Diaphorina citri psyllid: psy16905


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MKYLERVIKESLRLFPSVPFIGRVLSEDTQFGQYLVPAGTYINVEIFHVHRCPDQFPEPNSFNPDNKR
ccHHHHHHHHHHccccccccCEEECcccEEEccEECccccEEEEEEHHHccccccccccccccccccc
MKYLERVIKESLRLFPSVPFIGRVLSEDTQFGQYLVPAGTYINVEIFHVHRCPDQFPEPNSFNPDNKR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYLERVIKESLRLFPSVPFIGRVLSEDTQFGQYLVPAGTYINVEIFHVHRCPDQFPEPNSFNPDNKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable cytochrome P450 4d14 May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.confidentO46051

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070989 [BP]oxidative demethylationprobableGO:0070988, GO:0044710, GO:0008150, GO:0008152, GO:0055114
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0006694 [BP]steroid biosynthetic processprobableGO:1901576, GO:0044710, GO:0006629, GO:0044238, GO:0071704, GO:0009058, GO:0008150, GO:0008202, GO:0008152, GO:1901362, GO:1901360, GO:0008610
GO:0044255 [BP]cellular lipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0009820 [BP]alkaloid metabolic processprobableGO:0008150, GO:0071704, GO:0006807, GO:1901564, GO:0008152
GO:0006066 [BP]alcohol metabolic processprobableGO:0044710, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:1901615
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0016709 [MF]oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygenprobableGO:0003824, GO:0004497, GO:0016705, GO:0003674, GO:0016491
GO:0034754 [BP]cellular hormone metabolic processprobableGO:0042445, GO:0009987, GO:0044237, GO:0010817, GO:0008150, GO:0008152, GO:0065007, GO:0065008
GO:0042343 [BP]indole glucosinolate metabolic processprobableGO:0019757, GO:0034641, GO:0006807, GO:0044281, GO:1901360, GO:0044710, GO:0071704, GO:0009987, GO:0019760, GO:0019748, GO:0006725, GO:0016143, GO:0008150, GO:0008152, GO:0043436, GO:0042430, GO:0046483, GO:1901564, GO:0006082, GO:1901135, GO:0044237, GO:1901657, GO:0006790
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042446 [BP]hormone biosynthetic processprobableGO:0042445, GO:0010817, GO:0009058, GO:0008150, GO:0008152, GO:0065007, GO:0065008
GO:0008395 [MF]steroid hydroxylase activityprobableGO:0003824, GO:0004497, GO:0003674, GO:0016491
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016713 [MF]oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygenprobableGO:0003824, GO:0004497, GO:0016705, GO:0003674, GO:0016491
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0031967 [CC]organelle envelopeprobableGO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:1901575 [BP]organic substance catabolic processprobableGO:0008150, GO:0071704, GO:0009056, GO:0008152
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237
GO:0044249 [BP]cellular biosynthetic processprobableGO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0017144 [BP]drug metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K9V, chain A
Confidence level:very confident
Coverage over the Query: 1-68
View the alignment between query and template
View the model in PyMOL