RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy16893
         (112 letters)



>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine
          Kinase, Nemo-Like Kinase.  Serine/Threonine Kinases
          (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The NLK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Mitogen-activated protein
          kinases (MAPKs) are important mediators of cellular
          responses to extracellular signals. NLK is an atypical
          MAPK that is not regulated by a MAPK kinase. It
          functions downstream of the MAPK kinase kinase Tak1,
          which also plays a role in activating the JNK and p38
          MAPKs. The Tak1/NLK pathways are regulated by Wnts, a
          family of secreted proteins that is critical in the
          control of asymmetric division and cell polarity. NLK
          can phosphorylate transcription factors from the
          TCF/LEF family, inhibiting their ability to activate
          the transcription of target genes. In prostate cancer
          cells, NLK is involved in regulating androgen
          receptor-mediated transcription and its expression is
          altered during cancer progression.
          Length = 372

 Score =  102 bits (256), Expect = 3e-27
 Identities = 40/46 (86%), Positives = 44/46 (95%)

Query: 31 VKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          V +VTDPRDG+RVALKK+PNVFQ+LVS KRVFRELKMLCFFKHDNV
Sbjct: 16 VWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNV 61


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase (MAPK) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The MAPK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation. Typical MAPK pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPK kinase (MAP2K or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAP3K or MKKK). Each cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. There are three main typical MAPK subfamilies:
          Extracellular signal-Regulated Kinase (ERK), c-Jun
          N-terminal Kinase (JNK), and p38. Some MAPKs are
          atypical in that they are not regulated by MAP2Ks.
          These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 70.6 bits (174), Expect = 9e-16
 Identities = 21/46 (45%), Positives = 33/46 (71%)

Query: 31 VKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          V +  D R GR+VA+KK+ NVF  L+ +KR+ RE+K+L   +H+N+
Sbjct: 16 VCSAVDKRTGRKVAIKKISNVFDDLIDAKRILREIKLLRHLRHENI 61


>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
          Kinase,  Extracellular signal-Regulated Kinase 5.
          Serine/Threonine Kinases (STKs), Extracellular
          signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The ERK5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7,
          has a unique C-terminal extension, making it
          approximately twice as big as other MAPKs. This
          extension contains transcriptional activation
          capability which is inhibited by the N-terminal half.
          ERK5 is activated in response to growth factors and
          stress by a cascade that leads to its phosphorylation
          by the MAP2K MEK5, which in turn is regulated by the
          MAP3Ks MEKK2 and MEKK3. Activated ERK5 phosphorylates
          its targets including myocyte enhancer factor 2 (MEF2),
          Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
          cell proliferation during the G1/S phase transition.
          Studies on knockout mice revealed that ERK5 is
          essential for cardiovascular development and plays an
          important role in angiogenesis. It is also critical for
          neural differentiation and survival. The ERK5 pathway
          has been implicated in the pathogenesis of many
          diseases including cancer, cardiac hypertrophy, and
          atherosclerosis.
          Length = 334

 Score = 57.7 bits (140), Expect = 4e-11
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 4/50 (8%)

Query: 27 ICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          +CS++    D R G++VA+KK+P+ F     +KR  RELK+L  FKHDN+
Sbjct: 21 VCSAI----DTRSGKKVAIKKIPHAFDVPTLAKRTLRELKILRHFKHDNI 66


>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine
          Kinase, p38 Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), p38 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The p38 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They function in the regulation
          of the cell cycle, cell development, cell
          differentiation, senescence, tumorigenesis, apoptosis,
          pain development and pain progression, and immune
          responses. p38 kinases are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. p38 substrates include other protein kinases
          and factors that regulate transcription, nuclear
          export, mRNA stability and translation. p38 kinases are
          drug targets for the inflammatory diseases psoriasis,
          rheumatoid arthritis, and chronic pulmonary disease.
          Vertebrates contain four isoforms of p38, named alpha,
          beta, gamma, and delta, which show varying substrate
          specificity and expression patterns. p38alpha and
          p38beta are ubiquitously expressed, p38gamma is
          predominantly found in skeletal muscle, and p38delta is
          found in the heart, lung, testis, pancreas, and small
          intestine.
          Length = 343

 Score = 53.8 bits (130), Expect = 8e-10
 Identities = 21/47 (44%), Positives = 31/47 (65%)

Query: 30 SVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
           V +  D + GR+VA+KKL   FQS + +KR +REL++L    H+NV
Sbjct: 30 QVCSAFDTKTGRKVAIKKLSRPFQSAIHAKRTYRELRLLKHMDHENV 76


>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the
          Serine/Threonine Kinases, TEY Mitogen-Activated Protein
          Kinases from Plants.  Serine/Threonine Kinases (STKs),
          Plant TEY Mitogen-Activated Protein Kinase (MAPK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          TEY MAPK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. In plants, MAPKs are associated with
          physiological, developmental, hormonal, and stress
          responses. Some plants show numerous gene duplications
          of MAPKs. Arabidopsis thaliana harbors at least 20
          MAPKs, named AtMPK1-20. There are two subtypes of plant
          MAPKs based on the conserved phosphorylation motif
          present in the activation loop, TEY and TDY. This
          subfamily represents the TEY subtype and is further
          subdivided into three groups (A, B, and C). Group A is
          represented by AtMPK3, AtMPK6, Nicotiana tabacum BTF4
          (NtNTF4), among others. They are mostly involved in
          environmental and hormonal responses. AtMPK3 and
          AtMPK6 are also key regulators for stomatal development
          and patterning. Group B is represented by AtMPK4,
          AtMPK13, and NtNTF6, among others. They may be involved
          in both cell division and environmental stress
          response. AtMPK4 also participates in regulating innate
          immunity. Group C is represented by AtMPK1, AtMPK2,
          NtNTF3, Oryza sativa MAPK4 (OsMAPK4), among others.
          They may also be involved in stress responses. AtMPK1
          and AtMPK2 are activated following mechanical injury
          and in the presence of stress chemicals such as
          jasmonic acid, hydrogen peroxide and abscisic acid.
          OsMAPK4 is also called OsMSRMK3 for Multiple
          Stress-Responsive MAPK3.
          Length = 337

 Score = 51.6 bits (124), Expect = 5e-09
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 27 ICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          +CS+  + T      +VA+KK+ N F + + +KR  RE+K+L    H+NV
Sbjct: 21 VCSAKNSET----NEKVAIKKIANAFDNRIDAKRTLREIKLLRHLDHENV 66


>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the
          Serine/Threonine Kinase, p38alpha Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38alpha subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38alpha subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38alpha, also
          called MAPK14, is expressed in most tissues and is the
          major isoform involved in the immune and inflammatory
          response. It is the central p38 MAPK involved in
          myogenesis. It plays a role in regulating cell cycle
          check-point transition and promoting cell
          differentiation. p38alpha also regulates cell
          proliferation and death through crosstalk with the JNK
          pathway. Its substrates include MAPK activated protein
          kinase 2 (MK2), MK5, and the transcription factors ATF2
          and Mitf.
          Length = 345

 Score = 51.2 bits (122), Expect = 8e-09
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 4/51 (7%)

Query: 26 SICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          S+C++     D + G RVA+KKL   FQS++ +KR +REL++L   KH+NV
Sbjct: 32 SVCAAF----DTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENV 78


>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the
          Serine/Threonine Kinase, p38delta Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38delta subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38delta subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38delta, also
          called MAPK13, is found in skeletal muscle, heart,
          lung, testis, pancreas, and small intestine. It
          regulates microtubule function by phosphorylating Tau.
          It activates the c-jun promoter and plays a role in G2
          cell cycle arrest. It also controls the degration of
          c-Myb, which is associated with myeloid leukemia and
          poor prognosis in colorectal cancer. p38delta is the
          main isoform involved in regulating the differentiation
          and apoptosis of keratinocytes.
          Length = 342

 Score = 51.1 bits (122), Expect = 1e-08
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 4/52 (7%)

Query: 26 SICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNVS 77
          S+CS++    D R G +VA+KKL   FQS + +KR +REL +L   +H+NV 
Sbjct: 30 SVCSAI----DKRTGEKVAIKKLSRPFQSEIFAKRAYRELTLLKHMQHENVI 77


>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the
          Serine/Threonine Kinase, p38beta Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38beta subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38beta subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38beta, also
          called MAPK11, is widely expressed in tissues and shows
          more similarity with p38alpha than with the other
          isoforms. Both are sensitive to pyridinylimidazoles and
          share some common substrates such as MAPK activated
          protein kinase 2 (MK2) and the transcription factors
          ATF2, c-Fos and, ELK-1. p38beta is involved in
          regulating the activation of the cyclooxygenase-2
          promoter and the expression of TGFbeta-induced
          alpha-smooth muscle cell actin.
          Length = 343

 Score = 49.3 bits (117), Expect = 4e-08
 Identities = 22/47 (46%), Positives = 33/47 (70%)

Query: 30 SVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          SV +  D R  ++VA+KKL   FQSL+ ++R +REL++L   KH+NV
Sbjct: 30 SVCSAYDTRLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHMKHENV 76


>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Mitogen-Activated Protein Kinase MPK1.
          Serine/Threonine Kinases (STKs), Fungal
          Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MPK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1
          from Schizosaccharomyces pombe, and similar proteins.
          MAPKs are important mediators of cellular responses to
          extracellular signals. MPK1 (also called Slt2) and Pmk1
          (also called Spm1) are stress-activated MAPKs that
          regulate the cell wall integrity (CWI) pathway, and are
          therefore important in the maintainance of cell shape,
          cell wall construction, morphogenesis, and ion
          homeostasis. MPK1 is activated in response to cell wall
          stress including heat stimulation, osmotic shock, UV
          irradiation, and any agents that interfere with cell
          wall biogenesis such as chitin antagonists, caffeine,
          or zymolase. MPK1 is regulated by the MAP2Ks Mkk1/2,
          which are regulated by the MAP3K Bck1. Pmk1 is also
          activated by multiple stresses including elevated
          temperatures, hyper- or hypotonic stress, glucose
          deprivation, exposure to cell-wall damaging compounds,
          and oxidative stress. It is regulated by the MAP2K
          Pek1, which is regulated by the MAP3K Mkh1.
          Length = 332

 Score = 48.9 bits (117), Expect = 5e-08
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 27 ICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFK-HDNV 76
          +CS+  A T       VA+KK+ NVF   + +KR  RELK+L  F+ H N+
Sbjct: 16 VCSARNAETSE--EETVAIKKITNVFSKKILAKRALRELKLLRHFRGHKNI 64


>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the
          Serine/Threonine Kinase, p38gamma Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38gamma subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38gamma subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38gamma, also
          called MAPK12, is predominantly expressed in skeletal
          muscle. Unlike p38alpha and p38beta, p38gamma is
          insensitive to pyridinylimidazoles. It displays an
          antagonizing function compared to p38alpha. p38gamma
          inhibits, while p38alpha stimulates, c-Jun
          phosphorylation and AP-1 mediated transcription.
          p38gamma also plays a role in the signaling between Ras
          and the estrogen receptor and has been implicated to
          increase cell invasion and breast cancer progression.
          In Xenopus, p38gamma is critical in the meiotic
          maturation of oocytes.
          Length = 343

 Score = 48.8 bits (116), Expect = 5e-08
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 4/51 (7%)

Query: 26 SICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          ++CS++    D R G +VA+KKL   FQS + +KR +REL++L   KH+NV
Sbjct: 30 TVCSAL----DRRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMKHENV 76


>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine
          Kinase, c-Jun N-terminal Kinase.  Serine/Threonine
          Kinases (STKs), c-Jun N-terminal kinase (JNK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          JNK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. JNKs are mitogen-activated
          protein kinases (MAPKs) that are involved in many
          stress-activated responses including those during
          inflammation, neurodegeneration, apoptosis, and
          persistent pain sensitization, among others. They are
          also essential regulators of physiological and
          pathological processes and are involved in the
          pathogenesis of several diseases such as diabetes,
          atherosclerosis, stroke, Parkinson's and Alzheimer's.
          Vetebrates harbor three different JNK genes (Jnk1,
          Jnk2, and Jnk3) that are alternatively spliced to
          produce at least 10 isoforms. JNKs are specifically
          activated by the MAPK kinases MKK4 and MKK7, which are
          in turn activated by upstream MAPK kinase kinases as a
          result of different stimuli including stresses such as
          ultraviolet (UV) irradiation, hyperosmolarity, heat
          shock, or cytokines. JNKs activate a large number of
          different substrates based on specific stimulus, cell
          type, and cellular condition, and may be implicated in
          seemingly contradictory functions.
          Length = 353

 Score = 43.2 bits (102), Expect = 4e-06
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 27 ICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          +C++   VT    G+ VA+KKL   FQ++  +KR +REL ++    H N+
Sbjct: 32 VCAAYDTVT----GQNVAIKKLSRPFQNVTHAKRAYRELVLMKLVNHKNI 77


>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine
          Kinases, Fungal Mitogen-Activated Protein Kinases Sty1
          and Hog1.  Serine/Threonine Kinases (STKs), Fungal
          Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Sty1/Hog1 subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1
          from Saccharomyces cerevisiae, and similar proteins.
          MAPKs are important mediators of cellular responses to
          extracellular signals. Sty1 and Hog1 are
          stress-activated MAPKs that partipate in
          transcriptional regulation in response to stress. Sty1
          is activated in response to oxidative stress, osmotic
          stress, and UV radiation. Sty1 is regulated by the
          MAP2K Wis1, which is activated by the MAP3Ks Wis4 and
          Win1, which receive signals of the stress condition
          from membrane-spanning histidine kinases Mak1-3.
          Activated Sty1 stabilizes the Atf1 transcription factor
          and induces transcription of Atf1-dependent genes of
          the core environmetal stress response (CESR). Hog1 is
          the key element in the high osmolarity glycerol (HOG)
          pathway and is activated upon hyperosmotic stress.
          Activated Hog1 accumulates in the nucleus and regulates
          stress-induced transcription. The HOG pathway is
          mediated by two transmembrane osmosensors, Sln1 and
          Sho1.
          Length = 328

 Score = 42.9 bits (101), Expect = 6e-06
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 4/50 (8%)

Query: 27 ICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          +CS+   +T    G+ VA+KK+   F + V +KR +RELK+L   +H+N+
Sbjct: 26 VCSARDQLT----GQNVAIKKIMKPFSTPVLAKRTYRELKLLKHLRHENI 71


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
          domain.  Phosphotransferases. Serine or
          threonine-specific kinase subfamily.
          Length = 254

 Score = 40.2 bits (95), Expect = 6e-05
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 29 SSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
            V    D + G+ VA+K +          +R+ RE+K+L   KH N+
Sbjct: 13 GKVYLARDKKTGKLVAIKVIKKKKIK-KDRERILREIKILKKLKHPNI 59


>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the
          Serine/Threonine Kinases, TDY Mitogen-Activated Protein
          Kinases from Plants.  Serine/Threonine Kinases (STKs),
          Plant TDY Mitogen-Activated Protein Kinase (MAPK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          TDY MAPK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. In plants, MAPKs are associated with
          physiological, developmental, hormonal, and stress
          responses. Some plants show numerous gene duplications
          of MAPKs. Arabidopsis thaliana harbors at least 20
          MAPKs, named AtMPK1-20. Oryza sativa contains at least
          17 MAPKs. There are two subtypes of plant MAPKs based
          on the conserved phosphorylation motif present in the
          activation loop, TEY and TDY. Arabidopsis thaliana
          contains more TEY-type MAPKs than TDY-type, whereas the
          reverse is true for Oryza sativa. This subfamily
          represents the TDY subtype and is composed of Group D
          plant MAPKs including Arabidopsis thaliana MPK18
          (AtMPK18), Oryza sativa Blast- and Wound-induced MAPK1
          (OsBWMK1), OsWJUMK1 (Wound- and JA-Uninducible MAPK1),
          Zea mays MPK6, and the Medicago sativa TDY1 gene
          product. OsBWMK1 enhances resistance to pathogenic
          infections. It mediates stress-activated defense
          responses by activating a transcription factor that
          affects the expression of stress-related genes. AtMPK18
          is involved in microtubule-related functions.
          Length = 338

 Score = 40.1 bits (94), Expect = 6e-05
 Identities = 16/51 (31%), Positives = 31/51 (60%)

Query: 31 VKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNVSITQH 81
          V +  D   G +VA+KK+ +VF+ +  + R+ RE+K+L   +H ++   +H
Sbjct: 16 VCSAIDTHTGEKVAIKKINDVFEHVSDATRILREIKLLRLLRHPDIVEIKH 66


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), CMGC family, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The CMGC family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. The CMGC family
          consists of Cyclin-Dependent protein Kinases (CDKs),
          Mitogen-activated protein kinases (MAPKs) such as
          Extracellular signal-regulated kinase (ERKs), c-Jun
          N-terminal kinases (JNKs), and p38, and similar
          proteins. CDKs belong to a large subfamily of STKs that
          are regulated by their cognate cyclins. Together, they
          are involved in the control of cell-cycle progression,
          transcription, and neuronal function. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation.
          Length = 283

 Score = 39.2 bits (92), Expect = 1e-04
 Identities = 16/48 (33%), Positives = 22/48 (45%)

Query: 29 SSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
            V    D   G  VA+KK+   F+S    K   RE+K+L    H N+
Sbjct: 13 GVVYKARDKLTGEIVAIKKIKLRFESEGIPKTALREIKLLKELNHPNI 60


>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine
          Kinase, c-Jun N-terminal Kinase 3.  Serine/Threonine
          Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          JNK3 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. JNKs are mitogen-activated
          protein kinases (MAPKs) that are involved in many
          stress-activated responses including those during
          inflammation, neurodegeneration, apoptosis, and
          persistent pain sensitization, among others. Vetebrates
          harbor three different JNK genes (Jnk1, Jnk2, and
          Jnk3). JNK3 is expressed primarily in the brain, and to
          a lesser extent in the heart and testis. Mice deficient
          in Jnk3 are protected against kainic acid-induced
          seizures, stroke, sciatic axotomy neural death, and
          neuronal death due to NGF deprivation, oxidative
          stress, or exposure to beta-amyloid peptide. This
          suggests that JNK3 may play roles in the pathogenesis
          of these diseases.
          Length = 355

 Score = 37.8 bits (87), Expect = 5e-04
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 27 ICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          +C++  AV D    R VA+KKL   FQ+   +KR +REL ++    H N+
Sbjct: 33 VCAAYDAVLD----RNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNI 78


>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
          signal-Regulated Kinase 1 and 2-like Serine/Threonine
          Kinases.  Serine/Threonine Kinases (STKs),
          Extracellular signal-regulated kinases 1 and 2 (ERK1/2)
          and Fus3 subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. This
          ERK1/2-like subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of the mitogen-activated protein kinases (MAPKs) ERK1,
          ERK2, baker's yeast Fus3, and similar proteins. MAPK
          pathways are important mediators of cellular responses
          to extracellular signals. ERK1/2 activation is
          preferentially by mitogenic factors, differentiation
          stimuli, and cytokines, through a kinase cascade
          involving the MAPK kinases MEK1/2 and a MAPK kinase
          kinase from the Raf family. ERK1/2 have numerous
          substrates, many of which are nuclear and participate
          in transcriptional regulation of many cellular
          processes. They regulate cell growth, cell
          proliferation, and cell cycle progression from G1 to S
          phase. Although the distinct roles of ERK1 and ERK2
          have not been fully determined, it is known that ERK2
          can maintain most functions in the absence of ERK1, and
          that the deletion of ERK2 is embryonically lethal. The
          MAPK, Fus3, regulates yeast mating processes including
          mating-specific gene expression, G1 arrest, mating
          projection, and cell fusion.
          Length = 336

 Score = 36.5 bits (85), Expect = 0.001
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 7/51 (13%)

Query: 27 ICSSVKAVTDPRDGRRVALKKL-PNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          +CS+    T    G +VA+KK+ P  F+     +R  RE+K+L  FKH+N+
Sbjct: 21 VCSATHKPT----GVKVAIKKISP--FEHQTFCQRTLREIKILRRFKHENI 65


>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine
          Kinase, c-Jun N-terminal Kinase 1.  Serine/Threonine
          Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          JNK1 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. JNKs are mitogen-activated
          protein kinases (MAPKs) that are involved in many
          stress-activated responses including those during
          inflammation, neurodegeneration, apoptosis, and
          persistent pain sensitization, among others. Vetebrates
          harbor three different JNK genes (Jnk1, Jnk2, and
          Jnk3). JNK1, like JNK2, is expressed in every cell and
          tissue type. Initially it was thought that JNK1 and
          JNK2 were functionally redundant as mice deficient in
          either genes (Jnk1 or Jnk2) could survive but
          disruption of both genes resulted in lethality.
          However, recent studies have shown that JNK1 and JNK2
          perform distinct functions through specific binding
          partners and substrates. JNK1 specifically binds with
          JAMP (JNK1-associated membrane protein), which
          regulates the duration of JNK1 activity in response to
          stimuli. Specific JNK1 substrates include Itch and
          SG10, which are implicated in Th2 responses and airway
          inflammation, and microtubule dynamics and axodendritic
          length, respectively. Mice deficient in Jnk1 are
          protected against arthritis, obesity, type 2 diabetes,
          cardiac cell death, and non-alcoholic liver disease,
          suggesting that JNK1 may play roles in the pathogenesis
          of these diseases.
          Length = 364

 Score = 35.8 bits (82), Expect = 0.002
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 27 ICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          +C++  A+ +    R VA+KKL   FQ+   +KR +REL ++    H N+
Sbjct: 40 VCAAYDAILE----RNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNI 85


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c)
          domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The STE family
          is part of a larger superfamily that includes the
          catalytic domains of other protein serine/threonine
          kinases (STKs), protein tyrosine kinases (PTKs), RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase (PI3K). This
          family is composed of STKs, and some dual-specificity
          PKs that phosphorylate both threonine and tyrosine
          residues of target proteins. Most members are kinases
          involved in mitogen-activated protein kinase (MAPK)
          signaling cascades, acting as MAPK kinases (MAPKKs),
          MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase
          kinases (MAP4Ks). The MAPK signaling pathways are
          important mediators of cellular responses to
          extracellular signals. The pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPKK, which itself
          is phosphorylated and activated by a MAPKKK. Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAPKKK to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. Other STE family members include
          p21-activated kinases (PAKs) and class III myosins,
          among others. PAKs are Rho family GTPase-regulated
          kinases that serve as important mediators in the
          function of Cdc42 (cell division cycle 42) and Rac.
          Class III myosins are motor proteins containing an
          N-terminal kinase catalytic domain and a C-terminal
          actin-binding domain, which can phosphorylate several
          cytoskeletal proteins, conventional myosin regulatory
          light chains, as well as autophosphorylate the
          C-terminal motor domain. They play an important role in
          maintaining the structural integrity of photoreceptor
          cell microvilli.
          Length = 253

 Score = 35.6 bits (83), Expect = 0.002
 Identities = 12/47 (25%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 30 SVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
           V      R G+ VA+K +    +S    +++  E+++L   KH N+
Sbjct: 15 EVYKARHKRTGKEVAIKVIK--LESKEKKEKIINEIQILKKCKHPNI 59


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein
          Kinases (PKs), catalytic (c) domain. PKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine or tyrosine residues on protein
          substrates. The PK family is part of a larger
          superfamily that includes the catalytic domains of RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, phosphoinositide 3-kinase (PI3K), and
          actin-fragmin kinase. PKs make up a large family of
          serine/threonine kinases, protein tyrosine kinases
          (PTKs), and dual-specificity PKs that phosphorylate
          both serine/threonine and tyrosine residues of target
          proteins. Majority of protein phosphorylation, about
          95%, occurs on serine residues while only 1% occurs on
          tyrosine residues. Protein phosphorylation is a
          mechanism by which a wide variety of cellular proteins,
          such as enzymes and membrane channels, are reversibly
          regulated in response to certain stimuli. PKs often
          function as components of signal transduction pathways
          in which one kinase activates a second kinase, which in
          turn, may act on other kinases; this sequential action
          transmits a signal from the cell surface to target
          proteins, which results in cellular responses. The PK
          family is one of the largest known protein families
          with more than 100 homologous yeast enzymes and 550
          human proteins. A fraction of PK family members are
          pseudokinases that lack crucial residues for catalytic
          activity. The mutiplicity of kinases allows for
          specific regulation according to substrate, tissue
          distribution, and cellular localization. PKs regulate
          many cellular processes including proliferation,
          division, differentiation, motility, survival,
          metabolism, cell-cycle progression, cytoskeletal
          rearrangement, immunity, and neuronal functions. Many
          kinases are implicated in the development of various
          human diseases including different types of cancer.
          Length = 215

 Score = 34.5 bits (80), Expect = 0.005
 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 29 SSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
           +V    D + G++VA+K +     S    + + RE+++L    H N+
Sbjct: 7  GTVYLARDKKTGKKVAIKIIKKE-DSSSLLEELLREIEILKKLNHPNI 53


>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine
          Kinase, c-Jun N-terminal Kinase 2.  Serine/Threonine
          Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          JNK2 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. JNKs are mitogen-activated
          protein kinases (MAPKs) that are involved in many
          stress-activated responses including those during
          inflammation, neurodegeneration, apoptosis, and
          persistent pain sensitization, among others. Vetebrates
          harbor three different JNK genes (Jnk1, Jnk2, and
          Jnk3). JNK1, like JNK2, is expressed in every cell and
          tissue type. Initially it was thought that JNK1 and
          JNK2 were functionally redundant as mice deficient in
          either genes (Jnk1 or Jnk2) could survive but
          disruption of both genes resulted in lethality.
          However, recent studies have shown that JNK1 and JNK2
          perform distinct functions through specific binding
          partners and substrates.  JNK2 is specifically
          translocated to the mitochondria during dopaminergic
          cell death. Specific substrates include the
          microtubule-associated proteins DCX and Tau, as well as
          TIF-IA which is involved in ribosomal RNA synthesis
          regulation. Mice deficient in Jnk2 show protection
          against arthritis, type 1 diabetes, atherosclerosis,
          abdominal aortic aneurysm, cardiac cell death,
          TNF-induced liver damage, and tumor growth, indicating
          that JNK2 may play roles in the pathogenesis of these
          diseases.
          Length = 359

 Score = 33.8 bits (77), Expect = 0.009
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 27 ICSSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          +C++   V     G  VA+KKL   FQ+   +KR +REL +L    H N+
Sbjct: 37 VCAAFDTVL----GINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNI 82


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 33.8 bits (78), Expect = 0.009
 Identities = 12/62 (19%), Positives = 22/62 (35%)

Query: 29 SSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNVSITQHTPYTTRR 88
           +V        G+ VA+K L    +     +   RE+++L    H N+            
Sbjct: 13 GTVYKAKHKGTGKIVAVKILKKRSEKSKKDQTARREIRILRRLSHPNIVRLIDAFEDKDH 72

Query: 89 MY 90
          +Y
Sbjct: 73 LY 74


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase 15.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAPK15 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. Human MAPK15 is also called Extracellular
          signal Regulated Kinase 8 (ERK8) while the rat protein
          is called ERK7. ERK7 and ERK8 display both similar and
          different biochemical properties. They
          autophosphorylate and activate themselves and do not
          require upstream activating kinases. ERK7 is
          constitutively active and is not affected by
          extracellular stimuli whereas ERK8 shows low basal
          activity and is activated by DNA-damaging agents. ERK7
          and ERK8 also have different substrate profiles. Genome
          analysis shows that they are orthologs with similar
          gene structures. ERK7 and ERK 8 may be involved in the
          signaling of some nuclear receptor transcription
          factors. ERK7 regulates hormone-dependent degradation
          of estrogen receptor alpha while ERK8 down-regulates
          the transcriptional co-activation androgen and
          glucocorticoid receptors.
          Length = 337

 Score = 33.7 bits (78), Expect = 0.011
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 32 KAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLC-FFKHDNV 76
          KA+ D R    VALKK+ + F++   ++R FRE+  L     H N+
Sbjct: 25 KAI-DRRTKEVVALKKIFDAFRNATDAQRTFREIMFLQELGDHPNI 69


>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine
          Kinases, Mitogen-Activated Protein Kinases 4 and 6.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAPK4/6 subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. MAPK4 is also called ERK4 or p63MAPK, while
          MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6
          are atypical MAPKs that are not regulated by MAP2Ks.
          MAPK6 is expressed ubiquitously with highest amounts in
          brain and skeletal muscle. It may be involved in the
          control of cell differentiation by negatively
          regulating cell cycle progression in certain
          conditions. It may also play a role in glucose-induced
          insulin secretion. MAPK6 and MAPK4 cooperate to
          regulate the activity of MAPK-activated protein kinase
          5 (MK5), leading to its relocation to the cytoplasm and
          exclusion from the nucleus. The MAPK6/MK5 and MAPK4/MK5
          pathways may play critical roles in embryonic and
          post-natal development.
          Length = 342

 Score = 32.4 bits (74), Expect = 0.028
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 36 DPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          D    +RVA+KK+  V     S K   RE+K++    HDN+
Sbjct: 26 DSDCDKRVAVKKI--VLTDPQSVKHALREIKIIRRLDHDNI 64


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
          dual-specificity MAP kinase kinases and similar
          proteins.  Protein kinases (PKs), MAP kinase kinase
          (MAPKK) subfamily, Plant MAPKKs and similar proteins,
          catalytic (c) domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The MAPKK
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein serine/threonine
          kinases, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising of the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). Members of this
          group include MAPKKs from plants, kinetoplastids,
          alveolates, and mycetozoa. The MAPKK, LmxPK4, from
          Leishmania mexicana, is important in differentiation
          and virulence. Dictyostelium discoideum MEK1 is
          required for proper chemotaxis. MEK1 null mutants
          display severe defects in cell polarization and
          directional movement. Plants contain multiple MAPKKs
          like other eukaryotes. The Arabidopsis genome encodes
          for 10 MAPKKs while poplar and rice contain 13 MAPKKs
          each. The functions of these proteins have not been
          fully elucidated. There is evidence to suggest that
          MAPK cascades are involved in plant stress responses.
          In Arabidopsis, MKK3 plays a role in pathogen
          signaling, MKK2 is involved in cold and salt stress
          signaling, MKK4/MKK5 participates in innate immunity,
          and MKK7 regulates basal and systemic acquired
          resistance.
          Length = 264

 Score = 29.5 bits (67), Expect = 0.30
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 1/48 (2%)

Query: 29 SSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
            V  V     G+  ALKK+ +V       K++ RELK L   +   V
Sbjct: 15 GVVYKVRHKPTGKIYALKKI-HVDGDEEFRKQLLRELKTLRSCESPYV 61


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-Activated Protein
          Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAPKKK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks)
          are also called MAP/ERK kinase kinases (MEKKs) in some
          cases. They phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. This subfamily is composed of
          the Apoptosis Signal-regulating Kinases ASK1 (or
          MAPKKK5) and ASK2 (or MAPKKK6), MEKK1, MEKK2, MEKK3,
          MEKK4, as well as plant and fungal MAPKKKs. Also
          included in this subfamily are the cell division
          control proteins Schizosaccharomyces pombe Cdc7 and
          Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 28.7 bits (65), Expect = 0.47
 Identities = 12/48 (25%), Positives = 22/48 (45%)

Query: 29 SSVKAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
           SV    D   G  +A+K +     S    + + RE+++L   +H N+
Sbjct: 14 GSVYLALDKDTGELMAVKSVELSGDSEEELEALEREIRILSSLQHPNI 61


>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 4 and 6-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase 4 (CDK4) and CDK6-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK4/6-like
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK4 and CDK6 partner with D-type cyclins to
          regulate the early G1 phase of the cell cycle. They are
          the first kinase activated by mitogenic signals to
          release cells from the G0 arrested state. CDK4 and CDK6
          are both expressed ubiquitously, associate with all
          three D cyclins (D1, D2 and D3), and phosphorylate the
          retinoblastoma (pRb) protein. They are also regulated
          by the INK4 family of inhibitors which associate with
          either the CDK alone or the CDK/cyclin complex. CDK4
          and CDK6 show differences in subcellular localization,
          sensitivity to some inhibitors, timing in activation,
          tumor selectivity, and possibly substrate profiles.
          Although CDK4 and CDK6 seem to show some redundancy,
          they also have discrete, nonoverlapping functions. CDK6
          plays an important role in cell differentiation.
          Length = 287

 Score = 28.4 bits (64), Expect = 0.67
 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 12/68 (17%)

Query: 31 VKAVTDPRDGRRVALKKL--PNVFQSLVSSKRVFRE---LKMLCFFKHDNV----SITQH 81
          V    D   GR VALKK+  P   + +  S    RE   LK L  F+H N+     +  H
Sbjct: 15 VYKARDLNTGRFVALKKVRVPLSEEGIPLS--TLREIALLKQLESFEHPNIVRLLDVC-H 71

Query: 82 TPYTTRRM 89
           P T R +
Sbjct: 72 GPRTDREL 79


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
          Kinase Like Serine/Threonine Kinases.  Serine/Threonine
          Kinases (STKs), Cyclin-dependent protein kinase like
          (CDKL) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CDKL subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDKL1-5 and
          similar proteins. Some CDKLs, like CDKL1 and CDKL3, may
          be implicated in transformation and others, like CDKL3
          and CDKL5, are associated with mental retardation when
          impaired. CDKL2 plays a role in learning and memory.
          Length = 288

 Score = 28.1 bits (63), Expect = 0.80
 Identities = 12/37 (32%), Positives = 18/37 (48%)

Query: 40 GRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          G  VA+KK           K   RE+K+L   +H+N+
Sbjct: 26 GEIVAIKKFKESEDDEDVKKTALREVKVLRQLRHENI 62


>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Cyclin-Dependent protein Kinase Bypass
          UAS Requirement 1 and similar proteins.
          Serine/Threonine Kinases (STKs), Bypass UAS Requirement
          1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          BUR1 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. BUR1, also called SGV1, is a yeast
          Cyclin-Dependent protein Kinase (CDK) that is
          functionally equivalent to mammalian CDK9. It
          associates with the cyclin BUR2. BUR genes were
          orginally identified in a genetic screen as factors
          involved in general transcription. The BUR1/BUR2
          complex phosphorylates the C-terminal domain of RNA
          polymerase II. In addition, this complex regulates
          histone modification by phosporylating Rad6 and
          mediating the association of the Paf1 complex with
          chromatin.
          Length = 311

 Score = 28.1 bits (63), Expect = 0.82
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 12/45 (26%)

Query: 38 RDGRRVALKKLPNVFQSLVSSKR------VFRELKMLCFFKHDNV 76
          + GR VALKK+      L+ +++        RE+K+L   KH NV
Sbjct: 31 KTGRVVALKKI------LMHNEKDGFPITALREIKILKKLKHPNV 69


>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. 
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 2 (CDKL2) and CDKL3 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL2 and CDKL3
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKL2, also called p56 KKIAMRE, is expressed
          in testis, kidney, lung, and brain. It functions mainly
          in mature neurons and plays an important role in
          learning and memory. Inactivation of CDKL3, also called
          NKIAMRE (NKIATRE in rat), by translocation is
          associated with mild mental retardation. It has been
          reported that CDKL3 is lost in leukemic cells having a
          chromosome arm 5q deletion, and may contribute to the
          transformed phenotype.
          Length = 286

 Score = 27.7 bits (62), Expect = 1.2
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 40 GRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          G+ VA+KK        +  K   RE++ML   +H+N+
Sbjct: 26 GQIVAIKKFLESEDDKMVKKIAMREIRMLKQLRHENL 62


>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 9-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK9-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK9 and CDK12
          from higher eukaryotes, yeast BUR1, C-type plant CDKs
          (CdkC), and similar proteins. CDK9, BUR1, and CdkC are
          functionally equivalent. They act as a kinase for the
          C-terminal domain of RNA polymerase II and participate
          in regulating mutliple steps of gene expression
          including transcription elongation and RNA processing.
          CDK9 and CdkC associate with T-type cyclins while BUR1
          associates with the cyclin BUR2. CDK12 is a unique CDK
          that contains an arginine/serine-rich (RS) domain,
          which is predominantly found in splicing factors. CDK12
          interacts with cyclins L1 and L2, and participates in
          regulating transcription and alternative splicing.
          Length = 287

 Score = 27.5 bits (62), Expect = 1.2
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 10/44 (22%)

Query: 38 RDGRRVALKKLPNVFQSLVSSKRVF-----RELKMLCFFKHDNV 76
          + G  VALKK+      + + K  F     RE+K+L   +H N+
Sbjct: 22 KTGELVALKKIR-----MENEKEGFPITAIREIKLLQKLRHPNI 60


>gnl|CDD|240636 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid
           dehydrogenases.  2-Hydroxyacid dehydrogenases catalyze
           the conversion of a wide variety of D-2-hydroxy acids to
           their corresponding keto acids. The general mechanism is
           (R)-lactate + acceptor to pyruvate + reduced acceptor.
           Formate/glycerate and related dehydrogenases of the
           D-specific 2-hydroxyacid dehydrogenase superfamily
           include groups such as formate dehydrogenase, glycerate
           dehydrogenase, L-alanine dehydrogenase, and
           S-adenosylhomocysteine hydrolase. Despite often low
           sequence identity, these proteins typically have a
           characteristic arrangement of 2 similar subdomains of
           the alpha/beta Rossmann fold NAD+ binding form. The NAD+
           binding domain is inserted within the linear sequence of
           the mostly N-terminal catalytic domain, which has a
           similar domain structure to the internal NAD binding
           domain. Structurally, these domains are connected by
           extended alpha helices and create a cleft in which NAD
           is bound, primarily to the C-terminal portion of the 2nd
           (internal) domain. Some related proteins have similar
           structural subdomain but with a tandem arrangement of
           the catalytic and NAD-binding subdomains in the linear
           sequence. While many members of this family are dimeric,
           alanine DH is hexameric and phosphoglycerate DH is
           tetrameric.
          Length = 303

 Score = 26.8 bits (60), Expect = 2.7
 Identities = 11/34 (32%), Positives = 14/34 (41%), Gaps = 1/34 (2%)

Query: 74  DNVSITQHTPYTTRRMYPGLTLRLGEVHVRRWTK 107
            N  IT H   T   + P L  R+ E  VR +  
Sbjct: 257 PNALITPHVANTPEVIRPLLAERVAEN-VRAFAA 289


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. 
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 1 (CDKL1) and CDKL4 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL1 and CDKL4
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKL1, also called p42 KKIALRE, is a glial
          protein that is upregulated in gliosis. It is present
          in neuroblastoma and A431 human carcinoma cells, and
          may be implicated in neoplastic transformation. The
          function of CDKL4 is unknown.
          Length = 286

 Score = 26.2 bits (58), Expect = 3.6
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query: 40 GRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDN 75
          G+ VA+KK        V  K   RE++ML   KH N
Sbjct: 26 GQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHPN 61


>gnl|CDD|236761 PRK10795, PRK10795, penicillin-binding protein 2; Provisional.
          Length = 634

 Score = 26.3 bits (58), Expect = 4.7
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 4/30 (13%)

Query: 34  VTDPRDGRRVALKKL----PNVFQSLVSSK 59
           VTDPR G  +AL       PN+F   +SSK
Sbjct: 276 VTDPRTGGILALVSTPSYDPNLFVDGISSK 305


>gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional.
          Length = 1465

 Score = 26.0 bits (57), Expect = 5.5
 Identities = 9/15 (60%), Positives = 12/15 (80%)

Query: 94  TLRLGEVHVRRWTKD 108
           TLR+ E+ +RRWT D
Sbjct: 909 TLRITELPIRRWTDD 923


>gnl|CDD|217478 pfam03294, Pox_Rap94, RNA polymerase-associated transcription
           specificity factor, Rap94. 
          Length = 796

 Score = 25.8 bits (57), Expect = 5.5
 Identities = 8/19 (42%), Positives = 11/19 (57%)

Query: 50  NVFQSLVSSKRVFRELKML 68
           N+F   VSS  +F   K+L
Sbjct: 471 NLFDIHVSSTELFYSSKIL 489


>gnl|CDD|181087 PRK07701, flgL, flagellar hook-associated protein FlgL;
          Validated.
          Length = 298

 Score = 25.7 bits (57), Expect = 6.2
 Identities = 6/12 (50%), Positives = 10/12 (83%)

Query: 1  MASGKTFSRPSD 12
          +++GK  +RPSD
Sbjct: 30 LSTGKKITRPSD 41


>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
          Protein Tyrosine Kinase (PTK) family, catalytic domain.
          This PTKc family is part of a larger superfamily that
          includes the catalytic domains of protein
          serine/threonine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. They can
          be classified into receptor and non-receptor tyr
          kinases. PTKs play important roles in many cellular
          processes including, lymphocyte activation, epithelium
          growth and maintenance, metabolism control,
          organogenesis regulation, survival, proliferation,
          differentiation, migration, adhesion, motility, and
          morphogenesis. Receptor tyr kinases (RTKs) are integral
          membrane proteins which contain an extracellular
          ligand-binding region, a transmembrane segment, and an
          intracellular tyr kinase domain. RTKs are usually
          activated through ligand binding, which causes
          dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain, leading to
          intracellular signaling. Some RTKs are orphan receptors
          with no known ligands. Non-receptor (or cytoplasmic)
          tyr kinases are distributed in different intracellular
          compartments and are usually multi-domain proteins
          containing a catalytic tyr kinase domain as well as
          various regulatory domains such as SH3 and SH2. PTKs
          are usually autoinhibited and require a mechanism for
          activation. In many PTKs, the phosphorylation of tyr
          residues in the activation loop is essential for
          optimal activity. Aberrant expression of PTKs is
          associated with many development abnormalities and
          cancers.
          Length = 262

 Score = 25.6 bits (57), Expect = 6.2
 Identities = 9/38 (23%), Positives = 15/38 (39%), Gaps = 5/38 (13%)

Query: 41 RRVALKKLPNVFQSLVSSKRV--FRELKMLCFFKHDNV 76
            VA+K L          +R    +E +++    H NV
Sbjct: 24 TEVAVKTLKE---DASEEERKDFLKEARVMKKLGHPNV 58


>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional.
          Length = 335

 Score = 25.5 bits (56), Expect = 6.4
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 12/53 (22%)

Query: 36 DPRDGRRVALKKLPNV-FQSLVSSKR-----------VFRELKMLCFFKHDNV 76
          D   G+ VA+KK+  +   + V+  R             RELK++   KH+N+
Sbjct: 30 DTLTGKIVAIKKVKIIEISNDVTKDRQLVGMCGIHFTTLRELKIMNEIKHENI 82


>gnl|CDD|239128 cd02663, Peptidase_C19G, A subfamily of Peptidase C19. Peptidase
           C19 contains ubiquitinyl hydrolases. They are
           intracellular peptidases that remove ubiquitin molecules
           from polyubiquinated peptides by cleavage of isopeptide
           bonds. They hydrolyze bonds involving the carboxyl group
           of the C-terminal Gly residue of ubiquitin. The purpose
           of the de-ubiquitination is thought to be editing of the
           ubiquitin conjugates, which could rescue them from
           degradation, as well as recycling of the ubiquitin. The
           ubiquitin/proteasome system is responsible for most
           protein turnover in the mammalian cell, and with over 50
           members, family C19 is one of the largest families of
           peptidases in the human genome.
          Length = 300

 Score = 25.3 bits (56), Expect = 7.5
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 14/57 (24%)

Query: 41  RRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNVSITQHTPYTTRRMYPGLTLRL 97
           +R+ +KKLP +    +  KR          FK+D   + ++     R ++P L LRL
Sbjct: 181 KRMKIKKLPKIL--ALHLKR----------FKYDE-QLNRYIKLFYRVVFP-LELRL 223


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
          Phosphotransferases. Tyrosine-specific kinase
          subfamily.
          Length = 257

 Score = 25.2 bits (56), Expect = 8.5
 Identities = 10/34 (29%), Positives = 15/34 (44%), Gaps = 1/34 (2%)

Query: 43 VALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          VA+K L     S    +   RE +++    H NV
Sbjct: 31 VAVKTLKED-ASEQQIEEFLREARIMRKLDHPNV 63


>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
          Phosphotransferases. The specificity of this class of
          kinases can not be predicted. Possible dual-specificity
          Ser/Thr/Tyr kinase.
          Length = 258

 Score = 25.2 bits (56), Expect = 8.7
 Identities = 9/34 (26%), Positives = 15/34 (44%), Gaps = 1/34 (2%)

Query: 43 VALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          VA+K L     S    +   RE +++    H N+
Sbjct: 31 VAVKTLKED-ASEQQIEEFLREARIMRKLDHPNI 63


>gnl|CDD|237829 PRK14834, PRK14834, undecaprenyl pyrophosphate synthase;
           Provisional.
          Length = 249

 Score = 25.1 bits (55), Expect = 8.8
 Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 4/41 (9%)

Query: 3   SGKTFSRPSDEIGTMMHDEVGLLSICSSVKAVTDPRDGRRV 43
           S + +SRP+ E+  +     GLL +          R+G RV
Sbjct: 68  SSENWSRPASEVSDLF----GLLRLFIRRDLAELHRNGVRV 104


>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase Like 5.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 5 (CDKL5) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. Mutations in the gene encoding CDKL5,
          previously called STK9, are associated with early onset
          epilepsy and severe mental retardation [X-linked
          infantile spasm syndrome (ISSX) or West syndrome]. In
          addition, CDKL5 mutations also sometimes cause a
          phenotype similar to Rett syndrome (RTT), a progressive
          neurodevelopmental disorder. These pathogenic mutations
          are located in the N-terminal portion of the protein
          within the kinase domain.
          Length = 287

 Score = 25.3 bits (55), Expect = 9.2
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 43 VALKKLPNVFQSLVSSKRVFRELKMLCFFKHDNV 76
          VA+KK  +  ++    +   RELKML   K +N+
Sbjct: 29 VAIKKFKDSEENEEVKETTLRELKMLRTLKQENI 62


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.322    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0807    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,564,623
Number of extensions: 451474
Number of successful extensions: 374
Number of sequences better than 10.0: 1
Number of HSP's gapped: 367
Number of HSP's successfully gapped: 56
Length of query: 112
Length of database: 10,937,602
Length adjustment: 76
Effective length of query: 36
Effective length of database: 7,566,698
Effective search space: 272401128
Effective search space used: 272401128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (24.0 bits)