGO:0018105, GO:0016310, GO:0048583, GO:0023051, GO:0010646, GO:0010627, GO:0050789, GO:0044267, GO:0044260, GO:0009966, GO:0018193, GO:0071704, GO:0065007, GO:0006468, GO:0046425, GO:0009987, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044238, GO:0018209, GO:0042501, GO:0044237, GO:0043170, GO:0019538, GO:0006796, GO:0006793
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0042332 [BP]gravitaxisprobableGO:0009629, GO:0040011, GO:0042330, GO:0009605, GO:0009628, GO:0050896, GO:0008150
GO:0030178 [BP]negative regulation of Wnt receptor signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0007474 [BP]imaginal disc-derived wing vein specificationprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0003002, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0008586 [BP]imaginal disc-derived wing vein morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0023014 [BP]signal transduction by phosphorylationprobableGO:0044700, GO:0051716, GO:0008152, GO:0016310, GO:0050896, GO:0009987, GO:0044237, GO:0050794, GO:0008150, GO:0006796, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0006793, GO:0007154, GO:0050789, GO:0044699
GO:0048749 [BP]compound eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0045887 [BP]positive regulation of synaptic growth at neuromuscular junctionprobableGO:0048639, GO:0048638, GO:0019226, GO:0045927, GO:0035637, GO:0050803, GO:0008582, GO:0050807, GO:0048634, GO:0051128, GO:0032501, GO:0023052, GO:0051147, GO:0050789, GO:0044699, GO:0051962, GO:0040008, GO:0060284, GO:0065007, GO:0048518, GO:0048641, GO:0065008, GO:0051130, GO:0016202, GO:0009987, GO:0050793, GO:0050877, GO:0048742, GO:1901861, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051094, GO:0051963, GO:0044087, GO:0051960, GO:2000026, GO:0051965, GO:0044763, GO:0044089, GO:0048522
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0034605 [BP]cellular response to heatprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0009266, GO:0009408, GO:0044699
GO:0009574 [CC]preprophase bandprobableGO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0035173 [MF]histone kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0051019 [MF]mitogen-activated protein kinase bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0008356 [BP]asymmetric cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0051301
GO:0009737 [BP]response to abscisic acid stimulusprobableGO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0097305, GO:0010033
GO:0007169 [BP]transmembrane receptor protein tyrosine kinase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0030447 [BP]filamentous growthprobableGO:0008150, GO:0040007, GO:0044699
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0031398 [BP]positive regulation of protein ubiquitinationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0016572 [BP]histone phosphorylationprobableGO:0016310, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0006468, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0008150, GO:0016568, GO:0016569
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048610 [BP]cellular process involved in reproductionprobableGO:0009987, GO:0008150, GO:0000003
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0009755 [BP]hormone-mediated signaling pathwayprobableGO:0071495, GO:0044700, GO:0051716, GO:0009719, GO:0070887, GO:0008150, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0050794, GO:0050789, GO:0032870, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0042221, GO:0007154, GO:0010033, GO:0044699
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044732 [CC]mitotic spindle pole bodyprobableGO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622
GO:0042770 [BP]signal transduction in response to DNA damageprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0006974, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0000169 [BP]activation of MAPK activity involved in osmosensory signaling pathwayprobableGO:0000187, GO:0031401, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0065007, GO:0044093, GO:0031399, GO:0048518, GO:0032270, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0001932, GO:0047484, GO:0080134, GO:0080135, GO:0051338, GO:0045860, GO:0001934, GO:0048522
GO:0016605 [CC]PML bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0042594 [BP]response to starvationprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0006950, GO:0008150
GO:0009636 [BP]response to toxic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0042169 [MF]SH2 domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0045765 [BP]regulation of angiogenesisprobableGO:0022603, GO:0050793, GO:0008150, GO:1901342, GO:2000026, GO:0051239, GO:0065007, GO:0050789
GO:0030901 [BP]midbrain developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0042742 [BP]defense response to bacteriumprobableGO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0001707 [BP]mesoderm formationprobableGO:0032502, GO:0048598, GO:0048856, GO:0001704, GO:0048332, GO:0007498, GO:0007369, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0044699, GO:0048729, GO:0009653, GO:0007275, GO:0048646, GO:0044707
GO:0045167 [BP]asymmetric protein localization involved in cell fate determinationprobableGO:0032502, GO:0008105, GO:0008104, GO:0048869, GO:0001709, GO:0045165, GO:0044763, GO:0030154, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699
GO:0002218 [BP]activation of innate immune responseprobableGO:0031349, GO:0050776, GO:0045089, GO:0045088, GO:0080134, GO:0048584, GO:0048583, GO:0050778, GO:0002376, GO:0002684, GO:0065007, GO:0008150, GO:0002253, GO:0048518, GO:0002682, GO:0050789, GO:0031347
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0010085 [BP]polarity specification of proximal/distal axisprobableGO:0032502, GO:0007389, GO:0009954, GO:0044707, GO:0009946, GO:0065001, GO:0032501, GO:0008150, GO:0003002, GO:0009798, GO:0007275, GO:0044699
GO:0032869 [BP]cellular response to insulin stimulusprobableGO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0051403 [BP]stress-activated MAPK cascadeprobableGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0000165, GO:0031098, GO:0050794, GO:0008150, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0015030 [CC]Cajal bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0000307 [CC]cyclin-dependent protein kinase holoenzyme complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030177 [BP]positive regulation of Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0030111, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0060761 [BP]negative regulation of response to cytokine stimulusprobableGO:0048585, GO:0048583, GO:0008150, GO:0065007, GO:0060759, GO:0048519, GO:0050789
GO:0009411 [BP]response to UVprobableGO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0009524 [CC]phragmoplastprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044764 [BP]multi-organism cellular processprobableGO:0009987, GO:0008150, GO:0051704
GO:0034115 [BP]negative regulation of heterotypic cell-cell adhesionprobableGO:0034114, GO:0045995, GO:0022603, GO:0050793, GO:0030155, GO:0065007, GO:0008150, GO:0050794, GO:0051239, GO:0022407, GO:0007162, GO:0070587, GO:2000026, GO:0048523, GO:0010470, GO:0048519, GO:0050789, GO:0022408
GO:0030335 [BP]positive regulation of cell migrationprobableGO:0051272, GO:0030334, GO:0040017, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522
GO:0009952 [BP]anterior/posterior pattern specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0060968 [BP]regulation of gene silencingprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0030427 [CC]site of polarized growthprobableGO:0005575, GO:0044464, GO:0005623
GO:0032153 [CC]cell division siteprobableGO:0005575, GO:0044464, GO:0005623
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0016055 [BP]Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0035924 [BP]cellular response to vascular endothelial growth factor stimulusprobableGO:0051716, GO:0071363, GO:0050896, GO:0009987, GO:0070848, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0051602 [BP]response to electrical stimulusprobableGO:0009628, GO:0050896, GO:0008150
GO:0002757 [BP]immune response-activating signal transductionprobableGO:0048584, GO:0048583, GO:0023052, GO:0007165, GO:0050789, GO:0044699, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0009987, GO:0050794, GO:0008150, GO:0007154, GO:0044700, GO:0050776, GO:0050896, GO:0050778, GO:0002376, GO:0002253, GO:0044763
GO:0044445 [CC]cytosolic partprobableGO:0005737, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051534 [BP]negative regulation of NFAT protein import into nucleusprobableGO:0033157, GO:0060341, GO:0051049, GO:0032386, GO:0032387, GO:0051223, GO:0051224, GO:0050789, GO:0032880, GO:0065007, GO:0048519, GO:0070201, GO:0051051, GO:0090317, GO:0050794, GO:0008150, GO:0042308, GO:0042306, GO:0032879, GO:0042992, GO:0042990, GO:1900180, GO:0051532, GO:0046822, GO:0046823
GO:0036003 [BP]positive regulation of transcription from RNA polymerase II promoter in response to stressprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0010628, GO:0050789, GO:0044699, GO:0080090, GO:0051716, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0043618, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0044763, GO:0045893, GO:2001141, GO:0043620, GO:0050896, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0045944, GO:0033554, GO:0008150, GO:0048522
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0051591 [BP]response to cAMPprobableGO:1901700, GO:0009719, GO:0050896, GO:1901698, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0014074, GO:0046683, GO:0014070
GO:0032495 [BP]response to muramyl dipeptideprobableGO:1901700, GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:1901652, GO:0042221, GO:1901698
GO:0071276 [BP]cellular response to cadmium ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0046686, GO:0042221, GO:0010035, GO:0044699
GO:0042694 [BP]muscle cell fate specificationprobableGO:0032502, GO:0045165, GO:0009987, GO:0048869, GO:0001708, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0042693, GO:0042692, GO:0044699, GO:0048856
GO:0045087 [BP]innate immune responseprobableGO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955
GO:0007052 [BP]mitotic spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0071243 [BP]cellular response to arsenic-containing substanceprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0046685, GO:0044699
GO:0047485 [MF]protein N-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0002062 [BP]chondrocyte differentiationprobableGO:0032502, GO:0051216, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0009888, GO:0061448, GO:0008150, GO:0001501, GO:0048513, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0048856
GO:0031663 [BP]lipopolysaccharide-mediated signaling pathwayprobableGO:0071222, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0042221, GO:0032496, GO:0050789, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0065007, GO:0071219, GO:0071216, GO:0044700, GO:0009987, GO:0071396, GO:0050794, GO:0044763, GO:0007154, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0008150
GO:0004705 [MF]JUN kinase activityprobableGO:0016301, GO:0060089, GO:0016773, GO:0005057, GO:0003824, GO:0004702, GO:0016740, GO:0004674, GO:0004707, GO:0003674, GO:0004871, GO:0004672, GO:0016909, GO:0016772
GO:0032101 [BP]regulation of response to external stimulusprobableGO:0008150, GO:0065007, GO:0048583, GO:0050789
GO:0070301 [BP]cellular response to hydrogen peroxideprobableGO:1901700, GO:1901701, GO:0051716, GO:0070887, GO:0042542, GO:0050896, GO:0009987, GO:0034614, GO:0000302, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0034599, GO:0010035, GO:0006979, GO:0044699
GO:0042539 [BP]hypotonic salinity responseprobableGO:0009628, GO:0050896, GO:0008150, GO:0006950, GO:0006970, GO:0006971, GO:0009651
GO:0071214 [BP]cellular response to abiotic stimulusprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0043900 [BP]regulation of multi-organism processprobableGO:0008150, GO:0065007, GO:0050789
GO:0030332 [MF]cyclin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051641 [BP]cellular localizationprobableGO:0008150, GO:0009987, GO:0044763, GO:0051179, GO:0044699
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0001714 [BP]endodermal cell fate specificationprobableGO:0048598, GO:0007492, GO:0030154, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0001706, GO:0001704, GO:0048869, GO:0001708, GO:0007369, GO:0048646, GO:0032502, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0035987, GO:0001711, GO:0045165, GO:0044707, GO:0048856, GO:0060795, GO:0008150
GO:0009723 [BP]response to ethylene stimulusprobableGO:0009719, GO:0009725, GO:0050896, GO:0008150, GO:0042221, GO:0010033

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.24Mitogen-activated protein kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B9H, chain A
Confidence level:very confident
Coverage over the Query: 2-200
View the alignment between query and template
View the model in PyMOL