Query         psy16910
Match_columns 82
No_of_seqs    109 out of 857
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:48:57 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16910.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16910hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd05172 PIKKc_DNA-PK DNA-depen 100.0   2E-33 4.4E-38  200.7   3.0   75    2-76    130-204 (235)
  2 cd05169 PIKKc_TOR TOR (Target  100.0 9.8E-33 2.1E-37  200.1   2.5   73    3-75    176-248 (280)
  3 cd05163 TRRAP TRansformation/t 100.0 5.6E-32 1.2E-36  195.0   1.9   74    3-76    149-222 (253)
  4 cd05171 PIKKc_ATM Ataxia telan 100.0 6.6E-32 1.4E-36  196.5   1.0   73    3-76    176-248 (279)
  5 cd05170 PIKKc_SMG1 Suppressor  100.0 1.6E-31 3.5E-36  196.8   2.5   73    2-75    203-275 (307)
  6 cd00892 PIKKc_ATR ATR (Ataxia  100.0 3.5E-31 7.6E-36  189.3   1.3   72    3-75    134-205 (237)
  7 cd05164 PIKKc Phosphoinositide 100.0 5.6E-31 1.2E-35  186.6   1.5   73    3-76    126-198 (222)
  8 cd00142 PI3Kc_like Phosphoinos 100.0 3.5E-30 7.5E-35  181.5   1.4   72    3-75    123-194 (219)
  9 smart00146 PI3Kc Phosphoinosit 100.0 5.1E-30 1.1E-34  178.6   1.4   72    3-75     96-167 (202)
 10 cd05168 PI4Kc_III_beta Phospho  99.9 5.3E-29 1.2E-33  183.3   1.7   70    3-74    136-207 (293)
 11 cd00893 PI4Kc_III Phosphoinosi  99.9 4.6E-29   1E-33  183.3   0.2   71    3-74    134-206 (289)
 12 KOG0890|consensus               99.9 1.7E-28 3.6E-33  210.4   0.6   76    4-80   2215-2291(2382)
 13 cd05165 PI3Kc_I Phosphoinositi  99.9 4.4E-28 9.6E-33  182.8   1.7   71    3-74    207-284 (366)
 14 cd00891 PI3Kc Phosphoinositide  99.9 6.3E-28 1.4E-32  181.0   1.8   71    3-74    198-271 (352)
 15 KOG0892|consensus               99.9 5.1E-28 1.1E-32  208.7   0.2   76    2-78   2619-2695(2806)
 16 cd05167 PI4Kc_III_alpha Phosph  99.9 9.6E-28 2.1E-32  177.9   0.4   70    3-73    155-224 (311)
 17 cd00894 PI3Kc_IB_gamma Phospho  99.9 7.4E-27 1.6E-31  176.2   4.2   66    3-69    207-273 (365)
 18 cd00896 PI3Kc_III Phosphoinosi  99.9 3.9E-27 8.4E-32  176.7   1.4   67    3-74    197-265 (350)
 19 PF00454 PI3_PI4_kinase:  Phosp  99.9 7.8E-28 1.7E-32  168.4  -3.5   73    3-77    129-205 (235)
 20 COG5032 TEL1 Phosphatidylinosi  99.9 4.6E-27   1E-31  203.1  -1.1   78    3-80   1937-2015(2105)
 21 cd05173 PI3Kc_IA_beta Phosphoi  99.9 1.6E-26 3.5E-31  174.2   1.4   71    3-74    203-279 (362)
 22 cd05174 PI3Kc_IA_delta Phospho  99.9 6.2E-26 1.3E-30  171.0   3.6   62    3-65    203-265 (361)
 23 cd05166 PI3Kc_II Phosphoinosit  99.9 1.3E-25 2.8E-30  168.7   3.4   70    3-73    197-271 (353)
 24 cd05175 PI3Kc_IA_alpha Phospho  99.9 2.1E-25 4.5E-30  168.4   3.7   62    3-65    206-268 (366)
 25 cd05176 PI3Kc_C2_alpha Phospho  99.9 4.4E-25 9.4E-30  166.0   4.7   64    3-67    197-261 (353)
 26 cd05177 PI3Kc_C2_gamma Phospho  99.9   3E-25 6.5E-30  166.9   3.7   67    3-70    198-267 (354)
 27 cd00895 PI3Kc_C2_beta Phosphoi  99.9 3.4E-24 7.4E-29  161.3   3.7   62    4-66    199-261 (354)
 28 KOG0904|consensus               99.8 2.1E-20 4.6E-25  152.0   3.6   64    4-68    919-983 (1076)
 29 KOG0903|consensus               99.8   4E-19 8.7E-24  142.9   3.4   64    4-69    691-754 (847)
 30 KOG0906|consensus               99.7 1.8E-18 3.9E-23  138.1   6.0   63    3-70    689-751 (843)
 31 KOG0891|consensus               99.6   4E-18 8.6E-23  148.5  -3.9   72    3-74   2133-2204(2341)
 32 KOG0902|consensus               99.6 7.2E-16 1.6E-20  130.1   4.0   62    4-67   1648-1709(1803)
 33 KOG0905|consensus               99.6 7.7E-16 1.7E-20  128.5   3.8   63    4-67   1192-1255(1639)
 34 PTZ00303 phosphatidylinositol   99.5 1.7E-14 3.8E-19  117.6   2.9   63    3-67   1140-1202(1374)
 35 KOG0889|consensus               98.9 1.1E-10 2.4E-15  104.5  -2.0   74    3-76   3378-3451(3550)
 36 cd05145 RIO1_like RIO kinase f  92.6    0.11 2.4E-06   35.0   2.5   25   13-39    142-166 (190)
 37 cd05147 RIO1_euk RIO kinase fa  92.4    0.13 2.7E-06   35.2   2.6   26   13-40    142-167 (190)
 38 cd05151 ChoK Choline Kinase (C  91.4    0.23   5E-06   31.9   2.9   27   10-38    109-135 (170)
 39 cd05144 RIO2_C RIO kinase fami  91.1    0.26 5.7E-06   33.1   3.1   29   13-42    149-177 (198)
 40 COG0661 AarF Predicted unusual  91.0     0.2 4.3E-06   40.0   2.7   23   13-36    289-311 (517)
 41 TIGR03724 arch_bud32 Kae1-asso  90.7    0.26 5.7E-06   32.7   2.7   23   13-37    114-136 (199)
 42 PRK04750 ubiB putative ubiquin  89.7    0.28   6E-06   39.3   2.5   24   13-37    284-311 (537)
 43 TIGR01982 UbiB 2-polyprenylphe  89.4    0.32   7E-06   37.5   2.6   24   13-37    281-304 (437)
 44 cd05119 RIO RIO kinase family,  89.4    0.37   8E-06   31.6   2.6   27   13-41    139-165 (187)
 45 TIGR03843 conserved hypothetic  89.2    0.57 1.2E-05   34.6   3.6   37    6-43    141-177 (253)
 46 PRK14879 serine/threonine prot  89.0    0.45 9.8E-06   31.8   2.8   23   13-37    119-141 (211)
 47 PF01636 APH:  Phosphotransfera  88.9    0.43 9.3E-06   31.5   2.7   31    7-37    165-195 (239)
 48 cd05156 ChoK_euk Choline Kinas  88.5    0.62 1.3E-05   33.2   3.4   32    6-37    177-211 (302)
 49 PRK10359 lipopolysaccharide co  87.8    0.45 9.7E-06   34.3   2.3   22   13-36    159-180 (232)
 50 KOG0616|consensus               87.2    0.43 9.3E-06   36.6   2.0   24   13-37    168-191 (355)
 51 smart00090 RIO RIO-like kinase  86.4    0.66 1.4E-05   32.8   2.5   26   13-40    173-198 (237)
 52 PRK01723 3-deoxy-D-manno-octul  86.1    0.73 1.6E-05   32.6   2.6   24   13-37    166-189 (239)
 53 PF01633 Choline_kinase:  Choli  84.7    0.63 1.4E-05   31.7   1.7   30    8-37    143-172 (211)
 54 cd05120 APH_ChoK_like Aminogly  84.5     1.2 2.7E-05   26.8   2.8   24   13-37    113-136 (155)
 55 PLN02421 phosphotransferase, a  84.4     1.4 3.1E-05   32.5   3.6   35    7-41    181-215 (330)
 56 KOG0608|consensus               83.4     0.9 1.9E-05   38.4   2.3   24   13-37    753-776 (1034)
 57 cd05157 ETNK_euk Ethanolamine   83.2     2.2 4.7E-05   29.1   3.9   32    7-38    169-200 (235)
 58 KOG0984|consensus               82.5     1.1 2.3E-05   33.2   2.2   23   14-37    174-196 (282)
 59 cd05154 ACAD10_11_like Acyl-Co  82.0     1.5 3.3E-05   28.9   2.7   31    7-37    173-204 (223)
 60 cd05153 HomoserineK_II Homoser  81.8     1.3 2.8E-05   31.3   2.4   29    8-37    175-203 (296)
 61 KOG0598|consensus               81.2    0.85 1.8E-05   35.2   1.3   24   13-37    149-172 (357)
 62 PRK12274 serine/threonine prot  81.1     1.6 3.5E-05   31.4   2.6   25   13-38    115-140 (218)
 63 PF06176 WaaY:  Lipopolysacchar  79.8     1.9 4.1E-05   31.3   2.7   22   12-35    158-179 (229)
 64 PF01163 RIO1:  RIO1 family;  I  78.6     2.7 5.8E-05   29.1   3.1   42   13-62    131-172 (188)
 65 KOG0658|consensus               78.0     1.7 3.7E-05   33.6   2.1   25   13-37    149-173 (364)
 66 cd05122 PKc_STE Catalytic doma  77.9       3 6.6E-05   27.4   3.1   31   10-41    119-149 (253)
 67 TIGR02172 Fb_sc_TIGR02172 Fibr  77.7     2.2 4.7E-05   30.0   2.4   25   11-37    156-180 (226)
 68 KOG0594|consensus               76.9     1.9 4.1E-05   32.8   2.1   27   13-40    144-170 (323)
 69 PLN02236 choline kinase         76.2       4 8.8E-05   30.4   3.6   32    7-38    199-230 (344)
 70 PRK10271 thiK thiamine kinase;  76.1     3.2 6.9E-05   29.1   2.9   34    6-41     75-108 (188)
 71 cd05587 STKc_cPKC Catalytic do  75.9     1.7 3.8E-05   31.0   1.6   24   13-37    125-148 (324)
 72 COG3642 Mn2+-dependent serine/  75.2     3.3 7.2E-05   29.7   2.8   26   13-40    116-141 (204)
 73 cd05594 STKc_PKB_alpha Catalyt  74.9     2.7 5.8E-05   30.0   2.3   24   13-37    120-143 (325)
 74 PF01386 Ribosomal_L25p:  Ribos  74.6     3.8 8.2E-05   25.0   2.7   15   20-34     74-88  (88)
 75 PRK05231 homoserine kinase; Pr  74.5     3.5 7.5E-05   29.6   2.8   26   10-37    189-215 (319)
 76 cd05155 APH_ChoK_like_1 Unchar  74.3     3.9 8.4E-05   28.2   3.0   29    7-37    163-192 (235)
 77 KOG0603|consensus               74.2     2.8   6E-05   34.5   2.4   29   12-40    438-466 (612)
 78 cd07862 STKc_CDK6 Catalytic do  73.9       2 4.2E-05   29.7   1.4   25   13-38    134-158 (290)
 79 KOG0983|consensus               73.7     2.8   6E-05   32.3   2.2   24   13-37    216-239 (391)
 80 KOG1006|consensus               73.7     2.6 5.7E-05   32.2   2.1   23   14-37    193-215 (361)
 81 PF00069 Pkinase:  Protein kina  73.4     2.8 6.1E-05   28.1   2.0   25   13-38    122-146 (260)
 82 cd05627 STKc_NDR2 Catalytic do  73.1     2.1 4.6E-05   31.1   1.4   25   13-38    125-149 (360)
 83 PRK09188 serine/threonine prot  73.1     3.4 7.4E-05   31.5   2.6   25   13-38    135-160 (365)
 84 PTZ00426 cAMP-dependent protei  73.1       2 4.4E-05   31.3   1.3   25   13-38    155-179 (340)
 85 PRK09605 bifunctional UGMP fam  72.7     2.6 5.6E-05   33.0   1.9   23   13-37    452-474 (535)
 86 KOG0592|consensus               72.6     2.7 5.9E-05   34.4   2.0   23   14-37    199-221 (604)
 87 cd05590 STKc_nPKC_eta Catalyti  72.4     2.2 4.8E-05   30.5   1.4   24   13-37    120-143 (320)
 88 TIGR00938 thrB_alt homoserine   72.0     4.4 9.4E-05   29.1   2.8   29    8-37    187-215 (307)
 89 cd05616 STKc_cPKC_beta Catalyt  71.7     2.1 4.6E-05   30.5   1.2   25   13-38    125-149 (323)
 90 cd05585 STKc_YPK1_like Catalyt  71.6     2.6 5.5E-05   29.9   1.6   24   13-37    117-140 (312)
 91 KOG0610|consensus               71.4     3.4 7.5E-05   32.8   2.3   32    9-41    197-230 (459)
 92 cd06640 STKc_MST4 Catalytic do  71.4     3.2   7E-05   28.6   2.0   26   12-38    124-149 (277)
 93 cd05598 STKc_LATS Catalytic do  71.3     2.5 5.4E-05   30.8   1.5   24   13-37    125-148 (376)
 94 cd05601 STKc_CRIK Catalytic do  71.2     2.5 5.4E-05   30.1   1.4   25   13-38    126-150 (330)
 95 cd05603 STKc_SGK2 Catalytic do  70.9     2.2 4.8E-05   30.3   1.1   24   13-37    120-143 (321)
 96 cd07871 STKc_PCTAIRE3 Catalyti  70.8     2.3   5E-05   29.7   1.2   26   13-39    127-152 (288)
 97 cd05609 STKc_MAST Catalytic do  70.6     3.2 6.8E-05   29.2   1.8   25   12-37    124-148 (305)
 98 cd00180 PKc Catalytic domain o  70.3     4.2 9.1E-05   25.5   2.2   29   12-40    115-143 (215)
 99 cd05614 STKc_MSK2_N N-terminal  70.1     2.7 5.8E-05   30.0   1.4   24   13-37    129-152 (332)
100 cd05571 STKc_PKB Catalytic dom  70.1     2.9 6.2E-05   29.9   1.5   24   13-37    119-142 (323)
101 cd05575 STKc_SGK Catalytic dom  69.9     2.6 5.7E-05   30.0   1.3   25   13-38    120-144 (323)
102 cd05118 STKc_CMGC Catalytic do  69.9     3.6 7.8E-05   28.0   1.9   29   12-41    121-149 (283)
103 cd05591 STKc_nPKC_epsilon Cata  69.8     2.9 6.3E-05   29.8   1.5   25   13-38    120-144 (321)
104 cd05146 RIO3_euk RIO kinase fa  69.7     4.4 9.5E-05   28.4   2.4   27   13-41    149-175 (197)
105 cd05602 STKc_SGK1 Catalytic do  69.7     2.4 5.2E-05   30.2   1.1   24   13-37    120-143 (325)
106 PHA02882 putative serine/threo  69.5     3.6 7.9E-05   28.9   2.0   24   13-37    150-173 (294)
107 cd05600 STKc_Sid2p_Dbf2p Catal  69.4     2.9 6.3E-05   29.8   1.5   25   13-38    125-149 (333)
108 KOG0612|consensus               69.3     6.2 0.00014   35.0   3.6   56   14-70    200-259 (1317)
109 PF06293 Kdo:  Lipopolysacchari  69.2     5.2 0.00011   27.4   2.6   23   13-36    142-167 (206)
110 cd05068 PTKc_Frk_like Catalyti  69.1     4.5 9.7E-05   27.5   2.3   26   13-39    127-152 (261)
111 cd05581 STKc_PDK1 Catalytic do  69.1     2.6 5.6E-05   28.6   1.1   28   12-40    125-152 (280)
112 cd05042 PTKc_Aatyk Catalytic d  69.1     3.3 7.3E-05   28.2   1.7   26   13-39    124-149 (269)
113 cd05612 STKc_PRKX_like Catalyt  69.1     3.2   7E-05   29.0   1.6   25   13-38    125-149 (291)
114 cd05604 STKc_SGK3 Catalytic do  69.1     2.9 6.3E-05   29.8   1.4   24   13-37    120-143 (325)
115 cd05628 STKc_NDR1 Catalytic do  69.1       3 6.4E-05   30.4   1.5   24   13-37    125-148 (363)
116 cd05085 PTKc_Fer Catalytic dom  68.9     3.5 7.7E-05   27.6   1.7   25   13-38    117-141 (250)
117 cd05034 PTKc_Src_like Catalyti  68.4     3.9 8.5E-05   27.6   1.9   27   12-39    126-152 (261)
118 KOG1235|consensus               68.3     5.3 0.00012   32.3   2.8   25   13-37    325-352 (538)
119 cd06642 STKc_STK25-YSK1 Cataly  68.0     4.8  0.0001   27.6   2.3   24   13-37    125-148 (277)
120 cd05592 STKc_nPKC_theta_delta   67.9     2.8 6.2E-05   29.9   1.2   24   13-37    120-143 (316)
121 cd08223 STKc_Nek4 Catalytic do  67.7     5.9 0.00013   26.6   2.6   25   12-37    125-149 (257)
122 cd05150 APH Aminoglycoside 3'-  67.7     6.3 0.00014   27.1   2.8   30    7-37    162-191 (244)
123 cd06625 STKc_MEKK3_like Cataly  67.6     4.3 9.4E-05   27.3   2.0   24   13-37    128-151 (263)
124 PTZ00263 protein kinase A cata  67.6     3.4 7.4E-05   29.6   1.5   27   12-39    141-167 (329)
125 KOG0198|consensus               67.5     6.7 0.00015   29.5   3.1   45   14-58    142-186 (313)
126 cd05573 STKc_ROCK_NDR_like Cat  67.5     3.1 6.7E-05   29.7   1.3   25   13-38    125-149 (350)
127 cd05033 PTKc_EphR Catalytic do  67.4     4.2   9E-05   27.7   1.9   27   13-40    130-156 (266)
128 cd05621 STKc_ROCK2 Catalytic d  67.1     3.7 8.1E-05   30.3   1.7   27   13-40    166-192 (370)
129 cd05083 PTKc_Chk Catalytic dom  67.0     4.4 9.5E-05   27.4   1.9   27   12-39    123-149 (254)
130 cd07872 STKc_PCTAIRE2 Catalyti  67.0     3.1 6.8E-05   29.2   1.2   25   13-38    128-152 (309)
131 cd05039 PTKc_Csk_like Catalyti  66.9     7.3 0.00016   26.2   3.0   27   13-40    126-152 (256)
132 KOG2345|consensus               66.8     5.4 0.00012   30.1   2.5   24   13-37    153-176 (302)
133 cd06613 STKc_MAP4K3_like Catal  66.8     4.5 9.8E-05   27.2   1.9   26   12-38    124-149 (262)
134 cd05626 STKc_LATS2 Catalytic d  66.7     3.5 7.6E-05   30.3   1.5   24   13-37    125-148 (381)
135 cd05593 STKc_PKB_gamma Catalyt  66.7     3.3 7.2E-05   29.8   1.3   24   13-37    119-142 (328)
136 cd05617 STKc_aPKC_zeta Catalyt  66.6       4 8.6E-05   29.3   1.7   25   13-38    120-144 (327)
137 cd05586 STKc_Sck1_like Catalyt  66.6     3.3 7.2E-05   29.5   1.3   24   13-37    120-143 (330)
138 cd07837 STKc_CdkB_plant Cataly  66.6       5 0.00011   27.6   2.2   25   13-37    134-158 (295)
139 PRK15123 lipopolysaccharide co  66.3       6 0.00013   28.8   2.6   25   13-37    162-192 (268)
140 cd07874 STKc_JNK3 Catalytic do  66.2     4.1 8.9E-05   29.4   1.7   26   13-39    143-168 (355)
141 cd05625 STKc_LATS1 Catalytic d  66.0     3.8 8.2E-05   30.0   1.5   24   13-37    125-148 (382)
142 cd08219 STKc_Nek3 Catalytic do  65.9     5.5 0.00012   26.8   2.2   26   13-39    124-149 (255)
143 cd07838 STKc_CDK4_6_like Catal  65.7     7.8 0.00017   26.4   3.0   27   12-39    130-156 (287)
144 cd05596 STKc_ROCK Catalytic do  65.6     4.5 9.7E-05   29.7   1.8   27   13-40    166-192 (370)
145 PRK05943 50S ribosomal protein  65.6     4.5 9.7E-05   25.0   1.6   18   18-35     70-92  (94)
146 TIGR02721 ycfN_thiK thiamine k  65.6     6.3 0.00014   27.4   2.5   32    8-41    146-177 (256)
147 cd05069 PTKc_Yes Catalytic dom  65.5     4.9 0.00011   27.3   1.9   25   13-38    126-150 (260)
148 PLN00009 cyclin-dependent kina  65.3     6.9 0.00015   27.1   2.7   26   13-38    126-151 (294)
149 cd07876 STKc_JNK2 Catalytic do  65.2     3.8 8.3E-05   29.6   1.4   25   13-38    147-171 (359)
150 PLN00034 mitogen-activated pro  65.2     3.5 7.6E-05   29.8   1.2   25   13-38    192-216 (353)
151 cd05041 PTKc_Fes_like Catalyti  65.2     5.5 0.00012   26.7   2.1   27   12-39    116-142 (251)
152 cd05624 STKc_MRCK_beta Catalyt  65.1     4.8  0.0001   28.9   1.9   26   13-39    126-151 (331)
153 cd05615 STKc_cPKC_alpha Cataly  65.1     3.9 8.4E-05   29.3   1.4   25   13-38    125-149 (323)
154 cd05102 PTKc_VEGFR3 Catalytic   65.1     6.4 0.00014   28.0   2.5   24   13-37    198-221 (338)
155 cd06656 STKc_PAK3 Catalytic do  64.9     3.5 7.5E-05   29.0   1.1   26   13-39    139-164 (297)
156 cd05574 STKc_phototropin_like   64.9     4.8  0.0001   28.3   1.8   28   12-40    126-153 (316)
157 TIGR02906 spore_CotS spore coa  64.9     8.1 0.00018   27.3   3.0   29    7-37    186-214 (313)
158 cd05096 PTKc_DDR1 Catalytic do  64.8     4.3 9.4E-05   28.4   1.6   24   13-37    162-185 (304)
159 cd07869 STKc_PFTAIRE1 Catalyti  64.8     3.5 7.6E-05   28.9   1.1   25   13-38    127-151 (303)
160 cd05629 STKc_NDR_like_fungal C  64.7     4.3 9.4E-05   29.6   1.6   24   13-37    125-148 (377)
161 smart00219 TyrKc Tyrosine kina  64.6     5.3 0.00011   26.6   1.9   29   12-41    126-154 (258)
162 cd08530 STKc_CNK2-like Catalyt  64.6      16 0.00034   24.3   4.2   28   12-40    126-153 (256)
163 cd05595 STKc_PKB_beta Catalyti  64.5     3.3 7.1E-05   29.6   0.9   25   13-38    119-143 (323)
164 cd07835 STKc_CDK1_like Catalyt  64.3     4.5 9.8E-05   27.7   1.6   26   12-38    122-147 (283)
165 cd05075 PTKc_Axl Catalytic dom  64.3     4.2 9.2E-05   27.6   1.4   25   13-38    136-160 (272)
166 cd05580 STKc_PKA Catalytic dom  64.2     4.4 9.6E-05   28.1   1.5   27   12-39    124-150 (290)
167 PTZ00267 NIMA-related protein   64.2     4.9 0.00011   30.8   1.9   25   13-38    193-217 (478)
168 cd05620 STKc_nPKC_delta Cataly  64.1     3.4 7.4E-05   29.5   0.9   24   13-37    120-143 (316)
169 cd05072 PTKc_Lyn Catalytic dom  64.0     4.5 9.8E-05   27.4   1.5   26   13-39    127-152 (261)
170 cd06650 PKc_MEK1 Catalytic dom  63.8       6 0.00013   28.5   2.2   25   13-38    128-152 (333)
171 cd07875 STKc_JNK1 Catalytic do  63.8     4.5 9.9E-05   29.3   1.6   26   13-39    150-175 (364)
172 cd05040 PTKc_Ack_like Catalyti  63.8       6 0.00013   26.6   2.1   24   13-37    121-144 (257)
173 KOG0605|consensus               63.5     4.5 9.7E-05   32.9   1.6   23   14-37    266-288 (550)
174 cd06649 PKc_MEK2 Catalytic dom  63.5     5.7 0.00012   28.4   2.0   24   13-37    128-151 (331)
175 cd05059 PTKc_Tec_like Catalyti  63.4     4.4 9.6E-05   27.5   1.4   24   13-37    124-147 (256)
176 cd08217 STKc_Nek2 Catalytic do  63.3     5.2 0.00011   26.7   1.7   27   12-39    133-159 (265)
177 cd07853 STKc_NLK Catalytic dom  63.2     5.1 0.00011   29.2   1.7   25   13-38    127-151 (372)
178 cd05066 PTKc_EphR_A Catalytic   63.2     4.3 9.3E-05   27.7   1.3   26   12-38    129-154 (267)
179 cd05599 STKc_NDR_like Catalyti  63.1     4.4 9.6E-05   29.2   1.4   24   13-37    125-148 (364)
180 cd05084 PTKc_Fes Catalytic dom  63.0     5.6 0.00012   26.8   1.8   25   13-38    118-142 (252)
181 cd05584 STKc_p70S6K Catalytic   63.0     4.5 9.8E-05   28.9   1.4   24   13-37    124-147 (323)
182 cd07861 STKc_CDK1_euk Catalyti  62.9     4.3 9.3E-05   27.8   1.2   25   13-38    125-149 (285)
183 cd07878 STKc_p38beta_MAPK11 Ca  62.9     8.6 0.00019   27.5   2.8   26   13-39    142-167 (343)
184 cd05618 STKc_aPKC_iota Catalyt  62.8     4.8  0.0001   28.9   1.5   25   13-38    120-144 (329)
185 cd06606 STKc_MAPKKK Catalytic   62.5      10 0.00022   25.0   3.0   29   12-41    124-152 (260)
186 cd06624 STKc_ASK Catalytic dom  62.5     5.4 0.00012   27.2   1.7   26   13-38    132-157 (268)
187 cd08529 STKc_FA2-like Catalyti  62.5       8 0.00017   25.8   2.5   25   13-38    125-149 (256)
188 cd00495 Ribosomal_L25_TL5_CTC   62.4     4.3 9.4E-05   24.7   1.1   13   23-35     78-90  (91)
189 KOG0593|consensus               62.2     5.1 0.00011   31.1   1.6   24   13-37    125-148 (396)
190 cd05631 STKc_GRK4 Catalytic do  62.2     5.2 0.00011   27.8   1.6   25   13-38    126-150 (285)
191 cd07863 STKc_CDK4 Catalytic do  62.0     4.5 9.8E-05   27.8   1.2   25   13-38    132-156 (288)
192 cd05052 PTKc_Abl Catalytic dom  61.9      11 0.00025   25.5   3.2   28   13-41    128-155 (263)
193 cd06644 STKc_STK10_LOK Catalyt  61.9     6.7 0.00015   27.2   2.1   26   12-38    133-158 (292)
194 cd07873 STKc_PCTAIRE1 Catalyti  61.9     4.2   9E-05   28.4   1.0   25   13-38    128-152 (301)
195 cd05619 STKc_nPKC_theta Cataly  61.7     4.5 9.7E-05   28.9   1.2   25   13-38    120-144 (316)
196 cd06643 STKc_SLK Catalytic dom  61.7     7.3 0.00016   26.8   2.2   24   13-37    127-150 (282)
197 cd05082 PTKc_Csk Catalytic dom  61.7     6.5 0.00014   26.6   1.9   25   13-38    126-150 (256)
198 cd05048 PTKc_Ror Catalytic Dom  61.7     6.8 0.00015   26.8   2.1   25   13-38    148-172 (283)
199 cd08224 STKc_Nek6_Nek7 Catalyt  61.6     6.6 0.00014   26.4   2.0   25   13-38    130-154 (267)
200 cd07832 STKc_CCRK Catalytic do  61.5     6.1 0.00013   27.0   1.8   28   12-40    122-149 (286)
201 cd06608 STKc_myosinIII_like Ca  61.4       5 0.00011   27.0   1.3   25   13-38    137-161 (275)
202 cd07847 STKc_CDKL1_4 Catalytic  61.3     6.1 0.00013   26.9   1.8   26   13-39    124-149 (286)
203 cd05622 STKc_ROCK1 Catalytic d  61.3     6.2 0.00013   29.1   1.9   26   13-39    166-191 (371)
204 cd06622 PKc_MAPKK_PBS2_like Ca  61.3     8.6 0.00019   26.4   2.5   26   13-39    127-152 (286)
205 cd05123 STKc_AGC Catalytic dom  61.1     9.1  0.0002   25.5   2.6   26   12-38    116-141 (250)
206 cd05152 MPH2' Macrolide 2'-Pho  61.0     8.8 0.00019   27.7   2.6   29    8-37    185-214 (276)
207 PLN03225 Serine/threonine-prot  60.9       6 0.00013   31.5   1.9   25   13-37    279-303 (566)
208 PHA03212 serine/threonine kina  60.8       7 0.00015   29.2   2.2   24   13-37    206-229 (391)
209 cd05097 PTKc_DDR_like Catalyti  60.6     6.2 0.00014   27.4   1.8   25   12-37    152-176 (295)
210 cd07840 STKc_CDK9_like Catalyt  60.5     5.4 0.00012   27.1   1.4   28   12-40    123-150 (287)
211 cd05054 PTKc_VEGFR Catalytic d  60.4       9  0.0002   27.7   2.6   24   13-37    197-220 (337)
212 cd05112 PTKc_Itk Catalytic dom  60.2     7.2 0.00016   26.2   2.0   25   13-38    124-148 (256)
213 cd05588 STKc_aPKC Catalytic do  60.1     4.9 0.00011   28.8   1.2   25   13-38    120-144 (329)
214 cd05038 PTKc_Jak_rpt2 Catalyti  59.9     6.8 0.00015   26.6   1.8   26   12-38    132-157 (284)
215 cd05597 STKc_DMPK_like Catalyt  59.7     6.5 0.00014   28.2   1.8   26   13-39    126-151 (331)
216 cd06637 STKc_TNIK Catalytic do  59.7     4.9 0.00011   27.3   1.1   26   13-39    135-160 (272)
217 cd07834 STKc_MAPK Catalytic do  59.6     5.8 0.00013   28.0   1.5   29   12-41    126-154 (330)
218 cd08228 STKc_Nek6 Catalytic do  59.4     6.1 0.00013   26.7   1.5   26   13-39    130-155 (267)
219 PTZ00036 glycogen synthase kin  59.3     6.4 0.00014   29.9   1.7   26   13-38    194-219 (440)
220 cd05063 PTKc_EphR_A2 Catalytic  59.3     6.3 0.00014   26.7   1.6   26   12-38    130-155 (268)
221 cd00192 PTKc Catalytic domain   59.1     8.2 0.00018   25.6   2.1   27   13-40    129-155 (262)
222 cd05111 PTK_HER3 Pseudokinase   59.1       8 0.00017   26.7   2.1   24   13-37    133-156 (279)
223 cd07841 STKc_CDK7 Catalytic do  59.0     8.6 0.00019   26.6   2.2   28   12-40    125-152 (298)
224 cd05044 PTKc_c-ros Catalytic d  58.8     8.3 0.00018   26.1   2.1   24   13-37    130-158 (269)
225 cd08215 STKc_Nek Catalytic dom  58.8     6.9 0.00015   25.9   1.6   28   12-40    126-153 (258)
226 PHA03207 serine/threonine kina  58.7     5.4 0.00012   29.5   1.2   24   13-37    209-232 (392)
227 cd05088 PTKc_Tie2 Catalytic do  58.7     8.2 0.00018   27.1   2.1   25   13-38    148-172 (303)
228 PF05191 ADK_lid:  Adenylate ki  58.7       6 0.00013   20.6   1.0   15   22-36      3-17  (36)
229 cd06655 STKc_PAK2 Catalytic do  58.6       6 0.00013   27.8   1.4   26   12-38    138-163 (296)
230 cd05582 STKc_RSK_N N-terminal   58.5     6.2 0.00013   28.0   1.4   25   13-38    122-146 (318)
231 cd05607 STKc_GRK7 Catalytic do  58.4     9.3  0.0002   26.4   2.3   26   13-39    119-144 (277)
232 cd06623 PKc_MAPKK_plant_like C  58.4     5.7 0.00012   26.6   1.2   27   12-39    123-149 (264)
233 cd06607 STKc_TAO Catalytic dom  58.4      10 0.00022   26.6   2.5   26   12-38    138-163 (307)
234 cd05570 STKc_PKC Catalytic dom  58.3     5.2 0.00011   28.5   1.1   24   13-37    120-143 (318)
235 cd05071 PTKc_Src Catalytic dom  58.1       9  0.0002   26.1   2.2   25   13-38    126-150 (262)
236 cd05116 PTKc_Syk Catalytic dom  58.0     6.7 0.00014   26.6   1.5   25   13-38    119-143 (257)
237 cd05035 PTKc_Axl_like Catalyti  57.8     7.8 0.00017   26.2   1.8   25   13-38    137-161 (273)
238 cd05047 PTKc_Tie Catalytic dom  57.7     8.9 0.00019   26.2   2.1   25   13-38    136-160 (270)
239 cd05583 STKc_MSK_N N-terminal   57.6       7 0.00015   26.9   1.6   24   13-37    129-152 (288)
240 cd05589 STKc_PKN Catalytic dom  57.6     5.4 0.00012   28.4   1.0   25   13-38    125-149 (324)
241 cd05089 PTKc_Tie1 Catalytic do  57.4      10 0.00022   26.4   2.4   25   13-38    143-167 (297)
242 cd05090 PTKc_Ror1 Catalytic do  57.3     8.4 0.00018   26.5   1.9   25   13-38    148-172 (283)
243 cd05578 STKc_Yank1 Catalytic d  57.3      14  0.0003   24.9   3.0   29   12-41    123-151 (258)
244 cd05623 STKc_MRCK_alpha Cataly  57.0     7.1 0.00015   27.9   1.6   25   13-38    126-150 (332)
245 cd05070 PTKc_Fyn_Yrk Catalytic  57.0      11 0.00023   25.6   2.4   26   13-39    126-151 (260)
246 cd07870 STKc_PFTAIRE2 Catalyti  56.9     8.1 0.00018   26.7   1.8   24   13-37    127-150 (291)
247 cd05109 PTKc_HER2 Catalytic do  56.8     8.5 0.00018   26.4   1.9   24   13-37    133-156 (279)
248 KOG3087|consensus               56.6      12 0.00026   27.2   2.7   30   13-42    137-168 (229)
249 cd05079 PTKc_Jak1_rpt2 Catalyt  56.5     7.9 0.00017   26.7   1.7   25   13-38    133-157 (284)
250 cd05062 PTKc_IGF-1R Catalytic   56.5     7.7 0.00017   26.6   1.6   24   13-37    143-166 (277)
251 cd05608 STKc_GRK1 Catalytic do  56.3     7.7 0.00017   26.9   1.6   25   13-38    121-145 (280)
252 cd05579 STKc_MAST_like Catalyt  56.2     8.2 0.00018   25.7   1.7   26   13-39    117-142 (265)
253 KOG0665|consensus               56.2     6.5 0.00014   30.5   1.3   42   10-61    137-180 (369)
254 cd06641 STKc_MST3 Catalytic do  56.0     8.9 0.00019   26.3   1.9   25   12-37    124-148 (277)
255 cd06629 STKc_MAPKKK_Bck1_like   56.0     9.5 0.00021   25.9   2.0   25   13-38    132-156 (272)
256 cd06657 STKc_PAK4 Catalytic do  55.9     6.6 0.00014   27.6   1.2   26   12-38    139-164 (292)
257 cd07859 STKc_TDY_MAPK_plant Ca  55.9     6.4 0.00014   27.7   1.2   25   13-38    127-151 (338)
258 cd06619 PKc_MKK5 Catalytic dom  55.8     7.7 0.00017   26.7   1.6   25   13-38    119-143 (279)
259 cd06605 PKc_MAPKK Catalytic do  55.7     7.9 0.00017   26.1   1.6   25   13-38    125-149 (265)
260 cd07830 STKc_MAK_like Catalyti  55.7      11 0.00025   25.6   2.4   26   12-38    122-147 (283)
261 cd05050 PTKc_Musk Catalytic do  55.7     6.9 0.00015   27.0   1.3   25   13-38    154-178 (288)
262 cd06917 STKc_NAK1_like Catalyt  55.5     8.1 0.00018   26.3   1.6   26   13-39    125-150 (277)
263 cd06638 STKc_myosinIIIA Cataly  55.3     8.4 0.00018   26.4   1.7   26   13-39    148-173 (286)
264 cd05061 PTKc_InsR Catalytic do  55.2     9.4  0.0002   26.4   1.9   24   13-37    143-166 (288)
265 cd05630 STKc_GRK6 Catalytic do  54.8     8.6 0.00019   26.8   1.7   26   13-39    126-151 (285)
266 cd05115 PTKc_Zap-70 Catalytic   54.7     9.5 0.00021   26.0   1.9   24   13-37    119-142 (257)
267 cd05080 PTKc_Tyk2_rpt2 Catalyt  54.7      11 0.00025   25.8   2.3   24   13-37    131-154 (283)
268 cd05633 STKc_GRK3 Catalytic do  54.5      16 0.00034   25.4   3.0   25   13-38    121-145 (279)
269 cd07848 STKc_CDKL5 Catalytic d  54.3     8.3 0.00018   26.5   1.5   26   13-39    124-149 (287)
270 cd07860 STKc_CDK2_3 Catalytic   54.3     8.3 0.00018   26.4   1.5   24   13-37    124-147 (284)
271 KOG0599|consensus               54.2     9.7 0.00021   29.4   1.9   23   14-37    148-170 (411)
272 cd05113 PTKc_Btk_Bmx Catalytic  53.9      10 0.00022   25.8   1.9   24   13-37    124-147 (256)
273 cd05110 PTKc_HER4 Catalytic do  53.9      10 0.00022   26.6   1.9   25   13-38    133-157 (303)
274 cd05101 PTKc_FGFR2 Catalytic d  53.7      10 0.00022   26.4   1.9   25   13-38    161-185 (304)
275 cd06636 STKc_MAP4K4_6 Catalyti  53.5     8.7 0.00019   26.3   1.5   25   13-38    145-169 (282)
276 PF14956 DUF4505:  Domain of un  53.5     9.5 0.00021   26.9   1.7   17   15-31    114-130 (183)
277 cd05086 PTKc_Aatyk2 Catalytic   53.2      12 0.00026   25.6   2.2   25   13-38    123-147 (268)
278 cd07850 STKc_JNK Catalytic dom  53.0     7.5 0.00016   28.0   1.1   26   13-39    142-167 (353)
279 cd05093 PTKc_TrkB Catalytic do  53.0      11 0.00024   26.1   2.0   25   13-38    144-168 (288)
280 cd06612 STKc_MST1_2 Catalytic   52.9      12 0.00027   24.9   2.1   27   12-39    122-148 (256)
281 smart00587 CHK ZnF_C4 abd HLH   52.7      15 0.00033   24.9   2.6   30    8-37    120-153 (196)
282 cd07836 STKc_Pho85 Catalytic d  52.7     8.7 0.00019   26.2   1.4   26   12-38    123-148 (284)
283 cd06616 PKc_MKK4 Catalytic dom  52.2     8.9 0.00019   26.4   1.4   24   13-37    132-155 (288)
284 cd07839 STKc_CDK5 Catalytic do  52.2     7.8 0.00017   26.5   1.1   25   13-38    123-147 (284)
285 cd05067 PTKc_Lck_Blk Catalytic  52.0      10 0.00022   25.7   1.6   25   13-38    126-150 (260)
286 PTZ00283 serine/threonine prot  51.9      11 0.00024   29.3   2.0   24   13-37    167-190 (496)
287 cd05098 PTKc_FGFR1 Catalytic d  51.9     8.5 0.00018   27.0   1.3   24   13-37    164-187 (307)
288 cd06639 STKc_myosinIIIB Cataly  51.9      11 0.00023   26.1   1.7   25   13-38    152-176 (291)
289 cd05092 PTKc_TrkA Catalytic do  51.9      10 0.00022   26.2   1.6   24   13-37    146-169 (280)
290 cd07866 STKc_BUR1 Catalytic do  51.6       8 0.00017   26.7   1.1   26   13-39    139-164 (311)
291 cd06627 STKc_Cdc7_like Catalyt  51.6      11 0.00025   24.9   1.8   29   12-41    122-150 (254)
292 cd06646 STKc_MAP4K5 Catalytic   51.6     9.4  0.0002   25.9   1.4   25   13-38    130-154 (267)
293 cd05095 PTKc_DDR2 Catalytic do  51.5      12 0.00026   26.0   2.0   24   13-37    154-177 (296)
294 cd06628 STKc_MAPKKK_Byr2_like   51.4     8.3 0.00018   26.1   1.1   24   13-37    130-153 (267)
295 cd05045 PTKc_RET Catalytic dom  51.4     9.9 0.00022   26.3   1.5   24   13-37    151-174 (290)
296 cd07855 STKc_ERK5 Catalytic do  51.3     8.7 0.00019   27.4   1.3   26   13-39    131-156 (334)
297 cd05094 PTKc_TrkC Catalytic do  51.1      12 0.00025   26.0   1.9   25   13-38    147-171 (291)
298 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  51.0      10 0.00022   26.0   1.5   25   13-38    132-156 (284)
299 cd06631 STKc_YSK4 Catalytic do  51.0     8.6 0.00019   26.0   1.1   26   12-38    125-150 (265)
300 cd07845 STKc_CDK10 Catalytic d  51.0     9.2  0.0002   26.8   1.3   27   13-40    132-158 (309)
301 cd05056 PTKc_FAK Catalytic dom  50.9      15 0.00032   25.0   2.3   26   12-38    130-155 (270)
302 PF07804 HipA_C:  HipA-like C-t  50.8     4.8 0.00011   23.7  -0.1   31    5-38     48-78  (79)
303 COG0510 ycfN Thiamine kinase a  50.8      21 0.00045   25.9   3.2   33    8-41    153-185 (269)
304 cd05087 PTKc_Aatyk1_Aatyk3 Cat  50.7      12 0.00026   25.5   1.9   24   13-37    124-147 (269)
305 cd07879 STKc_p38delta_MAPK13 C  50.7      10 0.00022   27.2   1.6   26   13-39    141-166 (342)
306 cd05114 PTKc_Tec_Rlk Catalytic  50.5      12 0.00027   25.2   1.9   25   13-38    124-148 (256)
307 cd08229 STKc_Nek7 Catalytic do  50.5     9.9 0.00021   25.7   1.4   25   13-38    130-154 (267)
308 cd07857 STKc_MPK1 Catalytic do  50.4     8.6 0.00019   27.4   1.1   25   13-38    129-153 (332)
309 PRK11768 serine/threonine prot  50.4     9.6 0.00021   28.0   1.4   28    7-37    195-222 (325)
310 cd06621 PKc_MAPKK_Pek1_like Ca  50.2      25 0.00055   24.2   3.5   26   12-38    128-153 (287)
311 cd05032 PTKc_InsR_like Catalyt  49.9      13 0.00027   25.3   1.8   24   13-37    143-166 (277)
312 cd05632 STKc_GRK5 Catalytic do  49.4      11 0.00023   26.3   1.4   26   13-39    126-151 (285)
313 cd05148 PTKc_Srm_Brk Catalytic  49.4      14  0.0003   24.9   2.0   26   12-38    127-152 (261)
314 cd07865 STKc_CDK9 Catalytic do  49.4       9 0.00019   26.4   1.0   25   13-38    143-167 (310)
315 cd05610 STKc_MASTL Catalytic d  49.3      11 0.00025   30.4   1.8   25   13-38    128-152 (669)
316 cd07849 STKc_ERK1_2_like Catal  49.3     8.8 0.00019   27.4   1.0   26   13-39    130-155 (336)
317 COG3960 Glyoxylate carboligase  49.2      19  0.0004   28.6   2.8   30    7-36    272-305 (592)
318 cd07846 STKc_CDKL2_3 Catalytic  49.2      15 0.00033   25.0   2.2   25   13-38    124-148 (286)
319 cd08528 STKc_Nek10 Catalytic d  49.1      12 0.00026   25.3   1.7   28   12-40    137-164 (269)
320 cd06648 STKc_PAK_II Catalytic   49.1      13 0.00028   25.9   1.8   24   13-37    139-162 (285)
321 cd06658 STKc_PAK5 Catalytic do  49.1      10 0.00022   26.5   1.3   24   13-37    142-165 (292)
322 cd07851 STKc_p38 Catalytic dom  49.0      10 0.00022   27.3   1.3   27   13-40    142-168 (343)
323 KOG0581|consensus               48.9      11 0.00023   29.3   1.5   24   13-37    203-226 (364)
324 cd05106 PTKc_CSF-1R Catalytic   48.8      19  0.0004   26.6   2.7   24   13-37    236-259 (374)
325 cd07867 STKc_CDC2L6 Catalytic   48.8      23 0.00049   24.7   3.0   26   13-38    132-160 (317)
326 KOG0583|consensus               48.7      12 0.00025   28.5   1.6   26   13-38    144-169 (370)
327 cd06618 PKc_MKK7 Catalytic dom  48.5      10 0.00023   26.3   1.3   24   13-37    139-162 (296)
328 cd06609 STKc_MST3_like Catalyt  48.5      10 0.00023   25.8   1.3   24   13-37    122-145 (274)
329 cd05572 STKc_cGK_PKG Catalytic  48.2      13 0.00028   25.1   1.7   27   12-39    116-142 (262)
330 cd05055 PTKc_PDGFR Catalytic d  48.1      12 0.00026   26.3   1.6   25   13-38    165-189 (302)
331 cd05576 STKc_RPK118_like Catal  48.0      12 0.00025   25.3   1.4   24   13-37    109-132 (237)
332 cd06645 STKc_MAP4K3 Catalytic   47.9      12 0.00025   25.4   1.4   26   12-38    129-154 (267)
333 cd05103 PTKc_VEGFR2 Catalytic   47.9      20 0.00044   25.8   2.8   25   13-38    203-227 (343)
334 cd06652 STKc_MEKK2 Catalytic d  47.7      10 0.00022   25.7   1.1   25   13-38    130-154 (265)
335 PHA03209 serine/threonine kina  47.6      11 0.00025   27.3   1.4   24   13-37    181-204 (357)
336 cd05060 PTKc_Syk_like Catalyti  47.4      18 0.00038   24.4   2.3   24   13-37    119-142 (257)
337 cd06617 PKc_MKK3_6 Catalytic d  47.3      13 0.00028   25.3   1.6   24   13-37    128-151 (283)
338 COG0478 RIO-like serine/threon  47.1      20 0.00043   27.2   2.6   44   13-63    226-269 (304)
339 cd06659 STKc_PAK6 Catalytic do  47.1      14 0.00031   25.9   1.8   25   12-37    140-164 (297)
340 COG5072 ALK1 Serine/threonine   47.0      20 0.00043   28.7   2.7   50   13-64    346-407 (488)
341 cd05577 STKc_GRK Catalytic dom  46.7      11 0.00024   25.9   1.1   25   13-38    119-143 (277)
342 cd05613 STKc_MSK1_N N-terminal  46.6      13 0.00028   25.7   1.5   25   13-38    129-153 (290)
343 COG2334 Putative homoserine ki  46.6      18  0.0004   27.2   2.4   25   13-37    202-226 (331)
344 PHA03210 serine/threonine kina  46.6      13 0.00027   28.9   1.6   24   13-37    291-314 (501)
345 cd05057 PTKc_EGFR_like Catalyt  46.4      16 0.00035   25.0   1.9   24   13-37    133-156 (279)
346 smart00220 S_TKc Serine/Threon  46.3      13 0.00029   24.0   1.5   29   12-41    110-138 (244)
347 PHA03211 serine/threonine kina  46.3      11 0.00025   29.2   1.3   24   13-37    284-307 (461)
348 cd05065 PTKc_EphR_B Catalytic   46.1      15 0.00032   25.0   1.7   24   13-37    130-153 (269)
349 cd07852 STKc_MAPK15 Catalytic   46.0      16 0.00034   26.0   1.9   25   13-38    131-155 (337)
350 cd07844 STKc_PCTAIRE_like Cata  46.0      11 0.00025   25.9   1.1   26   13-39    127-152 (291)
351 KOG0696|consensus               45.8      16 0.00035   29.7   2.1   26   13-39    474-499 (683)
352 cd06635 STKc_TAO1 Catalytic do  45.8      19 0.00041   25.4   2.3   25   13-38    149-173 (317)
353 cd05058 PTKc_Met_Ron Catalytic  45.8      17 0.00037   24.4   2.0   25   13-38    122-146 (262)
354 PRK05618 50S ribosomal protein  45.3      17 0.00037   25.4   1.9   31   22-56     81-111 (197)
355 smart00221 STYKc Protein kinas  45.3      17 0.00037   23.4   1.8   28   12-40    121-148 (225)
356 PRK14751 tetracycline resistan  45.1      15 0.00033   18.2   1.2   17   23-39     11-27  (28)
357 TIGR02904 spore_ysxE spore coa  45.0      16 0.00034   26.4   1.8   29    8-37    196-224 (309)
358 cd05611 STKc_Rim15_like Cataly  44.9      14 0.00031   24.8   1.5   25   13-38    121-145 (260)
359 cd06614 STKc_PAK Catalytic dom  44.9      15 0.00032   25.3   1.6   26   12-38    139-164 (286)
360 cd07856 STKc_Sty1_Hog1 Catalyt  44.8      13 0.00029   26.6   1.4   26   13-39    132-157 (328)
361 KOG0670|consensus               44.7      17 0.00037   30.3   2.1   36   13-53    560-595 (752)
362 cd06611 STKc_SLK_like Catalyti  44.7      15 0.00034   25.0   1.6   24   13-37    127-150 (280)
363 cd07842 STKc_CDK8_like Catalyt  44.5      11 0.00023   26.2   0.8   26   12-38    131-160 (316)
364 PTZ00024 cyclin-dependent prot  44.2      12 0.00027   26.5   1.1   25   13-38    143-167 (335)
365 cd07829 STKc_CDK_like Catalyti  44.2      22 0.00048   24.0   2.3   26   13-39    122-147 (282)
366 cd05099 PTKc_FGFR4 Catalytic d  44.0      19  0.0004   25.4   2.0   25   13-38    158-182 (314)
367 cd07880 STKc_p38gamma_MAPK12 C  43.8      17 0.00036   26.2   1.8   25   13-38    142-166 (343)
368 cd05108 PTKc_EGFR Catalytic do  43.8      17 0.00038   25.6   1.8   25   13-38    133-157 (316)
369 cd05051 PTKc_DDR Catalytic dom  43.7      18 0.00039   24.9   1.8   24   13-37    154-177 (296)
370 cd08218 STKc_Nek1 Catalytic do  43.6      19 0.00042   24.1   2.0   25   13-38    125-149 (256)
371 cd06615 PKc_MEK Catalytic doma  43.4      18 0.00038   25.5   1.8   24   13-37    124-147 (308)
372 cd07843 STKc_CDC2L1 Catalytic   43.2      16 0.00035   25.2   1.6   28   12-40    129-156 (293)
373 cd07833 STKc_CDKL Catalytic do  43.1      18 0.00039   24.6   1.8   25   13-38    124-148 (288)
374 cd07868 STKc_CDK8 Catalytic do  42.9      26 0.00056   24.5   2.6   26   13-38    132-160 (317)
375 PHA03390 pk1 serine/threonine-  42.8      21 0.00046   24.5   2.1   26   13-38    133-158 (267)
376 KOG0694|consensus               42.8      15 0.00033   30.7   1.6   23   14-37    493-515 (694)
377 PLN03224 probable serine/threo  42.5      19 0.00042   28.6   2.1   25   13-38    333-357 (507)
378 PF15232 DUF4585:  Domain of un  42.3      29 0.00062   21.2   2.3   19   16-34      6-24  (75)
379 cd06654 STKc_PAK1 Catalytic do  42.2      14  0.0003   25.8   1.2   26   12-38    139-164 (296)
380 cd05053 PTKc_FGFR Catalytic do  42.1      19 0.00041   24.8   1.8   25   13-38    156-180 (293)
381 cd07854 STKc_MAPK4_6 Catalytic  41.6      14  0.0003   26.6   1.1   25   13-37    138-162 (342)
382 PRK10593 hypothetical protein;  41.3      25 0.00055   25.5   2.4   26   10-35    195-221 (297)
383 cd07877 STKc_p38alpha_MAPK14 C  41.3      20 0.00043   25.9   1.8   27   13-40    144-170 (345)
384 cd05073 PTKc_Hck Catalytic dom  41.1      22 0.00047   24.1   1.9   26   13-39    126-151 (260)
385 cd07831 STKc_MOK Catalytic dom  41.0      20 0.00044   24.3   1.8   24   13-38    124-147 (282)
386 cd05049 PTKc_Trk Catalytic dom  40.9      22 0.00047   24.2   1.9   24   13-37    146-169 (280)
387 cd07858 STKc_TEY_MAPK_plant Ca  40.9      15 0.00033   26.2   1.2   27   13-40    132-158 (337)
388 cd06610 STKc_OSR1_SPAK Catalyt  40.8      18 0.00039   24.2   1.5   25   12-37    125-149 (267)
389 PF15535 Toxin_57:  Putative to  40.6      16 0.00034   22.4   1.0   15   21-35     35-49  (77)
390 cd06653 STKc_MEKK3_like_1 Cata  40.6      14 0.00031   25.1   0.9   24   13-37    130-153 (264)
391 cd05091 PTKc_Ror2 Catalytic do  39.8      21 0.00045   24.4   1.7   24   13-37    148-171 (283)
392 PRK06148 hypothetical protein;  39.7      27 0.00059   30.0   2.7   26   13-38    208-235 (1013)
393 cd05104 PTKc_Kit Catalytic dom  39.6      28 0.00061   25.6   2.4   25   13-38    238-262 (375)
394 cd05605 STKc_GRK4_like Catalyt  39.4      19 0.00041   25.0   1.5   26   13-39    126-151 (285)
395 cd05606 STKc_beta_ARK Catalyti  39.2      16 0.00035   25.2   1.1   25   13-38    121-145 (278)
396 KOG1165|consensus               39.2      34 0.00073   27.1   2.9   25   13-37    148-176 (449)
397 cd06634 STKc_TAO2 Catalytic do  38.8      20 0.00042   25.3   1.5   26   13-39    139-164 (308)
398 cd08220 STKc_Nek8 Catalytic do  38.8      18 0.00039   24.1   1.2   27   12-38    124-150 (256)
399 TIGR01767 MTRK 5-methylthiorib  38.7      24 0.00052   27.3   2.0   29    9-39    193-221 (370)
400 cd06626 STKc_MEKK4 Catalytic d  38.6      18  0.0004   24.2   1.3   27   13-40    123-149 (264)
401 PRK13184 pknD serine/threonine  38.6      27 0.00058   30.2   2.4   25   13-38    137-161 (932)
402 cd06633 STKc_TAO3 Catalytic do  37.7      28  0.0006   24.6   2.1   26   13-39    145-170 (313)
403 KOG0585|consensus               37.7      29 0.00062   28.4   2.3   27   13-40    234-260 (576)
404 cd08216 PK_STRAD Pseudokinase   37.6      35 0.00076   23.8   2.6   25   13-38    125-149 (314)
405 KOG4750|consensus               37.5      13 0.00029   27.5   0.5   12   11-22    195-209 (269)
406 cd05100 PTKc_FGFR3 Catalytic d  37.5      27 0.00059   24.8   2.1   25   13-38    158-182 (334)
407 KOG4714|consensus               37.5      29 0.00063   26.4   2.2   22   14-35    233-254 (319)
408 cd05037 PTK_Jak_rpt1 Pseudokin  37.4      29 0.00062   23.1   2.0   26   13-39    125-157 (259)
409 cd08221 STKc_Nek9 Catalytic do  36.9      29 0.00063   23.2   2.0   27   12-39    124-150 (256)
410 KOG0690|consensus               36.0      19 0.00042   28.5   1.1   24   13-37    292-315 (516)
411 KOG0667|consensus               35.9      26 0.00057   28.8   1.9   25   13-37    313-338 (586)
412 cd06651 STKc_MEKK3 Catalytic d  35.5      21 0.00045   24.2   1.1   24   13-37    130-153 (266)
413 cd06632 STKc_MEKK1_plant Catal  35.5      25 0.00055   23.3   1.5   26   13-39    126-151 (258)
414 cd06630 STKc_MEKK1 Catalytic d  35.2      24 0.00051   23.8   1.4   28   12-39    126-153 (268)
415 KOG0611|consensus               35.0      29 0.00063   28.3   2.0   23   14-37    178-200 (668)
416 PF02958 EcKinase:  Ecdysteroid  35.0      23 0.00049   25.0   1.3   29    9-37    216-248 (294)
417 COG4248 Uncharacterized protei  34.9      33 0.00072   28.1   2.3   24   11-35    139-162 (637)
418 KOG1167|consensus               34.9      24 0.00053   27.9   1.5   25   14-38    157-181 (418)
419 cd05074 PTKc_Tyro3 Catalytic d  34.8      28 0.00061   23.5   1.7   24   13-37    137-160 (273)
420 PRK09550 mtnK methylthioribose  34.4      35 0.00076   26.5   2.3   28    9-38    224-251 (401)
421 KOG2464|consensus               34.4      38 0.00083   24.1   2.4   16   11-27    160-175 (246)
422 PRK10345 hypothetical protein;  34.2      34 0.00074   23.8   2.1   24   12-35    128-154 (210)
423 cd07864 STKc_CDK12 Catalytic d  34.2      22 0.00047   24.5   1.1   25   13-38    140-164 (302)
424 TIGR00731 ctc_TL5 ribosomal pr  33.8      27 0.00059   24.0   1.5   37   18-58     66-107 (176)
425 PTZ00284 protein kinase; Provi  33.6      41 0.00089   25.5   2.6   25   13-38    256-296 (467)
426 cd05077 PTK_Jak1_rpt1 Pseudoki  33.3      38 0.00082   23.1   2.2   25   13-38    129-160 (262)
427 KOG1163|consensus               33.0      41 0.00088   25.6   2.4   44   13-60    135-182 (341)
428 cd06620 PKc_MAPKK_Byr1_like Ca  32.9      25 0.00053   24.2   1.2   25   13-38    128-152 (284)
429 KOG4250|consensus               32.9      40 0.00087   28.5   2.5   24   14-37    145-171 (732)
430 cd05036 PTKc_ALK_LTK Catalytic  32.8      35 0.00076   23.3   1.9   25   13-38    140-167 (277)
431 PHA02988 hypothetical protein;  31.1      33 0.00071   24.0   1.6   24   13-37    147-170 (283)
432 PF14531 Kinase-like:  Kinase-l  30.8      39 0.00084   25.1   2.0   30   13-43    169-198 (288)
433 cd05064 PTKc_EphR_A10 Catalyti  30.7      32  0.0007   23.4   1.4   24   13-37    131-154 (266)
434 PRK12396 5-methylribose kinase  29.5      38 0.00082   26.6   1.8   24   12-37    231-254 (409)
435 KOG0597|consensus               28.9      37  0.0008   28.7   1.7   49   13-62    124-186 (808)
436 KOG0662|consensus               28.7      46 0.00099   24.4   2.0   24   13-37    125-148 (292)
437 KOG0659|consensus               28.4      47   0.001   25.3   2.1   24   13-37    125-148 (318)
438 cd05105 PTKc_PDGFR_alpha Catal  28.0      54  0.0012   24.7   2.3   24   13-37    261-284 (400)
439 PF14435 SUKH-4:  SUKH-4 immuni  27.8      73  0.0016   21.1   2.8   26   11-36     79-105 (179)
440 KOG0986|consensus               27.8      45 0.00097   27.3   2.0   27   13-40    311-337 (591)
441 KOG4645|consensus               27.8      73  0.0016   29.1   3.3   43   14-65   1359-1401(1509)
442 PF11720 Inhibitor_I78:  Peptid  27.7      56  0.0012   18.4   1.9   16   19-35     45-60  (60)
443 COG4499 Predicted membrane pro  27.5      65  0.0014   25.6   2.7   27    3-35    103-129 (434)
444 PRK06149 hypothetical protein;  27.1      54  0.0012   28.1   2.4   25   13-37    213-241 (972)
445 COG1871 CheD Chemotaxis protei  27.1      62  0.0013   22.5   2.3   19   12-30    135-153 (164)
446 PF03975 CheD:  CheD chemotacti  27.0      53  0.0012   20.8   1.9   21   11-31     84-104 (114)
447 PF03413 PepSY:  Peptidase prop  27.0      93   0.002   16.5   2.7   26    6-31     32-62  (64)
448 TIGR03606 non_repeat_PQQ dehyd  26.5      71  0.0015   25.3   2.9   29    7-36    222-250 (454)
449 cd05046 PTK_CCK4 Pseudokinase   26.4      65  0.0014   21.8   2.4   25   13-38    141-165 (275)
450 KOG0582|consensus               26.4      57  0.0012   26.5   2.3   52   14-66    151-209 (516)
451 COG0515 SPS1 Serine/threonine   26.3      44 0.00095   21.7   1.4   25   13-37    125-149 (384)
452 KOG2686|consensus               26.3      82  0.0018   24.5   3.1   29    9-37    213-241 (366)
453 cd08227 PK_STRAD_alpha Pseudok  26.3      54  0.0012   23.2   2.0   24   13-37    125-148 (327)
454 PRK13497 chemoreceptor glutami  26.1      68  0.0015   22.4   2.4   25   11-35    132-156 (184)
455 cd05043 PTK_Ryk Pseudokinase d  26.0      40 0.00086   23.0   1.3   24   13-37    141-164 (280)
456 PF10246 MRP-S35:  Mitochondria  25.7      91   0.002   20.2   2.8   42    9-55     16-71  (104)
457 PF08534 Redoxin:  Redoxin;  In  25.6      77  0.0017   19.8   2.5   21   15-36    114-134 (146)
458 PF12260 PIP49_C:  Protein-kina  25.5      68  0.0015   21.9   2.3   38    3-42     77-114 (188)
459 PF11776 DUF3315:  Domain of un  25.1      83  0.0018   17.4   2.3   14   19-32     39-52  (52)
460 cd08225 STKc_Nek5 Catalytic do  24.8      41  0.0009   22.3   1.1   25   13-37    125-149 (257)
461 cd05107 PTKc_PDGFR_beta Cataly  24.8      77  0.0017   23.9   2.7   25   13-38    263-287 (401)
462 cd06647 STKc_PAK_I Catalytic d  24.8      46   0.001   23.2   1.4   26   12-38    138-163 (293)
463 smart00135 LY Low-density lipo  24.7      96  0.0021   14.8   3.4   24   13-36      7-30  (43)
464 KOG0578|consensus               24.4      66  0.0014   26.4   2.3   21   16-37    396-416 (550)
465 PF06588 Muskelin_N:  Muskelin   24.2      41 0.00088   24.1   1.0   18   10-27     14-31  (199)
466 PRK13488 chemoreceptor glutami  24.1      79  0.0017   21.4   2.4   20   11-30    127-146 (157)
467 PRK13498 chemoreceptor glutami  24.1      79  0.0017   21.7   2.4   20   11-30    135-154 (167)
468 PF14433 SUKH-3:  SUKH-3 immuni  23.9 1.5E+02  0.0032   19.0   3.6   26    9-35     95-120 (142)
469 KOG0695|consensus               23.8      51  0.0011   26.3   1.6   26   13-39    375-400 (593)
470 KOG0668|consensus               23.6      58  0.0013   24.7   1.8   24   14-37    157-180 (338)
471 COG3536 Uncharacterized protei  23.5   2E+02  0.0043   19.0   4.1   40   14-67      2-41  (120)
472 COG2139 RPL21A Ribosomal prote  23.5      46   0.001   21.3   1.1   28   16-43     25-52  (98)
473 PLN00181 protein SPA1-RELATED;  23.2      70  0.0015   26.3   2.3   25   13-38    104-128 (793)
474 PRK13493 chemoreceptor glutami  23.1      83  0.0018   22.5   2.4   21   11-31    159-179 (213)
475 PF11094 UL11:  Membrane-associ  21.7      92   0.002   16.7   1.9   17   17-34     14-30  (39)
476 PF01436 NHL:  NHL repeat;  Int  21.7      98  0.0021   14.5   1.9   20   15-35      2-21  (28)
477 KOG3078|consensus               21.6      38 0.00082   24.7   0.5   15   22-36    140-154 (235)
478 PRK13490 chemoreceptor glutami  21.5      96  0.0021   21.1   2.4   20   11-30    132-151 (162)
479 KOG1166|consensus               21.0 1.1E+02  0.0024   26.7   3.2   29   13-41    818-852 (974)
480 PF07995 GSDH:  Glucose / Sorbo  20.9      83  0.0018   23.2   2.2   30    7-36    173-202 (331)
481 cd03014 PRX_Atyp2cys Peroxired  20.7      99  0.0021   19.2   2.3   22   16-38    110-131 (143)
482 cd03012 TlpA_like_DipZ_like Tl  20.7      90   0.002   19.2   2.0   20   16-36    106-125 (126)
483 PF02201 SWIB:  SWIB/MDM2 domai  20.6      41  0.0009   19.7   0.4   16   52-67      4-19  (76)
484 PRK13487 chemoreceptor glutami  20.4   1E+02  0.0022   21.9   2.4   20   11-30    147-166 (201)
485 PRK13489 chemoreceptor glutami  20.2   1E+02  0.0022   22.5   2.4   21   11-31    145-165 (233)
486 KOG0614|consensus               20.2      59  0.0013   27.2   1.3   24   13-37    544-567 (732)

No 1  
>cd05172 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. DNA-PK is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). DNA-PK is comprised of a regulatory subunit, containing the Ku70/80 subunit, and a catalytic subunit, which contains a NUC194 domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. It is part of a multi-component system involved in non-homologous end joining (NHEJ), a process of repairing double st
Probab=99.97  E-value=2e-33  Score=200.73  Aligned_cols=75  Identities=51%  Similarity=0.747  Sum_probs=71.0

Q ss_pred             ccceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeeeE
Q psy16910          2 NNSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSSE   76 (82)
Q Consensus         2 ~~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~~   76 (82)
                      ..|++||++|||||||+|||+++.||+++|||||++|+.+++.+++||.|||||||||+++||+.|+||.|++++
T Consensus       130 ~~S~~~YilglgDRH~~NIli~~~tG~v~HIDfg~~f~~~~~~~~~pE~vPFRLT~~~~~~~g~~g~~G~f~~~~  204 (235)
T cd05172         130 AMCVSHWILGIGDRHLSNFLVDLETGGLVGIDFGHAFGTATQFLPIPELMPFRLTPQFVNLMEPMKADGLLRSCM  204 (235)
T ss_pred             HHHHHhheeeccCCCcccEEEECCCCcEEEEeeHhhhccCCccCCCCCCCCeeeCHHHHHHhCCCCCCChHHHHH
Confidence            368999999999999999999999999999999999999988889999999999999999999999999998643


No 2  
>cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TOR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). TOR contains a rapamycin binding domain, a catalytic domain, and a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. It is also called FRAP (FK506 binding protein 12-rapamycin associated protein). TOR is a central component of the eukaryotic growth regulatory network. It controls the expression of many genes transcribed by all three RNA polymerases. It associates with 
Probab=99.97  E-value=9.8e-33  Score=200.08  Aligned_cols=73  Identities=32%  Similarity=0.442  Sum_probs=69.1

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSS   75 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~   75 (82)
                      .|++|||+|||||||+|||+|+.||+++|||||++|++++...++||.|||||||||+++||+.|+||.|+.+
T Consensus       176 ~Sv~~YilglgDRH~~NIll~~~tG~v~HIDfg~~f~~~~~~~~~pE~VPFRLT~~~~~~lG~~g~~G~F~~~  248 (280)
T cd05169         176 MSMVGYILGLGDRHPSNIMIDRLTGKVIHIDFGDCFEVAMHREKFPEKVPFRLTRMLVNALGVSGIEGTFRTT  248 (280)
T ss_pred             HHHHHhheeccCCCcceEEEEcCCCCEEEEecHHHHhhccccCCCCCcCCcccCHHHHHHhCCCCCCCchHHH
Confidence            5899999999999999999999999999999999999997667889999999999999999999999999854


No 3  
>cd05163 TRRAP TRansformation/tRanscription domain-Associated Protein (TRRAP), pseudokinase domain; The TRRAP catalytic domain is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TRRAP shows some similarity to members of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily in that it contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain and has a large molecular weight. Unlike PIKK proteins, however, it contains an inactive PI3K-like pseudokinase domain, which lacks the conserved residues necessary for ATP binding and catalytic activity. TRRAP also contains many motifs that may be critical for protein-protein interactions. TRRAP is a common component of many histone acetyltransferase (HAT) complexes, and is responsible for the recruitment of these complexes to chromatin during transcription, replicat
Probab=99.97  E-value=5.6e-32  Score=195.00  Aligned_cols=74  Identities=28%  Similarity=0.341  Sum_probs=70.3

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeeeE
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSSE   76 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~~   76 (82)
                      .|+++||+|+|||||+|||+++.||+++||||+++|+++...++.||.|||||||||+++||+.|+||.|++++
T Consensus       149 ~s~~gYilglgdRh~~nili~~~tG~v~hiDf~~~f~~~~~~~~~pE~VPFRLT~ni~~~~g~~g~eG~f~~~~  222 (253)
T cd05163         149 LSFMTYILSINNRNPDKIFISRDTGNVYQSDLLPSINNNKPLFHNNEPVPFRLTPNIQHLIGPIGLEGILTSSM  222 (253)
T ss_pred             HHHHHHHhcCCCCCchhEEEEcCCCcEEEEeeeeeecCCCcCCCCCCcCCcccCHHHHHHhCCcCcCCcHHHHH
Confidence            58999999999999999999999999999999999999987778999999999999999999999999998654


No 4  
>cd05171 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATM is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATM contains a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. ATM is critical in the response to DNA double strand breaks (DSBs) caused by radiation. It is activated at the site of a DSB and phosphorylates key substrates that trigger pathways that regulate DNA repair and cell cycle checkpoints at the G1/S, S phase, and G2/M transi
Probab=99.97  E-value=6.6e-32  Score=196.46  Aligned_cols=73  Identities=36%  Similarity=0.485  Sum_probs=69.3

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeeeE
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSSE   76 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~~   76 (82)
                      .|++|||+|||||||+|||+++.||+++||||+++|+++++ ++.||.|||||||||+++||+.|+||.|+.++
T Consensus       176 ~s~~~yilglgDRh~~NIll~~~tG~v~hiDf~~~f~~~~~-l~~pe~vPFRLT~~~~~~lg~~g~~g~f~~~~  248 (279)
T cd05171         176 SSIVGYILGLGDRHANNILIDEKTAEVVHIDLGIAFEQGKI-LPVPETVPFRLTRDIVDGMGITGVEGVFRRCC  248 (279)
T ss_pred             HHHHHHhhccCCCCcccEEEEcCcCcEEEEechhhhccCcC-CCCCCcCChhhhHHHHHHhCCCCCcchHHHHH
Confidence            58999999999999999999999999999999999999976 89999999999999999999999999998543


No 5  
>cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. SMG-1 is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). In addition to its catalytic domain, SMG-1 contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. SMG-1 plays a critical role in the mRNA surveillance mechanism known as non-sense mediated mRNA decay (NMD). NMD protects the cells from the accumulation of aberrant mRNAs with premature termination codons (PTCs) generated by geno
Probab=99.97  E-value=1.6e-31  Score=196.78  Aligned_cols=73  Identities=37%  Similarity=0.477  Sum_probs=68.9

Q ss_pred             ccceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeee
Q psy16910          2 NNSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSS   75 (82)
Q Consensus         2 ~~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~   75 (82)
                      ..|+++||+|||||||+||||++.||+++|||||++|++++ .+++||.|||||||||+++||+.|+||.|+.+
T Consensus       203 ~~s~~~yilglgDRh~~NIli~~~tG~v~hiDf~~~f~~~~-~l~~pE~VPFRLT~~~~~~lg~~g~~G~f~~~  275 (307)
T cd05170         203 VMSMIGYVIGLGDRHLDNVLIDLKTGEVVHIDYNVCFEKGK-SLRIPEKVPFRMTQNIETALGLTGVEGVFRLS  275 (307)
T ss_pred             HHHHHHHHccCCCCCCccEEEEcCCCcEEEEeeHhhhcccC-CCCCCCCCCeeeCHHHHHHhCCCCCchhHHHH
Confidence            36899999999999999999999999999999999999985 58899999999999999999999999999854


No 6  
>cd00892 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATR is also referred to as Mei-41 (Drosophila), Esr1/Mec1p (Saccharomyces cerevisiae), Rad3 (Schizosaccharomyces pombe), and FRAP-related protein (human). ATR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATR contains a UME domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. Together with its downstream effector kinase, Chk1, ATR plays a central 
Probab=99.96  E-value=3.5e-31  Score=189.26  Aligned_cols=72  Identities=33%  Similarity=0.470  Sum_probs=67.9

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSS   75 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~   75 (82)
                      .|+++||+|||||||+|||+++.||+++|||||++|+.++ .++.||.|||||||||++++|+.|++|.|+.+
T Consensus       134 ~s~~~YilgigDRh~~NIli~~~tG~~~HIDfg~~~~~~~-~~~~pe~vPFRLT~~~~~~lg~~g~~g~F~~~  205 (237)
T cd00892         134 MSMVGYILGLGDRHGENILFDSNTGDVVHVDFNCLFDKGE-TLEVPERVPFRLTQNMVDAMGVLGVEGLFRKS  205 (237)
T ss_pred             HHHHHHHhccCCCCcccEEEEcCCCcEEEEehHhhhcccc-cCCCCCCCCcccCHHHHHHhCCCCCCCchHHH
Confidence            5899999999999999999998899999999999999984 57899999999999999999999999999753


No 7  
>cd05164 PIKKc Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members include ATM (Ataxia telangiectasia mutated), ATR (Ataxia telangiectasia and Rad3-related), TOR (Target of rapamycin), SMG-1 (Suppressor of morphogenetic effect on genitalia-1), and DNA-PK (DNA-dependent protein kinase). PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). They show strong preference for phosphorylating serine/threonine residues followed by a glutamine and are also referred to as (S/T)-Q-directed kinases. They all contain a FATC (FRAP, ATM and TRRAP, C-terminal) d
Probab=99.96  E-value=5.6e-31  Score=186.59  Aligned_cols=73  Identities=38%  Similarity=0.551  Sum_probs=68.1

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeeeE
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSSE   76 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~~   76 (82)
                      .|+++|++|+|||||+|||+++.||+++||||+++|+.++ .++.||.|||||||||+++||+.|++|.|+.++
T Consensus       126 ~s~~~YvlglgDRh~~NIli~~~tG~v~hIDf~~~~~~~~-~~~~~e~vPFRLT~~~~~~lg~~g~~G~f~~~~  198 (222)
T cd05164         126 MSIVGYILGLGDRHLDNILIDRETGEVVHIDFGCIFEKGK-TLPVPELVPFRLTRNIINGMGITGVEGLFRKIC  198 (222)
T ss_pred             HHHHHHHhccCCCCCceEEEECCCCcEEEEccHHhhccCC-CCCCCCCCCEEeCHHHHHHhCCCCcCChHHHHH
Confidence            5899999999999999999999999999999999999986 467799999999999999999999999998543


No 8  
>cd00142 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members of the family include PI3K, phosphoinositide 4-kinase (PI4K), PI3K-related protein kinases (PIKKs), and TRansformation/tRanscription domain-Associated Protein (TRRAP). PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives, while PI4K catalyze the phosphorylation of the 4-hydroxyl of PtdIns. PIKKs are protein kinases that catalyze the phosphorylation of serine/threonine residues, especially those that are followed by a glutamine. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the 
Probab=99.96  E-value=3.5e-30  Score=181.49  Aligned_cols=72  Identities=35%  Similarity=0.482  Sum_probs=67.1

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSS   75 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~   75 (82)
                      .|+++|++|||||||+|||+++.||+++|||||++|+.+++... +|.|||||||||+++||+.|.+|.|+.+
T Consensus       123 ~s~~~YilglgDRh~~NIli~~~~G~~~hIDfg~~~~~~~~~~~-~e~vPFRLT~~~~~~~g~~~~~g~F~~~  194 (219)
T cd00142         123 YSVAGYILGIGDRHPDNIMIDLDTGKLFHIDFGFIFGKRKKFLG-RERVPFRLTPDLVNALGTGGVFGPFRSL  194 (219)
T ss_pred             HHHHHHHhccCCCCCccEEEECCCCeEEEEeeHHhhCcCcCCCC-CCCCCEeccHHHHHHhCCcchhhhHHHH
Confidence            58999999999999999999988999999999999999976544 9999999999999999999999999854


No 9  
>smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain. Phosphoinositide 3-kinase isoforms participate in a variety of processes,  including cell motility, the Ras pathway, vesicle trafficking and  secretion, and apoptosis. These homologues may be either lipid kinases and/or protein kinases: the former phosphorylate the 3-position in the inositol ring of inositol phospholipids. The ataxia telangiectesia-mutated gene produced, the targets of rapamycin (TOR) and the DNA-dependent kinase have not been found to possess lipid kinase activity. Some of this family possess PI-4 kinase activities.
Probab=99.95  E-value=5.1e-30  Score=178.65  Aligned_cols=72  Identities=36%  Similarity=0.568  Sum_probs=67.5

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSS   75 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~   75 (82)
                      .|+++|++|+|||||+||||+ +||+++|||||++|+++++....+|.|||||||||+++||+.|.+|.|+..
T Consensus        96 ~s~~~YilglgDRh~~NIli~-~~G~v~hIDfg~~~~~~~~~~~~~e~vPFRLT~~~~~~lg~~~~~g~F~~~  167 (202)
T smart00146       96 YSVITYILGLGDRHNDNIMLD-KTGHLFHIDFGFILGNGPKLFGFPERVPFRLTPEMVDVMGDSGYFGLFRSL  167 (202)
T ss_pred             HHHHHHHhcCCCCCCCcEEEe-CCCCEEEEechhhhCccccCCCCCCCCCeecCHHHHHHhCCCcccchHHHH
Confidence            589999999999999999999 899999999999999998766666999999999999999999999999753


No 10 
>cd05168 PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIbeta (also called Pik1p in yeast) is a 110 kDa protein that is localized to the Golgi and the nucleus. It is required for maintaining the structural integrity of the Golgi complex (GC), and is a key regulator of protein transport from the GC to the plasma membrane. PI4KII
Probab=99.95  E-value=5.3e-29  Score=183.26  Aligned_cols=70  Identities=27%  Similarity=0.311  Sum_probs=64.1

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCc--hheee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQ--EVALS   74 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~e--G~f~~   74 (82)
                      .|++||||||||||++||||++ +|+++|||||++|+.+++. ..+|+||||||++|+++||+.+++  |.|+.
T Consensus       136 ySvv~YvLGigDRH~~NILi~~-~G~liHIDFG~~fg~~~~~-~~~E~vPFrLT~~mv~~mGg~~s~~~~~F~~  207 (293)
T cd05168         136 YSLICYLLQIKDRHNGNILIDN-DGHIIHIDFGFMLSNSPGN-VGFETAPFKLTQEYIEVMGGVNSDLFNYFKK  207 (293)
T ss_pred             HHHHHHHhhccccCCCceEEcC-CCCEEEEehHHhhcccccC-CCCCCCCEEecHHHHHHhCCCCCchhHHHHH
Confidence            5899999999999999999995 9999999999999999765 457999999999999999999987  77864


No 11 
>cd00893 PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type III, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. There are two types of PI4Ks, types II and III. Type II PI4Ks lack the characteristic catalytic kinase domain present in PI3Ks and type III PI4Ks, and are excluded from this family. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes.
Probab=99.94  E-value=4.6e-29  Score=183.28  Aligned_cols=71  Identities=24%  Similarity=0.211  Sum_probs=63.5

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCc--hheee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQ--EVALS   74 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~e--G~f~~   74 (82)
                      -|++||||||||||++||||+ .+|+++|||||++|+.+++....+|.+|||||++|+++||+.+.+  +.|+.
T Consensus       134 ySvv~YiLgigDRH~~NILid-~~G~liHIDFG~ilg~~p~~~~~~E~~PFrLT~emv~~mGg~~s~~f~~F~~  206 (289)
T cd00893         134 YSLLCYLLQIKDRHNGNILLD-SDGHIIHIDFGFILDSSPGNNLGFEPAAFKFTKEMVDFMGGKKSDDFKKFRY  206 (289)
T ss_pred             HHHHHHHhhccccCCCceEEC-CCCCEEEEehHHhhCcCCcCCCCCCCCCeeecHHHHHHhCCCCChhHHHHHH
Confidence            489999999999999999998 599999999999999997653447999999999999999999988  45653


No 12 
>KOG0890|consensus
Probab=99.94  E-value=1.7e-28  Score=210.40  Aligned_cols=76  Identities=36%  Similarity=0.593  Sum_probs=72.3

Q ss_pred             ceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchhee-eeEEeee
Q psy16910          4 SSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVAL-SSEVGFQ   80 (82)
Q Consensus         4 S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~-~~~~~~q   80 (82)
                      ||+|||||+||||.+|||+|..||+++|+||...|+++ +.+++||.||||||+||+++|||+|+||.|| +||+++.
T Consensus      2215 SmVGyIlGLGDRHgENILFDs~TGdcVHVDFnCLFnKG-etlevPEiVPFRLT~NMidamGp~G~EG~Frk~cEiTLr 2291 (2382)
T KOG0890|consen 2215 SMVGYILGLGDRHGENILFDSTTGDCVHVDFNCLFNKG-ETLEVPELVPFRLTQNMIDAMGPLGLEGSFRKVCEITLR 2291 (2382)
T ss_pred             HHHHHHhcCccccccceeeecCCCcEEEEeecccccCC-cccCCCCccceecchhHHhhcCCcccchhHHHHHHHHHH
Confidence            89999999999999999999999999999999999999 5799999999999999999999999999997 6888764


No 13 
>cd05165 PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. In vitro, they can also phosphorylate the substrates P
Probab=99.94  E-value=4.4e-28  Score=182.84  Aligned_cols=71  Identities=31%  Similarity=0.397  Sum_probs=64.2

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCC-CCCCceeecHHHHHhhCCCCCc------hheee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPFRLTPHILAVNEPYGSQ------EVALS   74 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~-~E~vPFRLT~~~~~~~g~~g~e------G~f~~   74 (82)
                      -|++||+|||||||++||||+ .+|+++|||||++|+..++.+++ ||+||||||++|+++||+.|.+      |.|+.
T Consensus       207 ysvvtYiLGigDRH~~NILi~-~~G~l~HIDFG~ilg~~~~~~~i~~E~~PFkLT~emv~~mg~~~~~~~s~~f~~F~~  284 (366)
T cd05165         207 YCVATFVLGIGDRHNDNIMVK-ETGQLFHIDFGHILGNYKSKFGINRERVPFVLTPDFVHVIGRGKKDNTSEHFQRFQD  284 (366)
T ss_pred             HHHHHHHhhccccCCcceEEc-CCCCEEEEehHHhhccCCccCCCCCCCCCeeecHHHHHHhcccCCcCCChhhhHHHH
Confidence            489999999999999999998 69999999999999998877775 9999999999999999987665      67764


No 14 
>cd00891 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms c
Probab=99.94  E-value=6.3e-28  Score=181.03  Aligned_cols=71  Identities=31%  Similarity=0.358  Sum_probs=64.6

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCC-CCCCCceeecHHHHHhhCCCCCc--hheee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLP-IPELMPFRLTPHILAVNEPYGSQ--EVALS   74 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~-~~E~vPFRLT~~~~~~~g~~g~e--G~f~~   74 (82)
                      -|++||+|||||||++||||+ .+|+++|||||++|+..++.+. .||+||||||++|+++||+.|++  |.|+.
T Consensus       198 ysv~~YiLgigDRH~~NILi~-~~G~~~HIDFG~ilg~~~~~~~~~~E~~PFrLT~~mv~~mGg~~s~~~~~F~~  271 (352)
T cd00891         198 YCVATYVLGIGDRHNDNIMLT-KTGHLFHIDFGHFLGNFKKKFGIKRERAPFVLTPDMAYVMGGGDSEKFQRFED  271 (352)
T ss_pred             HHHHHHHccccccCCCceEEC-CCCCEEEEehHHhhccCCccCCCCCCCCCeeecHHHHHHhCCCCCcccchHHH
Confidence            489999999999999999998 7999999999999998876666 49999999999999999999976  77763


No 15 
>KOG0892|consensus
Probab=99.93  E-value=5.1e-28  Score=208.65  Aligned_cols=76  Identities=33%  Similarity=0.484  Sum_probs=71.3

Q ss_pred             ccceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchhee-eeEEe
Q psy16910          2 NNSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVAL-SSEVG   78 (82)
Q Consensus         2 ~~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~-~~~~~   78 (82)
                      .+||+|||||+||||.+|||||..||+++|||+|-+|+.+ +.++.||.|||||||++++.||-+|+||+|| ||+.+
T Consensus      2619 ~sS~VGyILGLGDRH~qNILid~~taEviHIDlGiAFEQG-kilptPE~VPFRLTRDiVdgmGItGveGvFrRccE~t 2695 (2806)
T KOG0892|consen 2619 ASSMVGYILGLGDRHGQNILIDQQTAEVIHIDLGIAFEQG-KILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEFT 2695 (2806)
T ss_pred             HHHHHHHHhcccchhhhheeecccccceEEEeeeeehhcC-CcCCCCCcccceeehhhccccCccCchHHHHHHHHHH
Confidence            3699999999999999999999999999999999999999 5799999999999999999999999999997 56543


No 16 
>cd05167 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), Type III, alpha isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIalpha is a 220 kDa protein found in the plasma membrane and the endoplasmic reticulum (ER). The role of PI4KIIIalpha in the ER remains unclear. In the plasma membrane, it provides PtdIns(4)P, which is then converted by PI5Ks to PtdIns(4,5)P2, an important signaling mole
Probab=99.93  E-value=9.6e-28  Score=177.86  Aligned_cols=70  Identities=24%  Similarity=0.289  Sum_probs=62.0

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchhee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVAL   73 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~   73 (82)
                      -|++||+|||||||++||||+ .+|+++|||||++|+.+++....+|++|||||++|+++||+.+.++.|+
T Consensus       155 ysv~tYiLgigDRHn~NILid-~~G~l~HIDFG~il~~~p~~~~~~E~~PFkLT~emv~~mGg~~~s~~f~  224 (311)
T cd05167         155 YSLISYLLQIKDRHNGNIMID-DDGHIIHIDFGFIFEISPGGNLKFESAPFKLTKEMVQIMGGSMEATPFK  224 (311)
T ss_pred             HHHHHHHhhccccCccceEEc-CCCCEEEEeeHHhhccCCCCCCCcCCCCEeecHHHHHHhCCCCcchhHH
Confidence            489999999999999999999 5999999999999999875423479999999999999999999666553


No 17 
>cd00894 PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), class IB, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and 
Probab=99.93  E-value=7.4e-27  Score=176.18  Aligned_cols=66  Identities=36%  Similarity=0.546  Sum_probs=60.3

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCC-CCCCceeecHHHHHhhCCCCCc
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPFRLTPHILAVNEPYGSQ   69 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~-~E~vPFRLT~~~~~~~g~~g~e   69 (82)
                      -|++||||||||||++||||+ .+|+++|||||++|+..++.+.+ +|++|||||++|+++||+.|.+
T Consensus       207 YsV~tYiLGIgDRHndNImi~-~~G~lfHIDFG~ilg~~~~~~gi~~E~~PFkLT~e~v~vmg~~gg~  273 (365)
T cd00894         207 YCVATFVLGIGDRHNDNIMIT-ETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKK  273 (365)
T ss_pred             HHHHHHhccccCccccceeEc-CCCCEEEEeeHHhhCCCCccCCCCCCCCCeeecHHHHHHhCccCCc
Confidence            489999999999999999998 79999999999999998766654 9999999999999999987655


No 18 
>cd00896 PI3Kc_III Phosphoinositide 3-kinase (PI3K), class III, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class III PI3Ks, also called Vps34 (vacuolar protein sorting 34), contain an N-terminal lipid binding C2 domain, a PI3K homology domain of unknown function, and a C-termin
Probab=99.93  E-value=3.9e-27  Score=176.73  Aligned_cols=67  Identities=30%  Similarity=0.460  Sum_probs=61.8

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCch--heee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQE--VALS   74 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG--~f~~   74 (82)
                      -|++||+|||||||++||||+ .+|+++|||||++|+.+++    |+.||||||++|+++||+.+++|  .|+.
T Consensus       197 ysvv~YiLGigDRH~~NILi~-~~G~~~HIDFG~ilg~~p~----~~~~PFrLT~~mv~~mGg~~s~~~~~F~~  265 (350)
T cd00896         197 YCVITYILGVGDRHLDNLLLT-KDGKLFHIDFGYILGRDPK----PFPPPMKLCKEMVEAMGGAQSEGYQEFKS  265 (350)
T ss_pred             HHHHHHHhcccccCCCcEEEc-CCCCEEEEEhHHhhCCCCC----CCCCCeeccHHHHHHhCCCCCcchHHHHH
Confidence            489999999999999999998 7999999999999999864    67799999999999999999999  6763


No 19 
>PF00454 PI3_PI4_kinase:  Phosphatidylinositol 3- and 4-kinase;  InterPro: IPR000403 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Phosphatidylinositol 3-kinase (PI3-kinase) (2.7.1.137 from EC) [] is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. The three products of PI3-kinase - PI-3-P, PI-3,4-P(2) and PI-3,4,5-P(3) function as secondary messengers in cell signalling. Phosphatidylinositol 4-kinase (PI4-kinase) (2.7.1.67 from EC) [] is an enzyme that acts on phosphatidylinositol (PI) in the first committed step in the production of the secondary messenger inositol-1'4'5'-trisphosphate. This domain is also present in a wide range of protein kinases, involved in diverse cellular functions, such as control of cell growth, regulation of cell cycle progression, a DNA damage checkpoint, recombination, and maintenance of telomere length. Despite significant homology to lipid kinases, no lipid kinase activity has been demonstrated for any of the PIK-related kinases []. The PI3- and PI4-kinases share a well conserved domain at their C-terminal section; this domain seems to be distantly related to the catalytic domain of protein kinases [, ]. The catalytic domain of PI3K has the typical bilobal structure that is seen in other ATP-dependent kinases, with a small N-terminal lobe and a large C-terminal lobe. The core of this domain is the most conserved region of the PI3Ks. The ATP cofactor binds in the crevice formed by the N-and C-terminal lobes, a loop between two strands provides a hydrophobic pocket for binding of the adenine moiety, and a lysine residue interacts with the alpha-phosphate. In contrast to protein kinases, the PI3K loop which interacts with the phosphates of the ATP and is known as the glycine-rich or P-loop, contains no glycine residues. Instead, contact with the ATP -phosphate is maintained through the side chain of a conserved serine residue.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 2WXL_A 4AJW_B 2WXQ_A 2WXP_A 2WXM_A 2WXH_A 2WXK_A 2WXG_A 2X38_A 2WXF_A ....
Probab=99.92  E-value=7.8e-28  Score=168.45  Aligned_cols=73  Identities=41%  Similarity=0.640  Sum_probs=59.2

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhh----CCCCCchheeeeEE
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVN----EPYGSQEVALSSEV   77 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~----g~~g~eG~f~~~~~   77 (82)
                      .|+++|++|+|||||+|||++..||+++|||||++|+ . +..+.+|.||||||++|+++|    ++.|.+|.|+.++.
T Consensus       129 ~si~~yilg~gDRh~~Nili~~~~g~~~hIDfg~~f~-~-~~~~~~e~vPFrLT~~~~~~~~~~l~~~~~~g~f~~~~~  205 (235)
T PF00454_consen  129 YSILDYILGLGDRHPGNILIDKKTGELIHIDFGFIFG-G-KHLPVPETVPFRLTRNMVNAMGGYLGPSGVEGLFRSSCE  205 (235)
T ss_dssp             HHHHHHHHT-CS--TTTEEE-ETTSEEEE--HSSCTT-H-HHGSSSS--SSTTHHHHHHHTTTSSSTSHHHHHHHHHHH
T ss_pred             HhhceEEEeecCCCchhheeccccceeeeEEeHHhhh-c-cccCCCCCCCeEeCHHHHHHHhccCCCchhHhHHHHHHH
Confidence            5899999999999999999999999999999999999 3 456889999999999999999    99999999986543


No 20 
>COG5032 TEL1 Phosphatidylinositol kinase and protein kinases of the PI-3 kinase family [Signal transduction mechanisms / Cell division and chromosome partitioning / Chromatin structure and dynamics / DNA replication, recombination, and repair / Intracellular trafficking and secretion]
Probab=99.92  E-value=4.6e-27  Score=203.09  Aligned_cols=78  Identities=32%  Similarity=0.492  Sum_probs=72.8

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheee-eEEeee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALS-SEVGFQ   80 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~-~~~~~q   80 (82)
                      .|++||+||+|||||+|||+|+.||+++|||||++++..++.++.||.||||||++++++||+.|.||.|+. |+.+++
T Consensus      1937 ySvigYiLglgDRH~~NIliD~~sG~viHiDFg~il~~~p~~~~~pE~vPFrLT~~iv~~mg~~g~EG~Fr~~c~~~~~ 2015 (2105)
T COG5032        1937 YSVIGYILGLGDRHPGNILIDRSSGHVIHIDFGFILFNAPGRFPFPEKVPFRLTRNIVEAMGVSGVEGSFRELCETAFR 2015 (2105)
T ss_pred             HHHHHHHccCCCcCCceEEEEcCCCcEEEehHHHHHhcCCCCCCCcccCcHhhhHHHHHhcCccchhhHHHHHHHHHHH
Confidence            589999999999999999999889999999999999999999999999999999999999999999999984 555544


No 21 
>cd05173 PI3Kc_IA_beta Phosphoinositide 3-kinase (PI3K), class IA, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and de
Probab=99.92  E-value=1.6e-26  Score=174.21  Aligned_cols=71  Identities=30%  Similarity=0.341  Sum_probs=60.5

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCC-CCCCCceeecHHHHHhhC-C-CC---Cchheee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLP-IPELMPFRLTPHILAVNE-P-YG---SQEVALS   74 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~-~~E~vPFRLT~~~~~~~g-~-~g---~eG~f~~   74 (82)
                      -|++||||||||||++||||+ .+|+++|||||++|+..++.+. .||+||||||++|+++|| + .|   .+|.|+.
T Consensus       203 YsvvtYILGIGDRHn~NILi~-~~G~l~HIDFG~ilg~~~~~~~~~~E~vPFkLT~emv~vm~~G~~g~s~~~~~F~~  279 (362)
T cd05173         203 YCVATYVLGIGDRHSDNIMVR-KNGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQ  279 (362)
T ss_pred             HHHHHHHhhccccCCCceEEC-CCCCEEEEehHHhhccCCcccCCCCCCCCeeecHHHHHHHhcCCCCCCcchhHHHH
Confidence            489999999999999999998 7999999999999998765554 489999999999999996 2 23   3566763


No 22 
>cd05174 PI3Kc_IA_delta Phosphoinositide 3-kinase (PI3K), class IA, delta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and 
Probab=99.92  E-value=6.2e-26  Score=170.99  Aligned_cols=62  Identities=29%  Similarity=0.401  Sum_probs=56.6

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCC-CCCCCceeecHHHHHhhCC
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLP-IPELMPFRLTPHILAVNEP   65 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~-~~E~vPFRLT~~~~~~~g~   65 (82)
                      -|++||||||||||++||||+ .+|+++|||||++|+..++.+. .||+||||||++|+++||.
T Consensus       203 ysVvtYiLGIGDRHn~NILi~-~~G~l~HIDFG~ilg~~~~~~~~~~E~vPFkLT~e~v~vmg~  265 (361)
T cd05174         203 YCVATYVLGIGDRHSDNIMIR-ESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQ  265 (361)
T ss_pred             HHHHHHHhcccCcCccceeEc-CCCCEEEEehHHhhcCCcccCCCCCCCCCeeccHHHHHHHcc
Confidence            489999999999999999997 7999999999999998766554 4899999999999999974


No 23 
>cd05166 PI3Kc_II Phosphoinositide 3-kinase (PI3K), class II, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do not associate with any
Probab=99.91  E-value=1.3e-25  Score=168.74  Aligned_cols=70  Identities=24%  Similarity=0.259  Sum_probs=60.5

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCC-CCCCCceeecHHHHHhhCCCC----Cchhee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLP-IPELMPFRLTPHILAVNEPYG----SQEVAL   73 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~-~~E~vPFRLT~~~~~~~g~~g----~eG~f~   73 (82)
                      -|++||||||||||++||||+ .+|+++|||||++|+..++... .+|+||||||++|+++||+.|    ..+.|+
T Consensus       197 ysvv~YiLgigDRH~~NILl~-~~G~l~HIDFG~~lg~~~~~~~~~~E~~PFrLT~emv~~~ggg~~~s~~~~~F~  271 (353)
T cd05166         197 CCVATYVLGICDRHNDNIMLT-KSGHMFHIDFGKFLGHAQMFGGFKRDRAPFVFTSDMAYVINGGDKPTQRFQDFV  271 (353)
T ss_pred             HHHHHHHhhccccCCCceEEC-CCCCEEEEeeHHhcccccccccCCCCCCCccccHHHHHHhcCCCCCcchHhHHH
Confidence            489999999999999999998 7999999999999999875544 389999999999999998653    234565


No 24 
>cd05175 PI3Kc_IA_alpha Phosphoinositide 3-kinase (PI3K), class IA, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and 
Probab=99.91  E-value=2.1e-25  Score=168.37  Aligned_cols=62  Identities=31%  Similarity=0.383  Sum_probs=57.2

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCC-CCCCCceeecHHHHHhhCC
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLP-IPELMPFRLTPHILAVNEP   65 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~-~~E~vPFRLT~~~~~~~g~   65 (82)
                      -|++||||||||||++||||+ .+|+++|||||++|+.+++.+. .||++|||||++|+.+||+
T Consensus       206 YsV~tYiLGIgDRHndNImi~-~~G~l~HIDFG~iLg~~p~~~~~~~E~~PFkLT~emv~v~~g  268 (366)
T cd05175         206 YCVATFILGIGDRHNSNIMVK-DDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISK  268 (366)
T ss_pred             HHHHHHHhcccccCccceeEc-CCCCEEEEehHHhhcCCCccCCCCCCCCCeEecHHHHHHhcc
Confidence            489999999999999999998 7999999999999999987664 5999999999999999974


No 25 
>cd05176 PI3Kc_C2_alpha Phosphoinositide 3-kinase (PI3K), class II, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do n
Probab=99.91  E-value=4.4e-25  Score=166.02  Aligned_cols=64  Identities=28%  Similarity=0.303  Sum_probs=57.4

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCC-CCCCCceeecHHHHHhhCCCC
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLP-IPELMPFRLTPHILAVNEPYG   67 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~-~~E~vPFRLT~~~~~~~g~~g   67 (82)
                      -|++||+|||||||++||||+ .+|+++|||||++|+.+++... .+|++|||||++|+++||+..
T Consensus       197 Ysv~tYiLGIgDRHn~NILi~-~~Ghl~HIDFG~ilg~~~~~g~~~~e~~PFkLT~emv~~mgG~~  261 (353)
T cd05176         197 CCVATYVLGICDRHNDNIMLR-STGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGE  261 (353)
T ss_pred             HHHHhhhccccCcCCcceEEc-CCCCEEEEeeHHhcCCCccccCCCCCCCCeeecHHHHHHhcCCC
Confidence            489999999999999999997 8999999999999999875443 389999999999999998644


No 26 
>cd05177 PI3Kc_C2_gamma Phosphoinositide 3-kinase (PI3K), class II, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do n
Probab=99.91  E-value=3e-25  Score=166.93  Aligned_cols=67  Identities=24%  Similarity=0.319  Sum_probs=57.8

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCC-CCCCceeecHHHHHhh--CCCCCch
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPFRLTPHILAVN--EPYGSQE   70 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~-~E~vPFRLT~~~~~~~--g~~g~eG   70 (82)
                      -|++||||||||||++||||+ .+|+++|||||++|+.+++...+ +|++|||||++|+.++  |+.+.++
T Consensus       198 ysvvtYiLGigDRHn~NILi~-~~G~~~HIDFG~ilg~~~~~~~~~~E~~PF~LT~emv~~~~~GG~~s~~  267 (354)
T cd05177         198 WCVVTFILGVCDRHNDNIMLT-HSGHMFHIDFGKFLGHAQTFGSIKRDRAPFIFTSEMEYFITEGGKKPQR  267 (354)
T ss_pred             HHHHHHHhcccCcCCCceeEc-CCCCEEEEehHHhcCCCccccCCCcCCCCeeccHHHHHHhcCCCCCchh
Confidence            489999999999999999998 89999999999999999765443 8999999999999876  4444444


No 27 
>cd00895 PI3Kc_C2_beta Phosphoinositide 3-kinase (PI3K), class II, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do not
Probab=99.89  E-value=3.4e-24  Score=161.25  Aligned_cols=62  Identities=27%  Similarity=0.307  Sum_probs=55.9

Q ss_pred             ceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCC-CCCCCceeecHHHHHhhCCC
Q psy16910          4 SSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLP-IPELMPFRLTPHILAVNEPY   66 (82)
Q Consensus         4 S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~-~~E~vPFRLT~~~~~~~g~~   66 (82)
                      |++||+|||||||++||||+ .+|+++|||||++|+..++... .+|++||+||++|+++||+-
T Consensus       199 sV~tYiLgIgDRHndNImi~-~~GhlfHIDFG~iLg~~~~~g~~~re~~PF~Lt~emv~vm~gg  261 (354)
T cd00895         199 CVATYVLGICDRHNDNIMLK-TTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGG  261 (354)
T ss_pred             HHHHHHccccccCCCceeEc-CCCCEEEEeeHHhcCCCcccCCCCcCCCCccccHHHHHHhcCC
Confidence            78999999999999999997 8999999999999999865433 48999999999999999753


No 28 
>KOG0904|consensus
Probab=99.80  E-value=2.1e-20  Score=152.05  Aligned_cols=64  Identities=36%  Similarity=0.460  Sum_probs=60.0

Q ss_pred             ceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCC-CCCCceeecHHHHHhhCCCCC
Q psy16910          4 SSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPFRLTPHILAVNEPYGS   68 (82)
Q Consensus         4 S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~-~E~vPFRLT~~~~~~~g~~g~   68 (82)
                      +++||||||||||.+|||| +.||+.+|||||+++|+.+..+.+ .|+|||-||++++.+|+.-+.
T Consensus       919 cVATyVLGIgDRHsDNIMv-ke~GqlFHIDFGHiLGh~KsKlGi~RERvPFvLT~dFl~VI~~G~~  983 (1076)
T KOG0904|consen  919 CVATYVLGIGDRHSDNIMV-KETGQLFHIDFGHILGHFKSKLGINRERVPFVLTYDFLHVIQKGKT  983 (1076)
T ss_pred             eeeeeeecccccccCceEE-eccCcEEEEEhhhhhccchhhcCcccccCceEeecceeeeecccCC
Confidence            6899999999999999999 599999999999999999988887 999999999999999987654


No 29 
>KOG0903|consensus
Probab=99.75  E-value=4e-19  Score=142.93  Aligned_cols=64  Identities=30%  Similarity=0.405  Sum_probs=58.2

Q ss_pred             ceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCc
Q psy16910          4 SSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQ   69 (82)
Q Consensus         4 S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~e   69 (82)
                      |++||+|+|.|||++||||| ..|+|+|||||++++.+|..+. .|..||+||.+++++||+...+
T Consensus       691 SLvcYlLQvKDRHNGNILiD-~EGHIIHIDFGFmLsnsPgnvg-FEsAPFKLT~EylEvmgG~~~d  754 (847)
T KOG0903|consen  691 SLVCYLLQVKDRHNGNILID-EEGHIIHIDFGFMLSNSPGNVG-FESAPFKLTTEYLEVMGGLDSD  754 (847)
T ss_pred             HHHHHhhhcccccCCceEec-CCCCEEEEeeeeEecCCCCCcc-cccCchhhHHHHHHHhcCCcHH
Confidence            78999999999999999999 9999999999999999987555 6999999999999999954433


No 30 
>KOG0906|consensus
Probab=99.74  E-value=1.8e-18  Score=138.07  Aligned_cols=63  Identities=33%  Similarity=0.569  Sum_probs=57.0

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCch
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQE   70 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG   70 (82)
                      -|++||||||||||++|+|+ ..+|+++|||||++||.+++.++    .|.+|+++|+++||+..++-
T Consensus       689 YsVitYILGvGDRhldNLll-T~dGk~FHiDFgyIlGRDPKP~p----p~MkL~kemve~mgg~es~~  751 (843)
T KOG0906|consen  689 YSVITYILGVGDRHLDNLLL-TKDGKLFHIDFGYILGRDPKPFP----PPMKLAKEMVEGMGGAESKQ  751 (843)
T ss_pred             ceeeeeeecccCCCcCceEE-ccCCcEEEEeeeeeccCCCCCCC----CccccCHHHHHHhcccchHH
Confidence            38999999999999999999 59999999999999999988554    39999999999999987643


No 31 
>KOG0891|consensus
Probab=99.65  E-value=4e-18  Score=148.55  Aligned_cols=72  Identities=33%  Similarity=0.433  Sum_probs=68.8

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheee
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALS   74 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~   74 (82)
                      .|+++|++|+|||||+|.|+++.||++.|||||.||+..+...+.||.+|||||+++.++|.+.|.+|.++.
T Consensus      2133 msmvgyilGlGdrhpsNlmldr~tgkvihidfgdcfevA~~rek~pe~~pfRlTrmli~amev~gl~g~~~~ 2204 (2341)
T KOG0891|consen 2133 MSMVGYILGLGDRHPSNLMLDRLTGKVIHIDFGDCFEVAMLREKFPEKVPFRLTRMLINAMEVTGIEGTYRI 2204 (2341)
T ss_pred             HHHHHHHhhccccchhhhhhhhcccceEEechHHHHHHHHhhccccccccHHHHHHHHHhHHHHhhhhHHHH
Confidence            589999999999999999999999999999999999999887788999999999999999999999999863


No 32 
>KOG0902|consensus
Probab=99.59  E-value=7.2e-16  Score=130.14  Aligned_cols=62  Identities=29%  Similarity=0.338  Sum_probs=56.0

Q ss_pred             ceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCC
Q psy16910          4 SSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYG   67 (82)
Q Consensus         4 S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g   67 (82)
                      |+++|.|++.|||++|||+| ..|+++|||||++|+.+|+..-..|. ||+||.+|+.+||+.-
T Consensus      1648 sv~s~lLq~KDRHNGNim~D-d~G~~iHIDFGf~~e~sPGgnl~fE~-~fKLt~Em~~~mgG~~ 1709 (1803)
T KOG0902|consen 1648 SVLSYLLQIKDRHNGNIMID-DQGHIIHIDFGFMFESSPGGNLGFEP-PFKLTKEMVMLMGGKM 1709 (1803)
T ss_pred             HHHHHHcccccccCCceeEc-cCCCEEEEeeeeEEecCCCCccCcCC-CccchHHHHHHhCCCC
Confidence            78899999999999999999 99999999999999999875334577 9999999999999654


No 33 
>KOG0905|consensus
Probab=99.59  E-value=7.7e-16  Score=128.52  Aligned_cols=63  Identities=29%  Similarity=0.353  Sum_probs=55.2

Q ss_pred             ceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCC-CCCCceeecHHHHHhhCCCC
Q psy16910          4 SSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPFRLTPHILAVNEPYG   67 (82)
Q Consensus         4 S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~-~E~vPFRLT~~~~~~~g~~g   67 (82)
                      +++||||||+|||++|||+ ++||+++|||||-.+|...-.-.+ .+++||-+|.+|..+|.+-+
T Consensus      1192 cVaTYVLGIcDRHNDNIMl-~~sGHmFHIDFGKFLGhaQMfg~fKRDRaPFVfTSdMayvINgG~ 1255 (1639)
T KOG0905|consen 1192 CVATYVLGICDRHNDNIML-TKSGHMFHIDFGKFLGHAQMFGGFKRDRAPFVFTSDMAYVINGGD 1255 (1639)
T ss_pred             eeeeEeeecccccCCceEE-eccCcEEEEehhhhcchHHHhcccccccCCeEEeccchhhhcCCC
Confidence            6899999999999999999 699999999999999987532222 78999999999999987654


No 34 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=99.47  E-value=1.7e-14  Score=117.64  Aligned_cols=63  Identities=30%  Similarity=0.372  Sum_probs=52.1

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCC
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYG   67 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g   67 (82)
                      -|+++|+|||||||++||||+ .+|+++|||||++|+..+ .-...-.-|-|+...|...++.+-
T Consensus      1140 YsViTYILgIgDRHngNILId-~dGhLfHIDFGFILg~rt-fkeKl~~s~vR~D~~l~eav~~~q 1202 (1374)
T PTZ00303       1140 FLLLNYIFSIGDRHKGNVLIG-TNGALLHIDFRFIFSEKT-FVEKLARSTVRIDDAFLAAVEQCQ 1202 (1374)
T ss_pred             HHHHHHHhccCcccCCceeEc-CCCCEEEEecceeecCch-hhhccCCCceehhHHHHHHHHHHH
Confidence            378999999999999999997 999999999999999875 112234459999999999876543


No 35 
>KOG0889|consensus
Probab=98.90  E-value=1.1e-10  Score=104.48  Aligned_cols=74  Identities=23%  Similarity=0.295  Sum_probs=69.1

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeeeE
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSSE   76 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~~   76 (82)
                      +|+.+|++.++.|.|+.+++.+.||+++..||-+....+++.++..|.||||||||++.++|..|+||++..++
T Consensus      3378 ~~~~~~~lni~~~~p~k~~~~~dsG~v~~~~~~~~~~~~~~~~~~~~~VpFRlTpni~~~i~~~~veg~l~~s~ 3451 (3550)
T KOG0889|consen 3378 FSFMEYMLNINGRGPAKLTFAKDSGKVFNTDFLPSYISSKPIFHNNEPVPFRLTPNIQEFIGDFGVEGLLAGSM 3451 (3550)
T ss_pred             HHHHHHHHhcCCCCccceeeeeccccccchhhccCcccCccccccCCcCCeeecCCchhhhcchhhhhhhHHHH
Confidence            57889999999999999999999999999999999988888899999999999999999999999999986543


No 36 
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=92.57  E-value=0.11  Score=34.96  Aligned_cols=25  Identities=28%  Similarity=0.224  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=+|+||+++  +|++.=||||.+-.
T Consensus       142 rDlkP~NIll~--~~~~~liDFG~a~~  166 (190)
T cd05145         142 GDLSEYNILYH--DGKPYIIDVSQAVE  166 (190)
T ss_pred             CCCChhhEEEE--CCCEEEEEccccee
Confidence            68899999997  79999999996543


No 37 
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=92.36  E-value=0.13  Score=35.19  Aligned_cols=26  Identities=27%  Similarity=0.138  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|=+|+|||++  +|++.=||||.+-..
T Consensus       142 rDlkP~NIli~--~~~v~LiDFG~a~~~  167 (190)
T cd05147         142 ADLSEYNLLYH--DGKLYIIDVSQSVEH  167 (190)
T ss_pred             CCCCHHHEEEE--CCcEEEEEccccccC
Confidence            68899999997  589999999976433


No 38 
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=91.39  E-value=0.23  Score=31.85  Aligned_cols=27  Identities=30%  Similarity=0.186  Sum_probs=22.5

Q ss_pred             eeeCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         10 YSIGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        10 lgigDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +.=||=||+||+++  .+++.-|||+.+-
T Consensus       109 ~~HgD~~~~Nil~~--~~~~~liDf~~a~  135 (170)
T cd05151         109 PCHNDLLPGNFLLD--DGRLWLIDWEYAG  135 (170)
T ss_pred             eecCCCCcCcEEEE--CCeEEEEeccccc
Confidence            44589999999997  6789999998643


No 39 
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=91.13  E-value=0.26  Score=33.10  Aligned_cols=29  Identities=24%  Similarity=0.149  Sum_probs=24.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecccc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGVAT   42 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~~~   42 (82)
                      +|=+|+||+++ .+|++.=+|||.+.....
T Consensus       149 ~Dl~p~Nill~-~~~~~~liDfg~~~~~~~  177 (198)
T cd05144         149 GDLSEFNILVD-DDEKIYIIDWPQMVSTDH  177 (198)
T ss_pred             CCCCcccEEEc-CCCcEEEEECCccccCCC
Confidence            57799999998 689999999998766654


No 40 
>COG0661 AarF Predicted unusual protein kinase [General function prediction only]
Probab=91.02  E-value=0.2  Score=40.00  Aligned_cols=23  Identities=48%  Similarity=0.657  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeece
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGY   36 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~   36 (82)
                      +|=||+||+++ ..|+++-+|||.
T Consensus       289 aDpHpGNi~v~-~~g~i~~lDfGi  311 (517)
T COG0661         289 ADPHPGNILVR-SDGRIVLLDFGI  311 (517)
T ss_pred             cCCCccceEEe-cCCcEEEEcCcc
Confidence            68999999997 779999999995


No 41 
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=90.71  E-value=0.26  Score=32.70  Aligned_cols=23  Identities=35%  Similarity=0.485  Sum_probs=20.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      ||=+|+||+++  .|++.-|||+.+
T Consensus       114 ~Dl~~~Nil~~--~~~~~liDfg~a  136 (199)
T TIGR03724       114 GDLTTSNIIVR--DDKLYLIDFGLG  136 (199)
T ss_pred             CCCCcceEEEE--CCcEEEEECCCC
Confidence            78999999997  799999999853


No 42 
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=89.67  E-value=0.28  Score=39.30  Aligned_cols=24  Identities=33%  Similarity=0.537  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCC----cEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTG----RCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG----~v~hiDfg~~   37 (82)
                      +|=||+||+++ .+|    ++.-+|||.+
T Consensus       284 aDpHPGNIlv~-~~g~~~~~i~llDFGiv  311 (537)
T PRK04750        284 ADMHPGNIFVS-YDPPENPRYIALDFGIV  311 (537)
T ss_pred             CCCChHHeEEe-cCCCCCCeEEEEecceE
Confidence            78999999997 556    9999999965


No 43 
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=89.45  E-value=0.32  Score=37.54  Aligned_cols=24  Identities=38%  Similarity=0.659  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=||+||+++ .+|++.-+|||.+
T Consensus       281 ~D~hPgNilv~-~~g~i~liDfG~~  304 (437)
T TIGR01982       281 ADLHPGNIFVL-KDGKIIALDFGIV  304 (437)
T ss_pred             CCCCcccEEEC-CCCcEEEEeCCCe
Confidence            69999999995 8899999999965


No 44 
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=89.42  E-value=0.37  Score=31.60  Aligned_cols=27  Identities=30%  Similarity=0.288  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      +|=+|+||+++  +|.+.-+|||.+-...
T Consensus       139 ~Dl~p~Nili~--~~~~~liDfg~a~~~~  165 (187)
T cd05119         139 GDLSEYNILVD--DGKVYIIDVPQAVEID  165 (187)
T ss_pred             CCCChhhEEEE--CCcEEEEECccccccc
Confidence            57799999998  8999999999764433


No 45 
>TIGR03843 conserved hypothetical protein. This model represents a protein family largely restricted to the Actinobacteria (high-GC Gram-positives), although it is also found in the Chloroflexi. Distant similarity to the phosphatidylinositol 3- and 4-kinase is suggested by the matching of some members to pfam00454.
Probab=89.21  E-value=0.57  Score=34.56  Aligned_cols=37  Identities=27%  Similarity=0.328  Sum_probs=31.4

Q ss_pred             eeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccC
Q psy16910          6 LLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQ   43 (82)
Q Consensus         6 ~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~   43 (82)
                      +=+++.=.|||.+|||.. .+|+++-||=|.+|....+
T Consensus       141 fDi~inNaDRk~GhiL~~-~dg~l~~IDHGl~f~~~~k  177 (253)
T TIGR03843       141 FDALVNNADRKGGHVLPG-PDGRVWGVDHGVCFHVEPK  177 (253)
T ss_pred             heeeeecCCCCCCcEeEc-CCCcEEEecCceecCCCCc
Confidence            345666689999999996 6999999999999998754


No 46 
>PRK14879 serine/threonine protein kinase; Provisional
Probab=89.02  E-value=0.45  Score=31.76  Aligned_cols=23  Identities=35%  Similarity=0.589  Sum_probs=20.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      ||=+|+|||++  .+.+.-|||+.+
T Consensus       119 ~Dl~p~Nil~~--~~~~~liDf~~a  141 (211)
T PRK14879        119 GDLTTSNMILS--GGKIYLIDFGLA  141 (211)
T ss_pred             CCCCcccEEEE--CCCEEEEECCcc
Confidence            78999999997  799999999854


No 47 
>PF01636 APH:  Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.;  InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation []. The proteins are found in a range of taxonomic groups.; PDB: 2PPQ_A 2Q83_B 3TDV_B 3TDW_A 3I0O_A 3I0Q_A 3I1A_B 3Q2M_A 3HAV_C 2PUI_B ....
Probab=88.92  E-value=0.43  Score=31.51  Aligned_cols=31  Identities=35%  Similarity=0.267  Sum_probs=22.0

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .+.+.=||=||+|||++...|++.-|||..+
T Consensus       165 ~~~~~HgD~~~~Nil~~~~~~~i~iID~e~a  195 (239)
T PF01636_consen  165 PPVLIHGDLHPGNILVDPSDGRIGIIDFEDA  195 (239)
T ss_dssp             CEEEE-SS-SGGGEEEESSTTEEEE--GTT-
T ss_pred             CcEEEEeccccccceeeeccceeEEEecccc
Confidence            4567779999999999877888888999764


No 48 
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancer
Probab=88.48  E-value=0.62  Score=33.24  Aligned_cols=32  Identities=28%  Similarity=0.333  Sum_probs=27.5

Q ss_pred             eeeeeeeCCCCCCcEEEEcC---CCcEEEEeecee
Q psy16910          6 LLLEYSIGDRHLENTLVCTK---TGRCVGIDFGYS   37 (82)
Q Consensus         6 ~~yilgigDRh~~nili~~~---tG~v~hiDfg~~   37 (82)
                      ..+++.=||=|++|||++..   ++++.-|||.++
T Consensus       177 ~~~~lcH~Dl~~~Nil~~~~~~~~~~i~lIDwEya  211 (302)
T cd05156         177 SPVVFCHNDLQEGNILLLNPSSETKKLVLIDFEYA  211 (302)
T ss_pred             CCceEEecCCCcCeEEecCCCCCCCcEEEEeeCCC
Confidence            45788999999999999843   589999999876


No 49 
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=87.77  E-value=0.45  Score=34.31  Aligned_cols=22  Identities=41%  Similarity=0.468  Sum_probs=19.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeece
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGY   36 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~   36 (82)
                      ||=||+||+++ ..| +.-||||.
T Consensus       159 ~Dikp~Nili~-~~g-i~liDfg~  180 (232)
T PRK10359        159 GDPHKGNFIVS-KNG-LRIIDLSG  180 (232)
T ss_pred             CCCChHHEEEe-CCC-EEEEECCC
Confidence            79999999997 677 99999984


No 50 
>KOG0616|consensus
Probab=87.21  E-value=0.43  Score=36.55  Aligned_cols=24  Identities=33%  Similarity=0.477  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|--|+|||+| ++|.+=-+|||++
T Consensus       168 RDLKPENiLlD-~~G~iKitDFGFA  191 (355)
T KOG0616|consen  168 RDLKPENLLLD-QNGHIKITDFGFA  191 (355)
T ss_pred             ccCChHHeeec-cCCcEEEEeccce
Confidence            47789999998 9999999999986


No 51 
>smart00090 RIO RIO-like kinase.
Probab=86.41  E-value=0.66  Score=32.83  Aligned_cols=26  Identities=38%  Similarity=0.408  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|=+|+||+++  ++++.=||||.+...
T Consensus       173 ~Dikp~NIli~--~~~i~LiDFg~a~~~  198 (237)
T smart00090      173 GDLSEYNILVH--DGKVVIIDVSQSVEL  198 (237)
T ss_pred             CCCChhhEEEE--CCCEEEEEChhhhcc
Confidence            68899999997  899999999965433


No 52 
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=86.07  E-value=0.73  Score=32.57  Aligned_cols=24  Identities=29%  Similarity=0.342  Sum_probs=20.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+|||++ .+|++.-|||+.+
T Consensus       166 rDlkp~NILv~-~~~~v~LIDfg~~  189 (239)
T PRK01723        166 ADLNAHNILLD-PDGKFWLIDFDRG  189 (239)
T ss_pred             CCCCchhEEEc-CCCCEEEEECCCc
Confidence            58899999997 5789999999843


No 53 
>PF01633 Choline_kinase:  Choline/ethanolamine kinase;  InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2.7.1.32 from EC) belongs to the choline/ethanolamine kinase family. Ethanolamine and choline are major membrane phospholipids, in the form of glycerophosphoethanolamine and glycerophosphocholine. Ethanolamine is also a component of the glycosylphosphatidylinositol (GPI) anchor, which is necessary for cell-surface protein attachment []. The de novo synthesis of these phospholipids begins with the creation of phosphoethanolamine and phosphocholine by ethanolamine and choline kinases in the first step of the CDP-ethanolamine pathway [, ]. There are two putative choline/ethanolamine kinases (C/EKs) in the Trypanosoma brucei genome.  Ethanolamine kinase has no choline kinase activity [] and its activity is inhibited by ADP []. Inositol supplementation represses ethanolamine kinase, decreasing the incorporation of ethanolamine into the CDP-ethanolamine pathway and into phosphatidylethanolamine and phosphatidylcholine []. ; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 3C5I_A 2IG7_A 3LQ3_A 3FEG_A 2QG7_E 3FI8_A 1NW1_A 3MES_A 3G15_A 2CKP_B ....
Probab=84.71  E-value=0.63  Score=31.67  Aligned_cols=30  Identities=33%  Similarity=0.479  Sum_probs=21.7

Q ss_pred             eeeeeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910          8 LEYSIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus         8 yilgigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .+++=+|=+++|||++..++++.-|||-++
T Consensus       143 ~v~cHnDl~~~Nil~~~~~~~~~lIDfEya  172 (211)
T PF01633_consen  143 LVFCHNDLNPGNILINNKDGEVKLIDFEYA  172 (211)
T ss_dssp             EEEE-S--SGGGEEETSSSSCEEE--GTT-
T ss_pred             ceEeeccCccccEEeccCCCeEEEecHHHH
Confidence            578889999999999779999999999876


No 54 
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=84.46  E-value=1.2  Score=26.81  Aligned_cols=24  Identities=38%  Similarity=0.368  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      ||=+|+||+++ .++.+.-+||+.+
T Consensus       113 ~Dl~~~Nil~~-~~~~~~l~Df~~~  136 (155)
T cd05120         113 GDLHPGNILVD-DGKILGIIDWEYA  136 (155)
T ss_pred             cCCCcceEEEE-CCcEEEEEecccc
Confidence            78899999998 5899999999854


No 55 
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase
Probab=84.41  E-value=1.4  Score=32.46  Aligned_cols=35  Identities=20%  Similarity=0.191  Sum_probs=29.5

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      ..++.=+|=+++|||++...+++.-|||.++--..
T Consensus       181 ~~v~CHnDl~~~NiL~~~~~~~l~lID~EYag~nd  215 (330)
T PLN02421        181 PVVFAHNDLLSGNLMLNEDEGKLYFIDFEYGSYSY  215 (330)
T ss_pred             CeEEEECCCCcccEEEeCCCCcEEEEcccccCCCc
Confidence            35788899999999998677899999999885444


No 56 
>KOG0608|consensus
Probab=83.36  E-value=0.9  Score=38.37  Aligned_cols=24  Identities=29%  Similarity=0.416  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|--|+||||| ..|+|--+|||.|
T Consensus       753 RDiKPDNILID-rdGHIKLTDFGLC  776 (1034)
T KOG0608|consen  753 RDIKPDNILID-RDGHIKLTDFGLC  776 (1034)
T ss_pred             cccCccceEEc-cCCceeeeecccc
Confidence            36679999999 8999999999988


No 57 
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate, and displays negligible activity towards N-methylated derivatives of Etn. The Drosophila ETNK is implicated in development and neuronal function. Mammals contain two ETNK proteins, ETNK1 and ETNK2. ETNK1 selectively increases Etn uptake and phosphorylation, as well as PtdEtn synthesis. ETNK2 is found primarily in the liver and reproductive tissues. It plays a critical role in regulating placental hemostasis to support late embryo
Probab=83.18  E-value=2.2  Score=29.12  Aligned_cols=32  Identities=16%  Similarity=0.148  Sum_probs=26.4

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      ..++.=||=|++|||++..++.+.=|||-++-
T Consensus       169 ~~~l~H~Dl~~~Nil~~~~~~~~~lIDwe~a~  200 (235)
T cd05157         169 PIVFCHNDLLSGNIIYNEEKNSVKFIDYEYAG  200 (235)
T ss_pred             CEEEEcCCCCcCcEEEeCCCCCEEEEEcccCC
Confidence            45788899999999998436889999998653


No 58 
>KOG0984|consensus
Probab=82.52  E-value=1.1  Score=33.24  Aligned_cols=23  Identities=35%  Similarity=0.410  Sum_probs=20.6

Q ss_pred             CCCCCcEEEEcCCCcEEEEeecee
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      |-.|+||||+ ..|+|-.+|||-+
T Consensus       174 DvKPsNiLIn-~~GqVKiCDFGIs  196 (282)
T KOG0984|consen  174 DVKPSNILIN-YDGQVKICDFGIS  196 (282)
T ss_pred             cCCcceEEEc-cCCcEEEcccccc
Confidence            5679999998 9999999999965


No 59 
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins. This subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of bacterial and eukaryotic proteins with similarity to the N-terminal domains of vertebrate ACAD10 and ACAD11. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis, among them. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and is highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 contain
Probab=81.96  E-value=1.5  Score=28.90  Aligned_cols=31  Identities=19%  Similarity=0.188  Sum_probs=23.5

Q ss_pred             eeeeeeCCCCCCcEEEEcC-CCcEEEEeecee
Q psy16910          7 LLEYSIGDRHLENTLVCTK-TGRCVGIDFGYS   37 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~-tG~v~hiDfg~~   37 (82)
                      -+.+-=||=|++||+++.+ ++.+.=|||..+
T Consensus       173 ~~~l~HgD~~~~Nil~~~~~~~~~~iID~e~~  204 (223)
T cd05154         173 RPGLVHGDYRLGNVLFHPDEPRVVAVLDWELA  204 (223)
T ss_pred             CcEEEECCCCcccEEEcCCCCcEEEEEecccc
Confidence            3456669999999999754 455778999754


No 60 
>cd05153 HomoserineK_II Homoserine Kinase, type II. Homoserine kinase is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a PK fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine.
Probab=81.85  E-value=1.3  Score=31.31  Aligned_cols=29  Identities=21%  Similarity=0.086  Sum_probs=22.5

Q ss_pred             eeeeeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910          8 LEYSIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus         8 yilgigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +.+.=||=||+|++++ .++.+.-|||..+
T Consensus       175 ~~l~HgD~~~~Nil~~-~~~~~~iIDfe~a  203 (296)
T cd05153         175 RGVIHADLFRDNVLFD-GDELSGVIDFYFA  203 (296)
T ss_pred             CcCCccCcCcccEEEe-CCceEEEeehhhh
Confidence            4455699999999997 5555679999764


No 61 
>KOG0598|consensus
Probab=81.18  E-value=0.85  Score=35.16  Aligned_cols=24  Identities=33%  Similarity=0.393  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|=-|+|||+| ..|++.-+|||.+
T Consensus       149 RDlKPENILLd-~~GHi~LtDFgL~  172 (357)
T KOG0598|consen  149 RDLKPENILLD-EQGHIKLTDFGLC  172 (357)
T ss_pred             ccCCHHHeeec-CCCcEEEeccccc
Confidence            46789999998 9999999999976


No 62 
>PRK12274 serine/threonine protein kinase; Provisional
Probab=81.08  E-value=1.6  Score=31.41  Aligned_cols=25  Identities=32%  Similarity=0.311  Sum_probs=20.7

Q ss_pred             CCC-CCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDR-HLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDR-h~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|= .|+|||++ .+|++.-||||.+-
T Consensus       115 rDL~kp~NILv~-~~g~i~LIDFG~A~  140 (218)
T PRK12274        115 NDLAKEANWLVQ-EDGSPAVIDFQLAV  140 (218)
T ss_pred             CCCCCcceEEEc-CCCCEEEEECCCce
Confidence            555 57999997 78999999999764


No 63 
>PF06176 WaaY:  Lipopolysaccharide core biosynthesis protein (WaaY);  InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY). The waaY, waaQ, and waaP genes are located in the central operon of the waa (formerly rfa) locus on the chromosome of Escherichia coli. This locus contains genes whose products are involved in the assembly of the core region of the lipopolysaccharide molecule. WaaY is the enzyme that phosphorylates HepII in this system [].; GO: 0009244 lipopolysaccharide core region biosynthetic process
Probab=79.80  E-value=1.9  Score=31.33  Aligned_cols=22  Identities=36%  Similarity=0.274  Sum_probs=19.0

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFG   35 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg   35 (82)
                      =||=||+|++++  .+.+.-||++
T Consensus       158 HGD~hpgNFlv~--~~~i~iID~~  179 (229)
T PF06176_consen  158 HGDPHPGNFLVS--NNGIRIIDTQ  179 (229)
T ss_pred             cCCCCcCcEEEE--CCcEEEEECc
Confidence            389999999995  5669999997


No 64 
>PF01163 RIO1:  RIO1 family;  InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date.   Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=78.63  E-value=2.7  Score=29.14  Aligned_cols=42  Identities=29%  Similarity=0.261  Sum_probs=26.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHh
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAV   62 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~   62 (82)
                      ||=++.||+++  .|+++-|||+-+.....      +..-.-|.+++.++
T Consensus       131 GDLs~~NIlv~--~~~~~iIDf~qav~~~~------p~a~~~l~RDi~ni  172 (188)
T PF01163_consen  131 GDLSEYNILVD--DGKVYIIDFGQAVDSSH------PNAEELLRRDIENI  172 (188)
T ss_dssp             SS-STTSEEEE--TTCEEE--GTTEEETTS------TTHHHHHHHHHHHH
T ss_pred             cCCChhhEEee--cceEEEEecCcceecCC------ccHHHHHHHHHHHH
Confidence            88999999996  34999999997766552      22234456665554


No 65 
>KOG0658|consensus
Probab=78.05  E-value=1.7  Score=33.59  Aligned_cols=25  Identities=36%  Similarity=0.327  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|=-|+|||+|..||.+=-.|||.+
T Consensus       149 RDIKPqNlLvD~~tg~LKicDFGSA  173 (364)
T KOG0658|consen  149 RDIKPQNLLVDPDTGVLKICDFGSA  173 (364)
T ss_pred             CCCChheEEEcCCCCeEEeccCCcc
Confidence            4668999999999999999999953


No 66 
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=77.85  E-value=3  Score=27.41  Aligned_cols=31  Identities=29%  Similarity=0.320  Sum_probs=25.0

Q ss_pred             eeeCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         10 YSIGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        10 lgigDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      +--||-+|+||+++ .+|++.=+||+.+....
T Consensus       119 i~h~dl~p~ni~i~-~~~~~~l~d~~~~~~~~  149 (253)
T cd05122         119 IIHRDIKAANILLT-SDGEVKLIDFGLSAQLS  149 (253)
T ss_pred             EecCCCCHHHEEEc-cCCeEEEeecccccccc
Confidence            34589999999997 78999999998764443


No 67 
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172. This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by PFAM model pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics. However, members of this family score below the current trusted and noise cutoffs for pfam01636.
Probab=77.66  E-value=2.2  Score=29.97  Aligned_cols=25  Identities=28%  Similarity=0.323  Sum_probs=20.7

Q ss_pred             eeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         11 SIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .=||=||+||+++ .+| +.=|||..+
T Consensus       156 ~HgD~~~~Nii~~-~~~-~~iIDwe~a  180 (226)
T TIGR02172       156 LHGDFQIGNLITS-GKG-TYWIDLGDF  180 (226)
T ss_pred             EecCCCCCcEEEc-CCC-cEEEechhc
Confidence            4589999999996 566 889999864


No 68 
>KOG0594|consensus
Probab=76.88  E-value=1.9  Score=32.79  Aligned_cols=27  Identities=26%  Similarity=0.320  Sum_probs=22.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -|=.|+||||+ ++|.+--+|||-+-..
T Consensus       144 RDLKPQNlLi~-~~G~lKlaDFGlAra~  170 (323)
T KOG0594|consen  144 RDLKPQNLLIS-SSGVLKLADFGLARAF  170 (323)
T ss_pred             ccCCcceEEEC-CCCcEeeeccchHHHh
Confidence            36689999998 6999999999976433


No 69 
>PLN02236 choline kinase
Probab=76.15  E-value=4  Score=30.36  Aligned_cols=32  Identities=19%  Similarity=0.282  Sum_probs=27.4

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      ..++.=+|=+++|||++..++++.-|||-++-
T Consensus       199 ~~~~cH~Dl~~~Nil~~~~~~~~~lID~Eya~  230 (344)
T PLN02236        199 EIGFCHNDLQYGNIMIDEETRAITIIDYEYAS  230 (344)
T ss_pred             CceEEeCCCCcCcEEEeCCCCcEEEEeehhcc
Confidence            35778899999999998667899999998873


No 70 
>PRK10271 thiK thiamine kinase; Provisional
Probab=76.08  E-value=3.2  Score=29.10  Aligned_cols=34  Identities=26%  Similarity=0.154  Sum_probs=26.3

Q ss_pred             eeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910          6 LLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus         6 ~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      +-.++.=||=||+|+++. .+| +.=||+.++=..+
T Consensus        75 l~~~p~H~D~~~~N~~~~-~~~-~~lIDwe~a~~gD  108 (188)
T PRK10271         75 LRLAPLHMDVHAGNLVHS-ASG-LRLIDWEYAGDGD  108 (188)
T ss_pred             CCeeeecCCCCCccEEEE-CCC-EEEEeCCcccCCC
Confidence            456777899999999984 656 8899999764444


No 71 
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=75.86  E-value=1.7  Score=30.95  Aligned_cols=24  Identities=29%  Similarity=0.429  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+--+|||.+
T Consensus       125 ~dlkp~Nill~-~~~~~kL~Dfg~~  148 (324)
T cd05587         125 RDLKLDNVMLD-AEGHIKIADFGMC  148 (324)
T ss_pred             cCCCHHHeEEc-CCCCEEEeecCcc
Confidence            67789999997 7899999999965


No 72 
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=75.19  E-value=3.3  Score=29.69  Aligned_cols=26  Identities=35%  Similarity=0.399  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      ||=.++||+++  .++++-||||...-.
T Consensus       116 GDLTtsNiIl~--~~~i~~IDfGLg~~s  141 (204)
T COG3642         116 GDLTTSNIILS--GGRIYFIDFGLGEFS  141 (204)
T ss_pred             CCCccceEEEe--CCcEEEEECCccccc
Confidence            78899999994  566999999976543


No 73 
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=74.89  E-value=2.7  Score=29.99  Aligned_cols=24  Identities=38%  Similarity=0.480  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.=+|||.+
T Consensus       120 rDikp~NIll~-~~~~~kL~Dfg~~  143 (325)
T cd05594         120 RDLKLENLMLD-KDGHIKITDFGLC  143 (325)
T ss_pred             cCCCCCeEEEC-CCCCEEEecCCCC
Confidence            67899999997 8899999999965


No 74 
>PF01386 Ribosomal_L25p:  Ribosomal L25p family;  InterPro: IPR020055 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry models the short-form of the ribosomal L25 protein. The long-form has homology to the general stress protein Ctc of Bacillus subtilis, a mesophile, and ribosomal protein TL5 of Thermus thermophilus, a thermophile. Ribosomal protein L25 of Escherichia coli and Haemophilus influenzae appear to be orthologous but consist only of the N-terminal half of Ctc and TL5. Both short (L25-like) and full-length (CTC-like) members of this family bind the E-loop of bacterial 5S rRNA.; GO: 0003735 structural constituent of ribosome, 0008097 5S rRNA binding, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2HGQ_Y 2HGJ_Y 2Y19_Z 2WRL_Z 3KIT_Z 2WH2_Z 2WDN_Z 3V25_Z 3HUZ_Z 3KIY_Z ....
Probab=74.60  E-value=3.8  Score=25.01  Aligned_cols=15  Identities=20%  Similarity=0.246  Sum_probs=12.5

Q ss_pred             EEEEcCCCcEEEEee
Q psy16910         20 TLVCTKTGRCVGIDF   34 (82)
Q Consensus        20 ili~~~tG~v~hiDf   34 (82)
                      +-.|.-++++.|+||
T Consensus        74 vQ~~p~~~~i~HvDF   88 (88)
T PF01386_consen   74 VQRDPVTDKILHVDF   88 (88)
T ss_dssp             EEEESSSSSEEEEEE
T ss_pred             eeeCCCCCCeEeccC
Confidence            334888999999998


No 75 
>PRK05231 homoserine kinase; Provisional
Probab=74.47  E-value=3.5  Score=29.58  Aligned_cols=26  Identities=27%  Similarity=0.192  Sum_probs=20.4

Q ss_pred             eeeCCCCCCcEEEEcCCCcE-EEEeecee
Q psy16910         10 YSIGDRHLENTLVCTKTGRC-VGIDFGYS   37 (82)
Q Consensus        10 lgigDRh~~nili~~~tG~v-~hiDfg~~   37 (82)
                      +-=||=||+||+++  .+++ .-|||+.+
T Consensus       189 liHgD~~~~Nil~~--~~~~~~iIDf~~~  215 (319)
T PRK05231        189 VIHADLFRDNVLFE--GDRLSGFIDFYFA  215 (319)
T ss_pred             cCCCCCCCCcEEEE--CCceEEEEecccc
Confidence            34489999999997  4455 69999876


No 76 
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members. The APH/ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resista
Probab=74.27  E-value=3.9  Score=28.20  Aligned_cols=29  Identities=38%  Similarity=0.365  Sum_probs=22.1

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcE-EEEeecee
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRC-VGIDFGYS   37 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v-~hiDfg~~   37 (82)
                      .+.|-=||=|++|+|++  .+++ --|||+.+
T Consensus       163 ~~~l~HGD~~~~Nvlv~--~~~i~giIDw~~a  192 (235)
T cd05155         163 PPVWFHGDLAPGNLLVQ--DGRLSAVIDFGCL  192 (235)
T ss_pred             CceEEeCCCCCCcEEEE--CCCEEEEEeCccc
Confidence            34566699999999996  3565 48999965


No 77 
>KOG0603|consensus
Probab=74.16  E-value=2.8  Score=34.50  Aligned_cols=29  Identities=21%  Similarity=0.136  Sum_probs=24.4

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      .+|=||+|||++..-|++--+|||..-..
T Consensus       438 hRDLkp~NIL~~~~~g~lrltyFG~a~~~  466 (612)
T KOG0603|consen  438 HRDLKPGNILLDGSAGHLRLTYFGFWSEL  466 (612)
T ss_pred             ecCCChhheeecCCCCcEEEEEechhhhC
Confidence            58999999999658899999999965443


No 78 
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=73.93  E-value=2  Score=29.71  Aligned_cols=25  Identities=32%  Similarity=0.395  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.-+|||.+-
T Consensus       134 ~dlkp~Nil~~-~~~~~kl~Dfg~~~  158 (290)
T cd07862         134 RDLKPQNILVT-SSGQIKLADFGLAR  158 (290)
T ss_pred             CCCCHHHEEEc-CCCCEEEccccceE
Confidence            67889999997 88999999999763


No 79 
>KOG0983|consensus
Probab=73.75  E-value=2.8  Score=32.28  Aligned_cols=24  Identities=33%  Similarity=0.354  Sum_probs=21.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|-.|+|||+| .+|+|--+|||-+
T Consensus       216 RDvKPSNILlD-e~GniKlCDFGIs  239 (391)
T KOG0983|consen  216 RDVKPSNILLD-ERGNIKLCDFGIS  239 (391)
T ss_pred             cccCccceEEc-cCCCEEeeccccc
Confidence            35679999999 9999999999954


No 80 
>KOG1006|consensus
Probab=73.65  E-value=2.6  Score=32.21  Aligned_cols=23  Identities=30%  Similarity=0.381  Sum_probs=20.8

Q ss_pred             CCCCCcEEEEcCCCcEEEEeecee
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      |--|+|||+| .+|.|--+|||-+
T Consensus       193 DvKPSNILld-r~G~vKLCDFGIc  215 (361)
T KOG1006|consen  193 DVKPSNILLD-RHGDVKLCDFGIC  215 (361)
T ss_pred             cCChhheEEe-cCCCEeeecccch
Confidence            5679999998 9999999999965


No 81 
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=73.44  E-value=2.8  Score=28.09  Aligned_cols=25  Identities=40%  Similarity=0.458  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|++.-+|||.+.
T Consensus       122 ~dikp~NIl~~-~~~~~~l~Dfg~~~  146 (260)
T PF00069_consen  122 RDIKPENILLD-ENGEVKLIDFGSSV  146 (260)
T ss_dssp             SSBSGGGEEES-TTSEEEESSGTTTE
T ss_pred             ccccccccccc-cccccccccccccc
Confidence            56789999997 99999999999875


No 82 
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=73.12  E-value=2.1  Score=31.06  Aligned_cols=25  Identities=28%  Similarity=0.303  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.-+|||.+-
T Consensus       125 rDLkp~NIli~-~~~~vkL~DfG~~~  149 (360)
T cd05627         125 RDIKPDNLLLD-AKGHVKLSDFGLCT  149 (360)
T ss_pred             cCCCHHHEEEC-CCCCEEEeeccCCc
Confidence            67789999997 89999999999753


No 83 
>PRK09188 serine/threonine protein kinase; Provisional
Probab=73.09  E-value=3.4  Score=31.49  Aligned_cols=25  Identities=28%  Similarity=0.315  Sum_probs=20.6

Q ss_pred             CCC-CCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDR-HLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDR-h~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|= .|+|||++ .+|++.-+|||.+-
T Consensus       135 rDL~KP~NILv~-~~~~ikLiDFGlA~  160 (365)
T PRK09188        135 NDLAKPQNWLMG-PDGEAAVIDFQLAS  160 (365)
T ss_pred             CCCCCcceEEEc-CCCCEEEEECccce
Confidence            455 48999996 78999999999754


No 84 
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=73.08  E-value=2  Score=31.28  Aligned_cols=25  Identities=36%  Similarity=0.393  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+|||++ .+|.+.-+|||.+-
T Consensus       155 rDLkp~NILl~-~~~~ikL~DFG~a~  179 (340)
T PTZ00426        155 RDLKPENLLLD-KDGFIKMTDFGFAK  179 (340)
T ss_pred             cCCCHHHEEEC-CCCCEEEecCCCCe
Confidence            67889999997 89999999999764


No 85 
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=72.66  E-value=2.6  Score=33.00  Aligned_cols=23  Identities=39%  Similarity=0.561  Sum_probs=20.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+|||+  .+++++=||||.+
T Consensus       452 rDlkp~NILl--~~~~~~liDFGla  474 (535)
T PRK09605        452 GDLTTSNFIV--RDDRLYLIDFGLG  474 (535)
T ss_pred             CCCChHHEEE--ECCcEEEEeCccc
Confidence            7899999999  5789999999975


No 86 
>KOG0592|consensus
Probab=72.57  E-value=2.7  Score=34.38  Aligned_cols=23  Identities=39%  Similarity=0.439  Sum_probs=20.3

Q ss_pred             CCCCCcEEEEcCCCcEEEEeecee
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      |=-|+|||+| .+|++--+|||-+
T Consensus       199 DlKPENILLd-~dmhikITDFGsA  221 (604)
T KOG0592|consen  199 DLKPENILLD-KDGHIKITDFGSA  221 (604)
T ss_pred             cCChhheeEc-CCCcEEEeecccc
Confidence            4469999998 9999999999964


No 87 
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=72.37  E-value=2.2  Score=30.51  Aligned_cols=24  Identities=38%  Similarity=0.635  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.-+|||.+
T Consensus       120 ~dlkp~NIli~-~~~~~kL~DfG~~  143 (320)
T cd05590         120 RDLKLDNVLLD-HEGHCKLADFGMC  143 (320)
T ss_pred             CCCCHHHeEEC-CCCcEEEeeCCCC
Confidence            68899999997 8899999999964


No 88 
>TIGR00938 thrB_alt homoserine kinase, Neisseria type. Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase.
Probab=71.95  E-value=4.4  Score=29.15  Aligned_cols=29  Identities=21%  Similarity=0.068  Sum_probs=22.8

Q ss_pred             eeeeeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910          8 LEYSIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus         8 yilgigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +.+-=||=|++|++++ .++.+.-|||..+
T Consensus       187 ~~l~HgD~~~~Nvl~~-~~~~~~vIDfd~~  215 (307)
T TIGR00938       187 RGVIHADLFPDNVLFD-GDSVKGVIDFYFA  215 (307)
T ss_pred             CccCCCCCCcCcEEEE-CCceEEEeecccc
Confidence            4455589999999997 5565689999876


No 89 
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=71.69  E-value=2.1  Score=30.50  Aligned_cols=25  Identities=28%  Similarity=0.375  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.-+|||.+-
T Consensus       125 rDlkp~Nill~-~~~~~kL~DfG~~~  149 (323)
T cd05616         125 RDLKLDNVMLD-SEGHIKIADFGMCK  149 (323)
T ss_pred             cCCCHHHeEEC-CCCcEEEccCCCce
Confidence            67889999997 88999999999654


No 90 
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=71.63  E-value=2.6  Score=29.93  Aligned_cols=24  Identities=33%  Similarity=0.365  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.-+|||.+
T Consensus       117 rDlkp~Nili~-~~~~~kl~Dfg~~  140 (312)
T cd05585         117 RDLKPENILLD-YQGHIALCDFGLC  140 (312)
T ss_pred             CCCCHHHeEEC-CCCcEEEEECccc
Confidence            67789999997 8899999999965


No 91 
>KOG0610|consensus
Probab=71.45  E-value=3.4  Score=32.80  Aligned_cols=32  Identities=31%  Similarity=0.358  Sum_probs=25.7

Q ss_pred             eeee--CCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910          9 EYSI--GDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus         9 ilgi--gDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      ++||  -|=-|+|||| +.+|+|.-.||-.++...
T Consensus       197 mlGivYRDLKPENILv-redGHIMLsDFDLS~~~~  230 (459)
T KOG0610|consen  197 MLGIVYRDLKPENILV-REDGHIMLSDFDLSLRCP  230 (459)
T ss_pred             hhceeeccCCcceeEE-ecCCcEEeeeccccccCC
Confidence            3444  3668999999 599999999998887663


No 92 
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=71.38  E-value=3.2  Score=28.55  Aligned_cols=26  Identities=27%  Similarity=0.282  Sum_probs=22.6

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|-+|+||+++ .+|++.-+|||..-
T Consensus       124 H~dl~p~Nil~~-~~~~~~l~dfg~~~  149 (277)
T cd06640         124 HRDIKAANVLLS-EQGDVKLADFGVAG  149 (277)
T ss_pred             CcCCChhhEEEc-CCCCEEEcccccce
Confidence            378899999997 88999999998763


No 93 
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=71.27  E-value=2.5  Score=30.78  Aligned_cols=24  Identities=29%  Similarity=0.416  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.-+|||.+
T Consensus       125 rDlkp~Nill~-~~~~ikL~DFG~a  148 (376)
T cd05598         125 RDIKPDNILID-RDGHIKLTDFGLC  148 (376)
T ss_pred             CCCCHHHEEEC-CCCCEEEEeCCCC
Confidence            68889999997 8999999999964


No 94 
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=71.18  E-value=2.5  Score=30.09  Aligned_cols=25  Identities=36%  Similarity=0.408  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|++.=+|||.+-
T Consensus       126 ~Dlkp~NIll~-~~~~~kL~Dfg~a~  150 (330)
T cd05601         126 RDIKPENVLID-RTGHIKLADFGSAA  150 (330)
T ss_pred             ccCchHheEEC-CCCCEEeccCCCCe
Confidence            68899999997 89999999999763


No 95 
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=70.91  E-value=2.2  Score=30.32  Aligned_cols=24  Identities=38%  Similarity=0.463  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|++.=+|||.+
T Consensus       120 ~Dlkp~NIll~-~~~~~kl~Dfg~~  143 (321)
T cd05603         120 RDLKPENILLD-SQGHVVLTDFGLC  143 (321)
T ss_pred             ccCCHHHeEEC-CCCCEEEccCCCC
Confidence            68889999997 7899999999965


No 96 
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=70.81  E-value=2.3  Score=29.65  Aligned_cols=26  Identities=27%  Similarity=0.333  Sum_probs=22.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+|||++ .+|++.=+|||.+-.
T Consensus       127 ~dlkp~Nil~~-~~~~~kl~DfG~~~~  152 (288)
T cd07871         127 RDLKPQNLLIN-EKGELKLADFGLARA  152 (288)
T ss_pred             CCCCHHHEEEC-CCCCEEECcCcceee
Confidence            67789999997 889999999997643


No 97 
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=70.58  E-value=3.2  Score=29.17  Aligned_cols=25  Identities=32%  Similarity=0.385  Sum_probs=21.7

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      -+|=+|+||+++ .+|.+.-+|||.+
T Consensus       124 H~dl~p~NIll~-~~~~~~l~dfg~~  148 (305)
T cd05609         124 HRDLKPDNLLIT-SMGHIKLTDFGLS  148 (305)
T ss_pred             ccCCchHHEEEC-CCCCEEEeeCCCc
Confidence            367899999996 8999999999964


No 98 
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=70.31  E-value=4.2  Score=25.46  Aligned_cols=29  Identities=31%  Similarity=0.306  Sum_probs=23.5

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -||=+|+||+++..++++.=+||+.+-..
T Consensus       115 H~dl~~~ni~~~~~~~~~~l~d~~~~~~~  143 (215)
T cd00180         115 HRDLKPENILLDSDNGKVKLADFGLSKLL  143 (215)
T ss_pred             ccCCCHhhEEEeCCCCcEEEecCCceEEc
Confidence            47889999999844899999999876433


No 99 
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=70.15  E-value=2.7  Score=29.97  Aligned_cols=24  Identities=46%  Similarity=0.576  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|++.-+|||.+
T Consensus       129 rDlkp~Nili~-~~~~~kl~DfG~~  152 (332)
T cd05614         129 RDIKLENILLD-SEGHVVLTDFGLS  152 (332)
T ss_pred             cCCCHHHeEEC-CCCCEEEeeCcCC
Confidence            67789999997 7899999999965


No 100
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=70.12  E-value=2.9  Score=29.90  Aligned_cols=24  Identities=38%  Similarity=0.480  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||.+
T Consensus       119 rDlkp~NIll~-~~~~~kl~DfG~a  142 (323)
T cd05571         119 RDLKLENLMLD-KDGHIKITDFGLC  142 (323)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCCC
Confidence            67789999997 8899999999965


No 101
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=69.93  E-value=2.6  Score=30.00  Aligned_cols=25  Identities=36%  Similarity=0.401  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.-+|||.+-
T Consensus       120 ~dikp~NIll~-~~~~~kl~Dfg~~~  144 (323)
T cd05575         120 RDLKPENILLD-SQGHVVLTDFGLCK  144 (323)
T ss_pred             CCCCHHHeEEC-CCCcEEEeccCCCc
Confidence            67889999997 78999999999653


No 102
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=69.88  E-value=3.6  Score=27.99  Aligned_cols=29  Identities=28%  Similarity=0.259  Sum_probs=24.1

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      =||-+|+||+++ .+|.+.=+||+......
T Consensus       121 H~dl~p~nili~-~~~~~~l~df~~~~~~~  149 (283)
T cd05118         121 HRDLKPENLLIN-TEGVLKLADFGLARSFG  149 (283)
T ss_pred             ecCcCHHHEEEC-CCCcEEEeeeeeeEecC
Confidence            489999999997 78999999999775443


No 103
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=69.84  E-value=2.9  Score=29.76  Aligned_cols=25  Identities=36%  Similarity=0.545  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.-+|||.+-
T Consensus       120 rDikp~Nill~-~~~~~kL~Dfg~~~  144 (321)
T cd05591         120 RDLKLDNILLD-AEGHCKLADFGMCK  144 (321)
T ss_pred             cCCCHHHeEEC-CCCCEEEeecccce
Confidence            67789999997 88999999999653


No 104
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=69.75  E-value=4.4  Score=28.41  Aligned_cols=27  Identities=26%  Similarity=0.124  Sum_probs=22.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      ||=.+.|||++  .|+++-|||+-+...+
T Consensus       149 GDLs~~NIL~~--~~~v~iIDF~qav~~~  175 (197)
T cd05146         149 ADLSEYNMLWH--DGKVWFIDVSQSVEPT  175 (197)
T ss_pred             CCCCHHHEEEE--CCcEEEEECCCceeCC
Confidence            78899999995  5899999999766655


No 105
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=69.68  E-value=2.4  Score=30.23  Aligned_cols=24  Identities=38%  Similarity=0.448  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+|||++ .+|.+.=+|||.+
T Consensus       120 rDlkp~Nili~-~~~~~kl~DfG~a  143 (325)
T cd05602         120 RDLKPENILLD-SQGHIVLTDFGLC  143 (325)
T ss_pred             cCCCHHHeEEC-CCCCEEEccCCCC
Confidence            68899999997 7899999999965


No 106
>PHA02882 putative serine/threonine kinase; Provisional
Probab=69.49  E-value=3.6  Score=28.88  Aligned_cols=24  Identities=38%  Similarity=0.483  Sum_probs=20.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ ..+.+.=+|||.+
T Consensus       150 rDiKp~Nill~-~~~~~~l~DFGla  173 (294)
T PHA02882        150 GDIKPENIMVD-GNNRGYIIDYGIA  173 (294)
T ss_pred             CCCCHHHEEEc-CCCcEEEEEcCCc
Confidence            56679999997 7789999999975


No 107
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=69.41  E-value=2.9  Score=29.85  Aligned_cols=25  Identities=36%  Similarity=0.356  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       125 ~dlkp~Nil~~-~~~~~kL~Dfg~a~  149 (333)
T cd05600         125 RDLKPENFLID-ASGHIKLTDFGLSK  149 (333)
T ss_pred             cCCCHHHEEEC-CCCCEEEEeCcCCc
Confidence            67789999997 88999999999654


No 108
>KOG0612|consensus
Probab=69.29  E-value=6.2  Score=35.00  Aligned_cols=56  Identities=21%  Similarity=0.277  Sum_probs=40.5

Q ss_pred             CCCCCcEEEEcCCCcEEEEeeceeeccccC-C--CCCCCCCceeecHHHHHhhCCC-CCch
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYSFGVATQ-L--LPIPELMPFRLTPHILAVNEPY-GSQE   70 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~~~~~~~-~--~~~~E~vPFRLT~~~~~~~g~~-g~eG   70 (82)
                      |=-|+|||+| ..|+|=-.|||.|+.-..- .  -.++=-.|==++|+++..+|.- |.-|
T Consensus       200 DiKPDNvLld-~~GHikLADFGsClkm~~dG~V~s~~aVGTPDYISPEvLqs~~~~~g~yG  259 (1317)
T KOG0612|consen  200 DIKPDNVLLD-KSGHIKLADFGSCLKMDADGTVRSSVAVGTPDYISPEVLQSQGDGKGEYG  259 (1317)
T ss_pred             cCCcceeEec-ccCcEeeccchhHHhcCCCCcEEeccccCCCCccCHHHHHhhcCCccccC
Confidence            6679999999 9999999999999765421 1  0111223666899999999887 5444


No 109
>PF06293 Kdo:  Lipopolysaccharide kinase (Kdo/WaaP) family;  InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents lipopolysaccharide kinases which are related to protein kinases IPR000719 from INTERPRO. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of Salmonella enterica [].; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0009103 lipopolysaccharide biosynthetic process, 0016020 membrane
Probab=69.20  E-value=5.2  Score=27.38  Aligned_cols=23  Identities=35%  Similarity=0.327  Sum_probs=19.5

Q ss_pred             CCCCCCcEEEEcCCC---cEEEEeece
Q psy16910         13 GDRHLENTLVCTKTG---RCVGIDFGY   36 (82)
Q Consensus        13 gDRh~~nili~~~tG---~v~hiDfg~   36 (82)
                      ||=++.|||++ ..+   +++-|||.-
T Consensus       142 ~Dl~~~NILv~-~~~~~~~~~lIDld~  167 (206)
T PF06293_consen  142 GDLNPSNILVD-PDDGQYRFYLIDLDR  167 (206)
T ss_pred             CCCCcccEEEe-CCCCceeEEEEcchh
Confidence            78899999997 555   899999974


No 110
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=69.13  E-value=4.5  Score=27.45  Aligned_cols=26  Identities=31%  Similarity=0.353  Sum_probs=22.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=+|+||+++ .+|.+.=+|||.+-.
T Consensus       127 ~dl~p~Nil~~-~~~~~~l~dfg~~~~  152 (261)
T cd05068         127 RDLAARNVLVG-ENNICKVADFGLARV  152 (261)
T ss_pred             ccCCcceEEEc-CCCCEEECCcceEEE
Confidence            78899999997 889999999987643


No 111
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=69.12  E-value=2.6  Score=28.58  Aligned_cols=28  Identities=29%  Similarity=0.146  Sum_probs=23.5

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -||=+|+||+++ .+|++.-+||+.....
T Consensus       125 H~dl~~~ni~i~-~~~~~~l~df~~~~~~  152 (280)
T cd05581         125 HRDLKPENILLD-KDMHIKITDFGTAKVL  152 (280)
T ss_pred             ecCCCHHHeEEC-CCCCEEecCCcccccc
Confidence            378899999996 8999999999976543


No 112
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=69.10  E-value=3.3  Score=28.21  Aligned_cols=26  Identities=19%  Similarity=0.162  Sum_probs=22.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.-+|||.+..
T Consensus       124 ~dlkp~Nill~-~~~~~kl~dfg~~~~  149 (269)
T cd05042         124 SDLALRNCQLT-ADLSVKIGDYGLALE  149 (269)
T ss_pred             ccccHhheEec-CCCcEEEeccccccc
Confidence            67789999997 789999999997643


No 113
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=69.09  E-value=3.2  Score=29.03  Aligned_cols=25  Identities=36%  Similarity=0.440  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.-+|||.+-
T Consensus       125 ~dlkp~NIli~-~~~~~kl~Dfg~~~  149 (291)
T cd05612         125 RDLKPENILLD-KEGHIKLTDFGFAK  149 (291)
T ss_pred             cCCCHHHeEEC-CCCCEEEEecCcch
Confidence            67789999997 89999999999754


No 114
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=69.08  E-value=2.9  Score=29.80  Aligned_cols=24  Identities=38%  Similarity=0.463  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.=+|||.+
T Consensus       120 ~Dlkp~NIll~-~~~~~kL~DfG~~  143 (325)
T cd05604         120 RDLKPENILLD-SQGHVVLTDFGLC  143 (325)
T ss_pred             cCCCHHHeEEC-CCCCEEEeecCCc
Confidence            67789999997 8899999999965


No 115
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=69.06  E-value=3  Score=30.38  Aligned_cols=24  Identities=29%  Similarity=0.353  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.=+|||.+
T Consensus       125 rDlKp~NILi~-~~~~vkL~DFGla  148 (363)
T cd05628         125 RDIKPDNLLLD-SKGHVKLSDFGLC  148 (363)
T ss_pred             cCCCHHHeEEC-CCCCEEEeeccCc
Confidence            67789999997 7899999999965


No 116
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=68.85  E-value=3.5  Score=27.62  Aligned_cols=25  Identities=32%  Similarity=0.219  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-+|+||+++ .+|.+.=+|||.+-
T Consensus       117 ~dl~p~nili~-~~~~~~l~d~g~~~  141 (250)
T cd05085         117 RDLAARNCLVG-ENNVLKISDFGMSR  141 (250)
T ss_pred             cccChheEEEc-CCCeEEECCCccce
Confidence            78899999996 89999999999763


No 117
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=68.37  E-value=3.9  Score=27.60  Aligned_cols=27  Identities=30%  Similarity=0.223  Sum_probs=22.7

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|-+|+||+++ .+|.+.-+|||.+..
T Consensus       126 h~di~p~nili~-~~~~~~l~d~g~~~~  152 (261)
T cd05034         126 HRDLAARNILVG-ENLVCKIADFGLARL  152 (261)
T ss_pred             cCCcchheEEEc-CCCCEEECcccccee
Confidence            378899999997 789999999986543


No 118
>KOG1235|consensus
Probab=68.33  E-value=5.3  Score=32.29  Aligned_cols=25  Identities=32%  Similarity=0.324  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEc---CCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCT---KTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~---~tG~v~hiDfg~~   37 (82)
                      +|=||+||++.+   ..++++-.|+|..
T Consensus       325 aDPHPGNilv~~~~~~~~~ivllDhGl~  352 (538)
T KOG1235|consen  325 ADPHPGNILVRPNPEGDEEIVLLDHGLY  352 (538)
T ss_pred             CCCCCCcEEEecCCCCCccEEEEccccc
Confidence            699999999973   5899999999854


No 119
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=68.02  E-value=4.8  Score=27.61  Aligned_cols=24  Identities=29%  Similarity=0.408  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-+|+||+++ .+|.+.-+|||..
T Consensus       125 ~dl~p~ni~i~-~~~~~~l~dfg~~  148 (277)
T cd06642         125 RDIKAANVLLS-EQGDVKLADFGVA  148 (277)
T ss_pred             cCCChheEEEe-CCCCEEEcccccc
Confidence            78899999997 7899999999865


No 120
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=67.92  E-value=2.8  Score=29.87  Aligned_cols=24  Identities=38%  Similarity=0.497  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.-+|||.+
T Consensus       120 ~dlkp~Nill~-~~~~~kL~Dfg~a  143 (316)
T cd05592         120 RDLKLDNVLLD-KDGHIKIADFGMC  143 (316)
T ss_pred             CCCCHHHeEEC-CCCCEEEccCcCC
Confidence            57789999997 8899999999965


No 121
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=67.74  E-value=5.9  Score=26.59  Aligned_cols=25  Identities=20%  Similarity=0.185  Sum_probs=22.0

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      -+|-.|+||+++ .+|.+.=+||+.+
T Consensus       125 H~di~p~nil~~-~~~~~~l~df~~~  149 (257)
T cd08223         125 HRDLKTQNVFLT-RTNIIKVGDLGIA  149 (257)
T ss_pred             ccCCCchhEEEe-cCCcEEEecccce
Confidence            378899999997 8899999999965


No 122
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH). The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibio
Probab=67.69  E-value=6.3  Score=27.07  Aligned_cols=30  Identities=30%  Similarity=0.162  Sum_probs=23.3

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      ..+|-=||=||+|||++ ..+.+.-|||..+
T Consensus       162 ~~~l~HgD~~~~Nil~~-~~~~~~iIDwe~a  191 (244)
T cd05150         162 DLVVTHGDACLPNIIVD-PGKFSGFIDLGRL  191 (244)
T ss_pred             ceEEECCCCCCccEEEe-CCcEEEEEEcccc
Confidence            34566699999999997 4555669999865


No 123
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=67.58  E-value=4.3  Score=27.34  Aligned_cols=24  Identities=33%  Similarity=0.207  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+||+++ .+|++.=+|||.+
T Consensus       128 ~dl~p~nilv~-~~~~~~l~dfg~~  151 (263)
T cd06625         128 RDIKGANILRD-SAGNVKLGDFGAS  151 (263)
T ss_pred             CCCCHHHEEEc-CCCCEEEeecccc
Confidence            78899999997 8899999999965


No 124
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=67.58  E-value=3.4  Score=29.64  Aligned_cols=27  Identities=30%  Similarity=0.377  Sum_probs=22.8

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|=.|+|||++ .+|.+.=+|||.+-.
T Consensus       141 H~dlkp~NIll~-~~~~~kl~Dfg~~~~  167 (329)
T PTZ00263        141 YRDLKPENLLLD-NKGHVKVTDFGFAKK  167 (329)
T ss_pred             ecCCCHHHEEEC-CCCCEEEeeccCceE
Confidence            368889999997 899999999997643


No 125
>KOG0198|consensus
Probab=67.53  E-value=6.7  Score=29.48  Aligned_cols=45  Identities=20%  Similarity=0.199  Sum_probs=29.1

Q ss_pred             CCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHH
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPH   58 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~   58 (82)
                      |=-|+|||++..+|.+-=.|||.........-......+++-||+
T Consensus       142 DiK~~NiLl~~~~~~~KlaDFG~a~~~~~~~~~~~~~~~~~Gtp~  186 (313)
T KOG0198|consen  142 DIKPANILLDPSNGDVKLADFGLAKKLESKGTKSDSELSVQGTPN  186 (313)
T ss_pred             CcccceEEEeCCCCeEEeccCccccccccccccccccccccCCcc
Confidence            556889999855799999999976655421112233446666544


No 126
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=67.50  E-value=3.1  Score=29.67  Aligned_cols=25  Identities=28%  Similarity=0.312  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.-+|||.+-
T Consensus       125 ~Dlkp~NIll~-~~~~~kL~Dfg~~~  149 (350)
T cd05573         125 RDIKPDNILID-ADGHIKLADFGLCK  149 (350)
T ss_pred             cCCCHHHeEEC-CCCCEEeecCCCCc
Confidence            67789999997 88999999999764


No 127
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=67.39  E-value=4.2  Score=27.68  Aligned_cols=27  Identities=33%  Similarity=0.319  Sum_probs=22.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|=.|+||+++ .++.+.-+|||.+...
T Consensus       130 ~di~p~nili~-~~~~~~l~dfg~~~~~  156 (266)
T cd05033         130 RDLAARNILVN-SNLVCKVSDFGLSRRL  156 (266)
T ss_pred             CCCCcceEEEc-CCCCEEECccchhhcc
Confidence            67899999997 8899999999876543


No 128
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=67.14  E-value=3.7  Score=30.28  Aligned_cols=27  Identities=30%  Similarity=0.357  Sum_probs=23.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|=.|+|||++ .+|.+.=+|||.+...
T Consensus       166 rDLKp~NILl~-~~~~~kL~DFG~a~~~  192 (370)
T cd05621         166 RDVKPDNMLLD-KHGHLKLADFGTCMKM  192 (370)
T ss_pred             cCCCHHHEEEC-CCCCEEEEecccceec
Confidence            57789999997 8899999999977543


No 129
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=66.98  E-value=4.4  Score=27.37  Aligned_cols=27  Identities=30%  Similarity=0.259  Sum_probs=22.8

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|=+|+||+++ .+|.+.=+|||.+..
T Consensus       123 H~dl~p~nili~-~~~~~kl~Dfg~~~~  149 (254)
T cd05083         123 HRDLAARNILVS-EDGVAKVSDFGLARV  149 (254)
T ss_pred             ccccCcceEEEc-CCCcEEECCCcccee
Confidence            378899999996 789999999997643


No 130
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=66.96  E-value=3.1  Score=29.24  Aligned_cols=25  Identities=28%  Similarity=0.336  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .+|.+.=+|||.+-
T Consensus       128 ~dlkp~Nill~-~~~~~kl~Dfg~~~  152 (309)
T cd07872         128 RDLKPQNLLIN-ERGELKLADFGLAR  152 (309)
T ss_pred             CCCCHHHEEEC-CCCCEEECccccce
Confidence            67789999997 88999999999764


No 131
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=66.88  E-value=7.3  Score=26.24  Aligned_cols=27  Identities=26%  Similarity=0.188  Sum_probs=22.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|-+|+||+++ .+|.+.=+|||.+...
T Consensus       126 ~di~p~Nili~-~~~~~~l~d~g~~~~~  152 (256)
T cd05039         126 RDLAARNVLVS-EDLVAKVSDFGLAKEA  152 (256)
T ss_pred             hhcccceEEEe-CCCCEEEccccccccc
Confidence            68899999997 8899999999866443


No 132
>KOG2345|consensus
Probab=66.84  E-value=5.4  Score=30.05  Aligned_cols=24  Identities=29%  Similarity=0.362  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=-|.|||++ .+|..+-+|||.+
T Consensus       153 ~DiKP~NILls-~~~~~vl~D~GS~  176 (302)
T KOG2345|consen  153 RDIKPANILLS-DSGLPVLMDLGSA  176 (302)
T ss_pred             cCCCcceeEec-CCCceEEEeccCc
Confidence            67889999997 7999999999964


No 133
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=66.82  E-value=4.5  Score=27.16  Aligned_cols=26  Identities=31%  Similarity=0.277  Sum_probs=22.6

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -||=.|+||+++ .+|.+.-+|||.+.
T Consensus       124 h~dl~p~ni~i~-~~~~~~l~d~g~~~  149 (262)
T cd06613         124 HRDIKGANILLT-EDGDVKLADFGVSA  149 (262)
T ss_pred             ecCCChhhEEEC-CCCCEEECccccch
Confidence            378899999997 88999999999764


No 134
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=66.74  E-value=3.5  Score=30.26  Aligned_cols=24  Identities=29%  Similarity=0.350  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|++.-+|||.+
T Consensus       125 rDlKp~Nili~-~~~~~kL~DFGl~  148 (381)
T cd05626         125 RDIKPDNILID-LDGHIKLTDFGLC  148 (381)
T ss_pred             cCCcHHHEEEC-CCCCEEEeeCcCC
Confidence            67889999997 7899999999964


No 135
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=66.72  E-value=3.3  Score=29.76  Aligned_cols=24  Identities=38%  Similarity=0.480  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.=+|||.+
T Consensus       119 rDikp~NIll~-~~~~~kL~DfG~~  142 (328)
T cd05593         119 RDLKLENLMLD-KDGHIKITDFGLC  142 (328)
T ss_pred             cccCHHHeEEC-CCCcEEEecCcCC
Confidence            67889999997 8899999999965


No 136
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=66.62  E-value=4  Score=29.26  Aligned_cols=25  Identities=28%  Similarity=0.364  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.-+|||.+.
T Consensus       120 rDlkp~Nili~-~~~~~kl~Dfg~~~  144 (327)
T cd05617         120 RDLKLDNVLLD-ADGHIKLTDYGMCK  144 (327)
T ss_pred             cCCCHHHEEEe-CCCCEEEeccccce
Confidence            67789999997 88999999999764


No 137
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=66.62  E-value=3.3  Score=29.52  Aligned_cols=24  Identities=42%  Similarity=0.452  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|++.=+|||.+
T Consensus       120 rDlkp~Nili~-~~~~~kl~Dfg~a  143 (330)
T cd05586         120 RDLKPENILLD-ATGHIALCDFGLS  143 (330)
T ss_pred             ccCCHHHeEEC-CCCCEEEecCCcC
Confidence            67789999997 8899999999965


No 138
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=66.60  E-value=5  Score=27.64  Aligned_cols=25  Identities=28%  Similarity=0.262  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-+|+||+++..+|.+.=+|||.+
T Consensus       134 ~dl~~~nil~~~~~~~~kl~dfg~~  158 (295)
T cd07837         134 RDLKPQNLLVDKQKGLLKIADLGLG  158 (295)
T ss_pred             cCCChHHEEEecCCCeEEEeecccc
Confidence            6889999999866899999999865


No 139
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional
Probab=66.27  E-value=6  Score=28.79  Aligned_cols=25  Identities=16%  Similarity=0.050  Sum_probs=20.6

Q ss_pred             CCCCCCcEEEEc------CCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCT------KTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~------~tG~v~hiDfg~~   37 (82)
                      ||=+++|||++.      ..++++-|||+-+
T Consensus       162 gDL~~~NiLl~~~~~~~~~~~~~~LIDl~r~  192 (268)
T PRK15123        162 RDCYICHFLLHLPFPGREEDLKLSVIDLHRA  192 (268)
T ss_pred             CCCChhhEEEeccccCCCCCceEEEEECCcc
Confidence            788999999974      2578999999843


No 140
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=66.23  E-value=4.1  Score=29.35  Aligned_cols=26  Identities=23%  Similarity=0.178  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.-+|||.+-.
T Consensus       143 rDikp~Nill~-~~~~~kl~Dfg~~~~  168 (355)
T cd07874         143 RDLKPSNIVVK-SDCTLKILDFGLART  168 (355)
T ss_pred             CCCChHHEEEC-CCCCEEEeeCccccc
Confidence            57789999996 889999999997643


No 141
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=66.01  E-value=3.8  Score=29.96  Aligned_cols=24  Identities=29%  Similarity=0.416  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.-+|||.+
T Consensus       125 rDlKp~NILl~-~~g~~kL~DFGla  148 (382)
T cd05625         125 RDIKPDNILID-RDGHIKLTDFGLC  148 (382)
T ss_pred             CCCCHHHEEEC-CCCCEEEeECCCC
Confidence            67789999997 8999999999965


No 142
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=65.92  E-value=5.5  Score=26.83  Aligned_cols=26  Identities=23%  Similarity=0.234  Sum_probs=22.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.=+|||.+..
T Consensus       124 ~dl~p~nili~-~~~~~~l~dfg~~~~  149 (255)
T cd08219         124 RDIKSKNIFLT-QNGKVKLGDFGSARL  149 (255)
T ss_pred             CCCCcceEEEC-CCCcEEEcccCccee
Confidence            78899999996 889999999997643


No 143
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=65.71  E-value=7.8  Score=26.37  Aligned_cols=27  Identities=30%  Similarity=0.277  Sum_probs=22.9

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|-.|+||+++ .+|++.=+|||.+..
T Consensus       130 h~~l~~~nili~-~~~~~~l~dfg~~~~  156 (287)
T cd07838         130 HRDLKPQNILVT-SDGQVKIADFGLARI  156 (287)
T ss_pred             eccCChhhEEEc-cCCCEEEeccCccee
Confidence            388999999998 669999999997644


No 144
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=65.65  E-value=4.5  Score=29.75  Aligned_cols=27  Identities=30%  Similarity=0.379  Sum_probs=23.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|=.|+|||++ .+|.+.=+|||.+...
T Consensus       166 rDLkp~NILl~-~~~~~kL~DfG~~~~~  192 (370)
T cd05596         166 RDVKPDNMLLD-KSGHLKLADFGTCMKM  192 (370)
T ss_pred             cCCCHHHEEEc-CCCCEEEEeccceeec
Confidence            67789999997 8999999999987543


No 145
>PRK05943 50S ribosomal protein L25; Reviewed
Probab=65.62  E-value=4.5  Score=25.01  Aligned_cols=18  Identities=22%  Similarity=0.086  Sum_probs=14.5

Q ss_pred             CcEEE-----EcCCCcEEEEeec
Q psy16910         18 ENTLV-----CTKTGRCVGIDFG   35 (82)
Q Consensus        18 ~nili-----~~~tG~v~hiDfg   35 (82)
                      .+.++     |+-++++.|+||-
T Consensus        70 ~~v~ikevQ~~pv~~~i~HvDF~   92 (94)
T PRK05943         70 VKVKVQAVQRHPFKPKLEHIDFV   92 (94)
T ss_pred             EEEEEeeeecCcCCCCeEeEeee
Confidence            45665     7789999999995


No 146
>TIGR02721 ycfN_thiK thiamine kinase. Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Probab=65.59  E-value=6.3  Score=27.44  Aligned_cols=32  Identities=28%  Similarity=0.185  Sum_probs=24.2

Q ss_pred             eeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910          8 LEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus         8 yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      .++.=||=||+||+++ .+| +.=|||.++--.+
T Consensus       146 ~~l~H~Dl~~~Nil~~-~~~-~~lIDwE~a~~gd  177 (256)
T TIGR02721       146 LAPLHMDVHAYNLVVT-PQG-LKLIDWEYASDGD  177 (256)
T ss_pred             CeeecCCCCcCcEEEe-CCC-CEEEeccccCcCC
Confidence            3566799999999997 555 7899998764333


No 147
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=65.46  E-value=4.9  Score=27.32  Aligned_cols=25  Identities=32%  Similarity=0.332  Sum_probs=22.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-+|+||+++ .+|.+.=+|||.+-
T Consensus       126 ~dl~~~Nill~-~~~~~~l~dfg~~~  150 (260)
T cd05069         126 RDLRAANILVG-DNLVCKIADFGLAR  150 (260)
T ss_pred             cccCcceEEEc-CCCeEEECCCccce
Confidence            78899999997 88999999999763


No 148
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=65.31  E-value=6.9  Score=27.09  Aligned_cols=26  Identities=27%  Similarity=0.264  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++..++.+.-+|||.+.
T Consensus       126 ~dl~p~nill~~~~~~~kl~dfg~~~  151 (294)
T PLN00009        126 RDLKPQNLLIDRRTNALKLADFGLAR  151 (294)
T ss_pred             CCCCcceEEEECCCCEEEEccccccc
Confidence            68899999998777888888999763


No 149
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=65.23  E-value=3.8  Score=29.62  Aligned_cols=25  Identities=24%  Similarity=0.199  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       147 rDlkp~NIl~~-~~~~~kl~Dfg~a~  171 (359)
T cd07876         147 RDLKPSNIVVK-SDCTLKILDFGLAR  171 (359)
T ss_pred             CCCCHHHEEEC-CCCCEEEecCCCcc
Confidence            57789999997 88999999999753


No 150
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=65.22  E-value=3.5  Score=29.82  Aligned_cols=25  Identities=28%  Similarity=0.224  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.-+|||.+.
T Consensus       192 rDlkp~NIll~-~~~~~kL~DfG~~~  216 (353)
T PLN00034        192 RDIKPSNLLIN-SAKNVKIADFGVSR  216 (353)
T ss_pred             cCCCHHHEEEc-CCCCEEEcccccce
Confidence            68889999997 78999999999753


No 151
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=65.15  E-value=5.5  Score=26.69  Aligned_cols=27  Identities=30%  Similarity=0.166  Sum_probs=23.0

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|=.|+||+++ .+|.+.=+|||....
T Consensus       116 h~di~p~nili~-~~~~~~l~d~g~~~~  142 (251)
T cd05041         116 HRDLAARNCLVG-ENNVLKISDFGMSRE  142 (251)
T ss_pred             hhhcCcceEEEc-CCCcEEEeecccccc
Confidence            378899999997 889999999997643


No 152
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=65.12  E-value=4.8  Score=28.88  Aligned_cols=26  Identities=27%  Similarity=0.310  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+|||++ .+|.+.=+|||.+..
T Consensus       126 rDlkp~Nill~-~~~~~kl~DfG~a~~  151 (331)
T cd05624         126 RDIKPDNVLLD-MNGHIRLADFGSCLK  151 (331)
T ss_pred             ccCchHHEEEc-CCCCEEEEeccceee
Confidence            57789999997 899999999997643


No 153
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=65.12  E-value=3.9  Score=29.28  Aligned_cols=25  Identities=28%  Similarity=0.375  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.-+|||.+-
T Consensus       125 rDikp~Nill~-~~~~ikL~Dfg~~~  149 (323)
T cd05615         125 RDLKLDNVMLD-SEGHIKIADFGMCK  149 (323)
T ss_pred             cCCCHHHeEEC-CCCCEEEecccccc
Confidence            57789999997 88999999999653


No 154
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=65.08  E-value=6.4  Score=28.01  Aligned_cols=24  Identities=25%  Similarity=0.296  Sum_probs=20.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.-+|||.+
T Consensus       198 rDiKp~Nil~~-~~~~~kl~DfG~a  221 (338)
T cd05102         198 RDLAARNILLS-ENNVVKICDFGLA  221 (338)
T ss_pred             CCCccceEEEc-CCCcEEEeecccc
Confidence            57789999997 7899999999965


No 155
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=64.93  E-value=3.5  Score=28.97  Aligned_cols=26  Identities=27%  Similarity=0.360  Sum_probs=22.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=+|+||+++ .+|.+.-+|||.+..
T Consensus       139 ~dL~p~Nili~-~~~~~~l~Dfg~~~~  164 (297)
T cd06656         139 RDIKSDNILLG-MDGSVKLTDFGFCAQ  164 (297)
T ss_pred             CCCCHHHEEEC-CCCCEEECcCccceE
Confidence            78899999997 889999999997644


No 156
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=64.92  E-value=4.8  Score=28.25  Aligned_cols=28  Identities=29%  Similarity=0.279  Sum_probs=23.4

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -+|=+|+||+++ .+|.+.=+||+.+...
T Consensus       126 H~dlkp~Nili~-~~~~~~l~dfg~~~~~  153 (316)
T cd05574         126 YRDLKPENILLH-ESGHIMLSDFDLSKQS  153 (316)
T ss_pred             ccCCChHHeEEc-CCCCEEEeecchhhcc
Confidence            478899999997 7899999999976543


No 157
>TIGR02906 spore_CotS spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers.
Probab=64.89  E-value=8.1  Score=27.30  Aligned_cols=29  Identities=24%  Similarity=0.353  Sum_probs=24.3

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .+.+.=||=|++|++++.  +++.-|||..+
T Consensus       186 ~~~liHgD~~~~Nil~~~--~~i~lIDfd~~  214 (313)
T TIGR02906       186 IRGFCHQDYAYHNILLKD--NEVYVIDFDYC  214 (313)
T ss_pred             cCceEcCCCCcccEEEeC--CcEEEEECccc
Confidence            456778999999999974  78999999854


No 158
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=64.84  E-value=4.3  Score=28.37  Aligned_cols=24  Identities=33%  Similarity=0.249  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||.+
T Consensus       162 ~dlkp~Nill~-~~~~~kl~DfG~~  185 (304)
T cd05096         162 RDLATRNCLVG-ENLTIKIADFGMS  185 (304)
T ss_pred             cCcchhheEEc-CCccEEECCCccc
Confidence            67899999997 7899999999965


No 159
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=64.82  E-value=3.5  Score=28.91  Aligned_cols=25  Identities=32%  Similarity=0.388  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       127 ~dlkp~Nill~-~~~~~kl~Dfg~~~  151 (303)
T cd07869         127 RDLKPQNLLIS-DTGELKLADFGLAR  151 (303)
T ss_pred             CCCCHHHEEEC-CCCCEEECCCCcce
Confidence            67889999997 88999999999764


No 160
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=64.69  E-value=4.3  Score=29.60  Aligned_cols=24  Identities=33%  Similarity=0.414  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+|||++ .+|.+.-+|||.+
T Consensus       125 rDlkp~NIll~-~~~~~kl~DfGla  148 (377)
T cd05629         125 RDIKPDNILID-RGGHIKLSDFGLS  148 (377)
T ss_pred             cCCCHHHEEEC-CCCCEEEeecccc
Confidence            67789999997 8899999999965


No 161
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=64.63  E-value=5.3  Score=26.61  Aligned_cols=29  Identities=28%  Similarity=0.125  Sum_probs=24.0

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      -+|=.|+||+++ .+|.+.-+|||.+....
T Consensus       126 h~dl~~~nil~~-~~~~~~l~dfg~~~~~~  154 (258)
T smart00219      126 HRDLAARNCLVG-ENLVVKISDFGLSRDLY  154 (258)
T ss_pred             ecccccceEEEc-cCCeEEEcccCCceecc
Confidence            378899999997 88899999999775443


No 162
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=64.59  E-value=16  Score=24.32  Aligned_cols=28  Identities=21%  Similarity=0.051  Sum_probs=22.8

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -+|=+|+||+++ .++.+.-+|||.+...
T Consensus       126 h~~l~~~ni~~~-~~~~~kl~d~g~~~~~  153 (256)
T cd08530         126 HRDLKSANILLV-ANDLVKIGDLGISKVL  153 (256)
T ss_pred             cCCCCcceEEEe-cCCcEEEeeccchhhh
Confidence            367789999997 6899999999876443


No 163
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=64.52  E-value=3.3  Score=29.64  Aligned_cols=25  Identities=36%  Similarity=0.414  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.=+|||.+-
T Consensus       119 ~Dlkp~NIll~-~~~~~kL~Dfg~~~  143 (323)
T cd05595         119 RDIKLENLMLD-KDGHIKITDFGLCK  143 (323)
T ss_pred             cCCCHHHEEEc-CCCCEEecccHHhc
Confidence            67789999997 88999999999653


No 164
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=64.28  E-value=4.5  Score=27.70  Aligned_cols=26  Identities=27%  Similarity=0.285  Sum_probs=22.6

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -||-+|+||+++ .+|.+.=+||+.+.
T Consensus       122 H~dl~p~nil~~-~~~~~~l~df~~~~  147 (283)
T cd07835         122 HRDLKPQNLLID-REGALKLADFGLAR  147 (283)
T ss_pred             CCCCCHHHEEEc-CCCcEEEeeccccc
Confidence            389999999998 59999999998764


No 165
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=64.26  E-value=4.2  Score=27.61  Aligned_cols=25  Identities=24%  Similarity=0.236  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .++.+.-+|||.+-
T Consensus       136 ~dlkp~Nil~~-~~~~~kl~Dfg~~~  160 (272)
T cd05075         136 RDLAARNCMLN-ENMNVCVADFGLSK  160 (272)
T ss_pred             cccchhheEEc-CCCCEEECCCCccc
Confidence            67789999996 78999999999653


No 166
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=64.22  E-value=4.4  Score=28.12  Aligned_cols=27  Identities=30%  Similarity=0.310  Sum_probs=22.7

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|=+|+||+++ .+|.+.-+|||.+-.
T Consensus       124 H~dl~p~nili~-~~~~~kl~dfg~~~~  150 (290)
T cd05580         124 YRDLKPENLLLD-SDGYIKITDFGFAKR  150 (290)
T ss_pred             cCCCCHHHEEEC-CCCCEEEeeCCCccc
Confidence            378899999996 889999999986543


No 167
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=64.18  E-value=4.9  Score=30.81  Aligned_cols=25  Identities=32%  Similarity=0.305  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+|||++ .+|.+.-+|||.+-
T Consensus       193 rDlkp~NIll~-~~~~~kL~DFgla~  217 (478)
T PTZ00267        193 RDLKSANIFLM-PTGIIKLGDFGFSK  217 (478)
T ss_pred             CCcCHHhEEEC-CCCcEEEEeCcCce
Confidence            68899999997 88999999999764


No 168
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=64.10  E-value=3.4  Score=29.47  Aligned_cols=24  Identities=29%  Similarity=0.473  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||.+
T Consensus       120 rDlkp~Nil~~-~~~~~kl~Dfg~~  143 (316)
T cd05620         120 RDLKLDNVMLD-RDGHIKIADFGMC  143 (316)
T ss_pred             cCCCHHHeEEC-CCCCEEeCccCCC
Confidence            67889999997 7899999999965


No 169
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=63.96  E-value=4.5  Score=27.35  Aligned_cols=26  Identities=31%  Similarity=0.337  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|-.|+||+++ .+|.+.-+|||.+-.
T Consensus       127 ~dl~p~nili~-~~~~~~l~dfg~~~~  152 (261)
T cd05072         127 RDLRAANVLVS-ESLMCKIADFGLARV  152 (261)
T ss_pred             cccchhhEEec-CCCcEEECCCcccee
Confidence            67889999997 889999999997643


No 170
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=63.80  E-value=6  Score=28.48  Aligned_cols=25  Identities=36%  Similarity=0.292  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .+|.+.=+|||.+-
T Consensus       128 ~dlkp~Nili~-~~~~~kL~Dfg~~~  152 (333)
T cd06650         128 RDVKPSNILVN-SRGEIKLCDFGVSG  152 (333)
T ss_pred             cCCChhhEEEc-CCCCEEEeeCCcch
Confidence            68899999997 78999999999753


No 171
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=63.78  E-value=4.5  Score=29.29  Aligned_cols=26  Identities=23%  Similarity=0.178  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.-+|||.+-.
T Consensus       150 ~Dlkp~NIll~-~~~~~kL~DfG~a~~  175 (364)
T cd07875         150 RDLKPSNIVVK-SDCTLKILDFGLART  175 (364)
T ss_pred             CCCCHHHEEEC-CCCcEEEEeCCCccc
Confidence            67789999996 889999999997643


No 172
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=63.78  E-value=6  Score=26.62  Aligned_cols=24  Identities=25%  Similarity=0.259  Sum_probs=20.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+||+++ .+|.+.=+|||..
T Consensus       121 ~di~p~nil~~-~~~~~kl~dfg~~  144 (257)
T cd05040         121 RDLAARNILLA-SDDKVKIGDFGLM  144 (257)
T ss_pred             cccCcccEEEe-cCCEEEecccccc
Confidence            68899999997 6799999999865


No 173
>KOG0605|consensus
Probab=63.50  E-value=4.5  Score=32.89  Aligned_cols=23  Identities=35%  Similarity=0.408  Sum_probs=21.1

Q ss_pred             CCCCCcEEEEcCCCcEEEEeecee
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      |=-|+|+||| .+|++=-.|||.+
T Consensus       266 DIKPdNlLiD-~~GHiKLSDFGLs  288 (550)
T KOG0605|consen  266 DIKPDNLLID-AKGHIKLSDFGLS  288 (550)
T ss_pred             cCChhheeec-CCCCEeecccccc
Confidence            5579999999 9999999999987


No 174
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=63.47  E-value=5.7  Score=28.45  Aligned_cols=24  Identities=38%  Similarity=0.376  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.=+|||.+
T Consensus       128 ~dlkp~Nil~~-~~~~~kl~Dfg~~  151 (331)
T cd06649         128 RDVKPSNILVN-SRGEIKLCDFGVS  151 (331)
T ss_pred             CCCChhhEEEc-CCCcEEEccCccc
Confidence            68889999997 8899999999965


No 175
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=63.36  E-value=4.4  Score=27.47  Aligned_cols=24  Identities=29%  Similarity=0.291  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.-+|||.+
T Consensus       124 ~dl~p~ni~i~-~~~~~kl~dfg~~  147 (256)
T cd05059         124 RDLAARNCLVG-EDNVVKVSDFGLA  147 (256)
T ss_pred             ccccHhhEEEC-CCCcEEECCcccc
Confidence            77889999997 8999999999865


No 176
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=63.26  E-value=5.2  Score=26.68  Aligned_cols=27  Identities=19%  Similarity=0.042  Sum_probs=22.8

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|=+|+||+++ .+|.+.=+||+.+-.
T Consensus       133 h~dl~p~nili~-~~~~~kl~d~g~~~~  159 (265)
T cd08217         133 HRDLKPANIFLD-ANNNVKLGDFGLAKI  159 (265)
T ss_pred             ecCCCHHHEEEe-cCCCEEEeccccccc
Confidence            378889999997 789999999996543


No 177
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=63.23  E-value=5.1  Score=29.19  Aligned_cols=25  Identities=28%  Similarity=0.147  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.-+|||.+-
T Consensus       127 ~dlkp~Nili~-~~~~~kL~Dfg~a~  151 (372)
T cd07853         127 RDIKPGNLLVN-SNCVLKICDFGLAR  151 (372)
T ss_pred             CCCChHHEEEC-CCCCEEecccccee
Confidence            67789999997 88999999999764


No 178
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=63.22  E-value=4.3  Score=27.70  Aligned_cols=26  Identities=35%  Similarity=0.293  Sum_probs=22.1

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|-+|+||+++ .++++.-+|||.+-
T Consensus       129 h~dlkp~nili~-~~~~~~l~dfg~~~  154 (267)
T cd05066         129 HRDLAARNILVN-SNLVCKVSDFGLSR  154 (267)
T ss_pred             ehhhchhcEEEC-CCCeEEeCCCCccc
Confidence            378899999996 78999999998764


No 179
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=63.07  E-value=4.4  Score=29.22  Aligned_cols=24  Identities=29%  Similarity=0.331  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.-+|||.+
T Consensus       125 ~Dlkp~NIl~~-~~~~~kl~Dfg~~  148 (364)
T cd05599         125 RDIKPDNLLLD-AKGHIKLSDFGLC  148 (364)
T ss_pred             ccCCHHHeEEC-CCCCEEEeecccc
Confidence            67889999997 8999999999975


No 180
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=62.97  E-value=5.6  Score=26.76  Aligned_cols=25  Identities=32%  Similarity=0.234  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|++.=+|||.+-
T Consensus       118 ~dl~p~nil~~-~~~~~kl~dfg~~~  142 (252)
T cd05084         118 RDLAARNCLVT-EKNVLKISDFGMSR  142 (252)
T ss_pred             cccchheEEEc-CCCcEEECccccCc
Confidence            67789999997 88999999998653


No 181
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=62.95  E-value=4.5  Score=28.85  Aligned_cols=24  Identities=33%  Similarity=0.386  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.=+|||.+
T Consensus       124 ~dlkp~Nil~~-~~~~~kl~Dfg~~  147 (323)
T cd05584         124 RDLKPENILLD-AQGHVKLTDFGLC  147 (323)
T ss_pred             CCCCHHHeEEC-CCCCEEEeeCcCC
Confidence            67889999997 8899999999964


No 182
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=62.93  E-value=4.3  Score=27.79  Aligned_cols=25  Identities=28%  Similarity=0.290  Sum_probs=22.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .+|.+.-+|||.+-
T Consensus       125 ~dl~p~nil~~-~~~~~~l~dfg~~~  149 (285)
T cd07861         125 RDLKPQNLLID-NKGVIKLADFGLAR  149 (285)
T ss_pred             cCCCHHHEEEc-CCCcEEECccccee
Confidence            78899999997 89999999999653


No 183
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=62.89  E-value=8.6  Score=27.48  Aligned_cols=26  Identities=23%  Similarity=0.179  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+-=+|||.+..
T Consensus       142 rdikp~Nil~~-~~~~~kl~Dfg~~~~  167 (343)
T cd07878         142 RDLKPSNVAVN-EDCELRILDFGLARQ  167 (343)
T ss_pred             ccCChhhEEEC-CCCCEEEcCCcccee
Confidence            67789999997 889999999997654


No 184
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=62.83  E-value=4.8  Score=28.92  Aligned_cols=25  Identities=28%  Similarity=0.369  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       120 ~Dikp~Nili~-~~~~~kL~DfG~~~  144 (329)
T cd05618         120 RDLKLDNVLLD-SEGHIKLTDYGMCK  144 (329)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCccc
Confidence            67889999997 88999999999653


No 185
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=62.55  E-value=10  Score=24.98  Aligned_cols=29  Identities=28%  Similarity=0.202  Sum_probs=23.9

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      -||-+|+||+++ ..|++.=+||+......
T Consensus       124 h~dl~p~ni~i~-~~~~~~l~d~~~~~~~~  152 (260)
T cd06606         124 HRDIKGANILVD-SDGVVKLADFGCAKRLG  152 (260)
T ss_pred             ccCCCHHHEEEc-CCCCEEEcccccEEecc
Confidence            478899999997 68999999999765444


No 186
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=62.53  E-value=5.4  Score=27.15  Aligned_cols=26  Identities=38%  Similarity=0.302  Sum_probs=22.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++...+++.-+|||.+-
T Consensus       132 ~dl~p~nil~~~~~~~~~l~dfg~~~  157 (268)
T cd06624         132 RDIKGDNVLVNTYSGVVKISDFGTSK  157 (268)
T ss_pred             cCCCHHHEEEcCCCCeEEEecchhhe
Confidence            78899999998778999999998653


No 187
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=62.50  E-value=8  Score=25.84  Aligned_cols=25  Identities=16%  Similarity=-0.031  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-+|+||+++ .+|.+.=+||+.+.
T Consensus       125 ~dl~~~nili~-~~~~~~l~df~~~~  149 (256)
T cd08529         125 RDIKSLNLFLD-AYDNVKIGDLGVAK  149 (256)
T ss_pred             CCCCcceEEEe-CCCCEEEcccccce
Confidence            68899999997 78999999998654


No 188
>cd00495 Ribosomal_L25_TL5_CTC Ribosomal_L25_TL5_CTC: Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding domain. L25 is a single-domain protein, homologous to the N-terminal domain of TL5 and CTC, which each contain two domains. CTC is a known stress protein, and proteins of this family are believed to have two functions, acting as both ribosomal and stress proteins. In Escherichia coli, cells deleted for L25 were found to be viable; however, these cells grew slowly and had impaired protein synthesis capability. In Bacillus subtilis, CTC is induced under stress conditions and located in the ribosome; it has been proposed that CTC may be necessary for accurate translation under stress conditions. Ribosomal_L25_TL5_CTC is found only in bacteria and some plastids. Due to its limited taxonomic diversity and the viability of cells deleted for L25, this protein is not believed to be necessary for ribosomal assembly. Eukaryotes contain a protein called L25, which is not homologous to bacterial L
Probab=62.36  E-value=4.3  Score=24.72  Aligned_cols=13  Identities=15%  Similarity=0.250  Sum_probs=11.7

Q ss_pred             EcCCCcEEEEeec
Q psy16910         23 CTKTGRCVGIDFG   35 (82)
Q Consensus        23 ~~~tG~v~hiDfg   35 (82)
                      |+-++++.|+||-
T Consensus        78 ~pv~~~i~HvDF~   90 (91)
T cd00495          78 HPVKDKILHVDFL   90 (91)
T ss_pred             ccCCCCEEEEecc
Confidence            7889999999994


No 189
>KOG0593|consensus
Probab=62.21  E-value=5.1  Score=31.10  Aligned_cols=24  Identities=33%  Similarity=0.513  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|--|+||||+ .+|.+=-+|||++
T Consensus       125 RDIKPENILit-~~gvvKLCDFGFA  148 (396)
T KOG0593|consen  125 RDIKPENILIT-QNGVVKLCDFGFA  148 (396)
T ss_pred             ccCChhheEEe-cCCcEEeccchhh
Confidence            36679999996 9999999999986


No 190
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=62.19  E-value=5.2  Score=27.83  Aligned_cols=25  Identities=28%  Similarity=0.292  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.=+|||.+-
T Consensus       126 ~dikp~Nill~-~~~~~kl~Dfg~~~  150 (285)
T cd05631         126 RDLKPENILLD-DRGHIRISDLGLAV  150 (285)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCCcE
Confidence            67789999997 88999999999653


No 191
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=62.02  E-value=4.5  Score=27.79  Aligned_cols=25  Identities=36%  Similarity=0.400  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .+|.+.=+|||.+-
T Consensus       132 ~dikp~Nili~-~~~~~kl~dfg~~~  156 (288)
T cd07863         132 RDLKPENILVT-SGGQVKLADFGLAR  156 (288)
T ss_pred             CCCCHHHEEEC-CCCCEEECccCccc
Confidence            68889999997 88999999998753


No 192
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=61.92  E-value=11  Score=25.52  Aligned_cols=28  Identities=29%  Similarity=0.192  Sum_probs=23.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      +|=.|+||+++ .+|.+.=+||+.+....
T Consensus       128 ~dlkp~nil~~-~~~~~kl~df~~~~~~~  155 (263)
T cd05052         128 RDLAARNCLVG-ENHLVKVADFGLSRLMT  155 (263)
T ss_pred             cccCcceEEEc-CCCcEEeCCCccccccc
Confidence            78899999996 89999999999765443


No 193
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=61.89  E-value=6.7  Score=27.17  Aligned_cols=26  Identities=31%  Similarity=0.262  Sum_probs=22.4

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=+|+||+++ .+|++.=+|||.+.
T Consensus       133 H~dlkp~Nili~-~~~~~kl~dfg~~~  158 (292)
T cd06644         133 HRDLKAGNVLLT-LDGDIKLADFGVSA  158 (292)
T ss_pred             ecCCCcceEEEc-CCCCEEEccCccce
Confidence            378899999996 78999999999654


No 194
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=61.85  E-value=4.2  Score=28.42  Aligned_cols=25  Identities=28%  Similarity=0.336  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .+|.+.-+|||.+-
T Consensus       128 ~dlkp~Nil~~-~~~~~kl~dfg~~~  152 (301)
T cd07873         128 RDLKPQNLLIN-ERGELKLADFGLAR  152 (301)
T ss_pred             CCCCHHHEEEC-CCCcEEECcCcchh
Confidence            68899999997 88999999999764


No 195
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=61.71  E-value=4.5  Score=28.91  Aligned_cols=25  Identities=32%  Similarity=0.384  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .+|.+.-+|||.+-
T Consensus       120 rdikp~Nil~~-~~~~~kl~Dfg~~~  144 (316)
T cd05619         120 RDLKLDNILLD-TDGHIKIADFGMCK  144 (316)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCCcce
Confidence            67889999997 78999999999653


No 196
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=61.70  E-value=7.3  Score=26.78  Aligned_cols=24  Identities=33%  Similarity=0.314  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|++.-+|||.+
T Consensus       127 ~dlkp~nili~-~~~~~kl~dfg~~  150 (282)
T cd06643         127 RDLKAGNILFT-LDGDIKLADFGVS  150 (282)
T ss_pred             cCCCcccEEEc-cCCCEEEcccccc
Confidence            68889999996 8899999999865


No 197
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=61.66  E-value=6.5  Score=26.57  Aligned_cols=25  Identities=28%  Similarity=0.282  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       126 ~dlkp~nil~~-~~~~~kl~dfg~~~  150 (256)
T cd05082         126 RDLAARNVLVS-EDNVAKVSDFGLTK  150 (256)
T ss_pred             cccchheEEEc-CCCcEEecCCccce
Confidence            67789999997 89999999999654


No 198
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=61.66  E-value=6.8  Score=26.80  Aligned_cols=25  Identities=32%  Similarity=0.181  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .++.+.=+|||.+-
T Consensus       148 ~dlkp~Nil~~-~~~~~~L~dfg~~~  172 (283)
T cd05048         148 RDLAARNCLVG-EGLTVKISDFGLSR  172 (283)
T ss_pred             cccccceEEEc-CCCcEEECCCccee
Confidence            68899999997 78889889999653


No 199
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=61.62  E-value=6.6  Score=26.41  Aligned_cols=25  Identities=24%  Similarity=0.197  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      ||=+|+||+++ .+|.+.=+||+.+.
T Consensus       130 ~dl~p~nil~~-~~~~~~l~d~~~~~  154 (267)
T cd08224         130 RDIKPANVFIT-ATGVVKLGDLGLGR  154 (267)
T ss_pred             CCcChhhEEEC-CCCcEEEeccceee
Confidence            78899999997 78999999998753


No 200
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=61.52  E-value=6.1  Score=26.97  Aligned_cols=28  Identities=25%  Similarity=0.179  Sum_probs=23.1

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      =+|=+|+||+++ .+|.+.=+|||.+...
T Consensus       122 H~dl~p~ni~~~-~~~~~~l~dfg~~~~~  149 (286)
T cd07832         122 HRDLKPANLLIS-ADGVLKIADFGLARLF  149 (286)
T ss_pred             cCCcCHHHEEEc-CCCcEEEeeeeecccc
Confidence            368899999997 6899999999976543


No 201
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=61.39  E-value=5  Score=27.02  Aligned_cols=25  Identities=32%  Similarity=0.353  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      ||-+|+||+++ .+|.+.-+|||.+.
T Consensus       137 ~~l~p~ni~~~-~~~~~~l~d~~~~~  161 (275)
T cd06608         137 RDIKGQNILLT-KNAEVKLVDFGVSA  161 (275)
T ss_pred             CCCCHHHEEEc-cCCeEEECCCccce
Confidence            78899999997 78999999998653


No 202
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=61.35  E-value=6.1  Score=26.95  Aligned_cols=26  Identities=35%  Similarity=0.427  Sum_probs=22.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|-+|+||+++ .+|.+.=+|||.+..
T Consensus       124 ~dl~p~nil~~-~~~~~~l~dfg~~~~  149 (286)
T cd07847         124 RDVKPENILIT-KQGQIKLCDFGFARI  149 (286)
T ss_pred             cCCChhhEEEc-CCCcEEECcccccee
Confidence            78899999997 889999999997654


No 203
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=61.29  E-value=6.2  Score=29.07  Aligned_cols=26  Identities=31%  Similarity=0.373  Sum_probs=22.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|++.=+|||.+..
T Consensus       166 rDLkp~NIll~-~~~~ikL~DfG~a~~  191 (371)
T cd05622         166 RDVKPDNMLLD-KSGHLKLADFGTCMK  191 (371)
T ss_pred             CCCCHHHEEEC-CCCCEEEEeCCceeE
Confidence            67789999997 789999999997644


No 204
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=61.26  E-value=8.6  Score=26.41  Aligned_cols=26  Identities=35%  Similarity=0.312  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|++.=+|||.+..
T Consensus       127 ~dl~p~nil~~-~~~~~~l~dfg~~~~  152 (286)
T cd06622         127 RDVKPTNVLVN-GNGQVKLCDFGVSGN  152 (286)
T ss_pred             CCCCHHHEEEC-CCCCEEEeecCCccc
Confidence            67889999997 699999999997643


No 205
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=61.09  E-value=9.1  Score=25.46  Aligned_cols=26  Identities=31%  Similarity=0.304  Sum_probs=22.2

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -||=+|+||+++ .+|.+.=+||+..-
T Consensus       116 H~~l~p~ni~~~-~~~~~~l~d~~~~~  141 (250)
T cd05123         116 YRDLKPENILLD-ADGHIKLTDFGLAK  141 (250)
T ss_pred             ecCCCcceEEEc-CCCcEEEeecCcce
Confidence            478899999997 78999999998653


No 206
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported 
Probab=60.96  E-value=8.8  Score=27.71  Aligned_cols=29  Identities=24%  Similarity=0.251  Sum_probs=22.3

Q ss_pred             eeeeeCCCCCCcEEEEcCCCcEE-EEeecee
Q psy16910          8 LEYSIGDRHLENTLVCTKTGRCV-GIDFGYS   37 (82)
Q Consensus         8 yilgigDRh~~nili~~~tG~v~-hiDfg~~   37 (82)
                      .++-=||=|++||+++ .+|++. =|||+.+
T Consensus       185 ~~lvHGD~~~~Nilv~-~~~~~~gviDWe~a  214 (276)
T cd05152         185 TVLVHGDLHPGHILID-EDARVTGLIDWTEA  214 (276)
T ss_pred             CeeEeCCCCCCcEEEe-CCCCEEEEECcHhc
Confidence            3455599999999998 447764 7899865


No 207
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=60.89  E-value=6  Score=31.54  Aligned_cols=25  Identities=24%  Similarity=0.319  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|=.|+|||++..+|.+.=+|||.+
T Consensus       279 RDLKP~NILl~~~~~~~KL~DFGlA  303 (566)
T PLN03225        279 RDVKPQNIIFSEGSGSFKIIDLGAA  303 (566)
T ss_pred             CcCCHHHEEEeCCCCcEEEEeCCCc
Confidence            4668999999877899999999976


No 208
>PHA03212 serine/threonine kinase US3; Provisional
Probab=60.79  E-value=7  Score=29.21  Aligned_cols=24  Identities=29%  Similarity=0.364  Sum_probs=21.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ ..|.+.=+|||.+
T Consensus       206 rDiKP~NIll~-~~~~vkL~DFG~a  229 (391)
T PHA03212        206 RDIKAENIFIN-HPGDVCLGDFGAA  229 (391)
T ss_pred             CCCChHhEEEc-CCCCEEEEeCCcc
Confidence            56789999997 8899999999975


No 209
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=60.63  E-value=6.2  Score=27.44  Aligned_cols=25  Identities=32%  Similarity=0.199  Sum_probs=21.6

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      -+|-.|+||+++ .++.+.=+|||.+
T Consensus       152 H~dlkp~Nill~-~~~~~kl~dfg~~  176 (295)
T cd05097         152 HRDLATRNCLVG-NHYTIKIADFGMS  176 (295)
T ss_pred             ccccChhhEEEc-CCCcEEecccccc
Confidence            378899999997 7889999999865


No 210
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=60.47  E-value=5.4  Score=27.11  Aligned_cols=28  Identities=25%  Similarity=0.175  Sum_probs=23.6

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -+|-+|+||+++ .+|.+.=+|||.+...
T Consensus       123 h~dl~p~nil~~-~~~~~~l~d~g~~~~~  150 (287)
T cd07840         123 HRDIKGSNILIN-NDGVLKLADFGLARPY  150 (287)
T ss_pred             eccCcHHHeEEc-CCCCEEEccccceeec
Confidence            478899999997 7999999999976544


No 211
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=60.41  E-value=9  Score=27.71  Aligned_cols=24  Identities=25%  Similarity=0.296  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+|||++ .++.+.=+|||.+
T Consensus       197 rDikp~Nill~-~~~~vkL~DfG~a  220 (337)
T cd05054         197 RDLAARNILLS-ENNVVKICDFGLA  220 (337)
T ss_pred             CCCCcceEEEe-CCCcEEEeccccc
Confidence            68889999998 7899999999965


No 212
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=60.22  E-value=7.2  Score=26.21  Aligned_cols=25  Identities=28%  Similarity=0.227  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .++.+.-+||+..-
T Consensus       124 ~dl~p~ni~i~-~~~~~~l~d~g~~~  148 (256)
T cd05112         124 RDLAARNCLVG-ENQVVKVSDFGMTR  148 (256)
T ss_pred             cccccceEEEc-CCCeEEECCCccee
Confidence            68899999997 88999999998654


No 213
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=60.09  E-value=4.9  Score=28.80  Aligned_cols=25  Identities=28%  Similarity=0.363  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       120 ~dlkp~Nili~-~~~~~kL~Dfg~~~  144 (329)
T cd05588         120 RDLKLDNVLLD-AEGHIKLTDYGMCK  144 (329)
T ss_pred             cCCCHHHeEEC-CCCCEEECcCcccc
Confidence            67889999997 78999999999653


No 214
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=59.91  E-value=6.8  Score=26.61  Aligned_cols=26  Identities=27%  Similarity=0.147  Sum_probs=22.1

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|-.|+||+++ .++.+.=+|||.+-
T Consensus       132 H~dl~p~nil~~-~~~~~~l~dfg~~~  157 (284)
T cd05038         132 HRDLAARNILVE-SEDLVKISDFGLAK  157 (284)
T ss_pred             cCCCCHHhEEEc-CCCCEEEccccccc
Confidence            378999999997 77999999998653


No 215
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=59.70  E-value=6.5  Score=28.20  Aligned_cols=26  Identities=31%  Similarity=0.370  Sum_probs=22.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+|||++ .+|++.=+|||.+..
T Consensus       126 ~dlkp~Nill~-~~~~~kl~Dfg~~~~  151 (331)
T cd05597         126 RDIKPDNVLLD-KNGHIRLADFGSCLR  151 (331)
T ss_pred             CCCCHHHEEEC-CCCCEEEEECCceee
Confidence            67889999996 889999999997643


No 216
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=59.67  E-value=4.9  Score=27.27  Aligned_cols=26  Identities=27%  Similarity=0.309  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=+|+||+++ .++.+.-+|||.+..
T Consensus       135 ~dl~~~nili~-~~~~~~l~Dfg~~~~  160 (272)
T cd06637         135 RDIKGQNVLLT-ENAEVKLVDFGVSAQ  160 (272)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCCCcee
Confidence            67889999997 889999999997643


No 217
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=59.63  E-value=5.8  Score=28.00  Aligned_cols=29  Identities=31%  Similarity=0.255  Sum_probs=24.0

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      -+|=+|+||+++ .+|++.=+|||.+....
T Consensus       126 H~dlkp~nili~-~~~~~~L~dfg~~~~~~  154 (330)
T cd07834         126 HRDLKPSNILVN-SNCDLKICDFGLARGVD  154 (330)
T ss_pred             cCCCCHHHEEEc-CCCCEEEcccCceEeec
Confidence            378899999997 77999999999775543


No 218
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=59.43  E-value=6.1  Score=26.74  Aligned_cols=26  Identities=23%  Similarity=0.123  Sum_probs=22.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=+|+||+++ .+|.+.-+|||.+..
T Consensus       130 ~dl~~~nil~~-~~~~~~l~d~g~~~~  155 (267)
T cd08228         130 RDIKPANVFIT-ATGVVKLGDLGLGRF  155 (267)
T ss_pred             CCCCHHHEEEc-CCCCEEECcccccee
Confidence            68899999997 789999999996543


No 219
>PTZ00036 glycogen synthase kinase; Provisional
Probab=59.30  E-value=6.4  Score=29.91  Aligned_cols=26  Identities=27%  Similarity=0.197  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++..++.+.=+|||.+-
T Consensus       194 rDLKp~NILl~~~~~~vkL~DFGla~  219 (440)
T PTZ00036        194 RDLKPQNLLIDPNTHTLKLCDFGSAK  219 (440)
T ss_pred             CCcCHHHEEEcCCCCceeeeccccch
Confidence            57789999998777788889999763


No 220
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=59.28  E-value=6.3  Score=26.74  Aligned_cols=26  Identities=35%  Similarity=0.323  Sum_probs=22.2

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|-+|+||+++ .++.+.=+|||.+-
T Consensus       130 H~dlkp~Nili~-~~~~~kl~dfg~~~  155 (268)
T cd05063         130 HRDLAARNILVN-SNLECKVSDFGLSR  155 (268)
T ss_pred             ccccchhhEEEc-CCCcEEECCCccce
Confidence            378899999997 78999999999764


No 221
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=59.13  E-value=8.2  Score=25.60  Aligned_cols=27  Identities=33%  Similarity=0.202  Sum_probs=22.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|=.|+||+++ .+|.+.-+|||.+...
T Consensus       129 ~di~p~nili~-~~~~~~l~dfg~~~~~  155 (262)
T cd00192         129 RDLAARNCLVG-EDLVVKISDFGLSRDV  155 (262)
T ss_pred             CccCcceEEEC-CCCcEEEccccccccc
Confidence            68889999997 7799999999876543


No 222
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=59.11  E-value=8  Score=26.74  Aligned_cols=24  Identities=21%  Similarity=0.185  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+||+++ .++++.-+|||.+
T Consensus       133 ~dlkp~nili~-~~~~~kl~Dfg~~  156 (279)
T cd05111         133 RNLAARNILLK-SDSIVQIADFGVA  156 (279)
T ss_pred             cccCcceEEEc-CCCcEEEcCCccc
Confidence            67789999997 7899999999976


No 223
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=58.97  E-value=8.6  Score=26.58  Aligned_cols=28  Identities=25%  Similarity=0.259  Sum_probs=23.7

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -+|-.|+||+++ .+|.+.=+|||.....
T Consensus       125 H~dl~p~nill~-~~~~~~l~dfg~~~~~  152 (298)
T cd07841         125 HRDLKPNNLLIA-SDGVLKLADFGLARSF  152 (298)
T ss_pred             ecCCChhhEEEc-CCCCEEEccceeeeec
Confidence            378899999997 7899999999977543


No 224
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=58.81  E-value=8.3  Score=26.09  Aligned_cols=24  Identities=33%  Similarity=0.353  Sum_probs=19.8

Q ss_pred             CCCCCCcEEEEcCCC-----cEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTG-----RCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG-----~v~hiDfg~~   37 (82)
                      +|-+|+||+++ .++     .+.-+|||.+
T Consensus       130 ~dl~p~nil~~-~~~~~~~~~~~l~dfg~~  158 (269)
T cd05044         130 RDLAARNCLVS-EKGYDADRVVKIGDFGLA  158 (269)
T ss_pred             CCCChheEEEe-cCCCCCCcceEECCcccc
Confidence            78899999997 555     7888999865


No 225
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=58.81  E-value=6.9  Score=25.91  Aligned_cols=28  Identities=25%  Similarity=0.180  Sum_probs=23.1

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -||=+|+||+++ .+|.+.=+||+.+...
T Consensus       126 H~dl~~~nil~~-~~~~~~l~d~~~~~~~  153 (258)
T cd08215         126 HRDIKPQNIFLT-SNGLVKLGDFGISKVL  153 (258)
T ss_pred             cccCChHHeEEc-CCCcEEECCccceeec
Confidence            478899999997 7899999999876443


No 226
>PHA03207 serine/threonine kinase US3; Provisional
Probab=58.72  E-value=5.4  Score=29.48  Aligned_cols=24  Identities=29%  Similarity=0.299  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ ..|.+.=+|||.+
T Consensus       209 rDlkp~Nill~-~~~~~~l~DfG~a  232 (392)
T PHA03207        209 RDVKTENIFLD-EPENAVLGDFGAA  232 (392)
T ss_pred             cCCCHHHEEEc-CCCCEEEccCccc
Confidence            67789999997 8899999999975


No 227
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=58.71  E-value=8.2  Score=27.14  Aligned_cols=25  Identities=32%  Similarity=0.202  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .++.+.=+|||..-
T Consensus       148 ~dlkp~Nili~-~~~~~kl~dfg~~~  172 (303)
T cd05088         148 RDLAARNILVG-ENYVAKIADFGLSR  172 (303)
T ss_pred             cccchheEEec-CCCcEEeCccccCc
Confidence            67789999997 78999999999764


No 228
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=58.65  E-value=6  Score=20.63  Aligned_cols=15  Identities=40%  Similarity=0.802  Sum_probs=12.3

Q ss_pred             EEcCCCcEEEEeece
Q psy16910         22 VCTKTGRCVGIDFGY   36 (82)
Q Consensus        22 i~~~tG~v~hiDfg~   36 (82)
                      +.+..|+++|+.|.+
T Consensus         3 ~C~~Cg~~Yh~~~~p   17 (36)
T PF05191_consen    3 ICPKCGRIYHIEFNP   17 (36)
T ss_dssp             EETTTTEEEETTTB-
T ss_pred             CcCCCCCccccccCC
Confidence            567899999999975


No 229
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=58.60  E-value=6  Score=27.78  Aligned_cols=26  Identities=27%  Similarity=0.353  Sum_probs=22.4

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -||-+|+||+++ .+|.+.=+|||.+-
T Consensus       138 H~dL~p~Nili~-~~~~~kl~dfg~~~  163 (296)
T cd06655         138 HRDIKSDNVLLG-MDGSVKLTDFGFCA  163 (296)
T ss_pred             cCCCCHHHEEEC-CCCCEEEccCccch
Confidence            488999999997 78999999998653


No 230
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=58.48  E-value=6.2  Score=27.98  Aligned_cols=25  Identities=36%  Similarity=0.360  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+.
T Consensus       122 ~dlkp~Nil~~-~~~~~kL~Dfg~~~  146 (318)
T cd05582         122 RDLKPENILLD-EEGHIKLTDFGLSK  146 (318)
T ss_pred             CCCCHHHeEEC-CCCcEEEeeccCCc
Confidence            67889999997 88999999999654


No 231
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=58.40  E-value=9.3  Score=26.43  Aligned_cols=26  Identities=31%  Similarity=0.446  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .++.+.=+|||.+..
T Consensus       119 ~dikp~Nili~-~~~~~~l~Dfg~~~~  144 (277)
T cd05607         119 RDMKPENVLLD-DQGNCRLSDLGLAVE  144 (277)
T ss_pred             ccCChHhEEEc-CCCCEEEeeceeeee
Confidence            67789999997 789999999997643


No 232
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=58.40  E-value=5.7  Score=26.62  Aligned_cols=27  Identities=30%  Similarity=0.234  Sum_probs=22.4

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|-+|+||+++ .+|.+.=+||+.+-.
T Consensus       123 H~~l~~~ni~~~-~~~~~~l~df~~~~~  149 (264)
T cd06623         123 HRDIKPSNLLIN-SKGEVKIADFGISKV  149 (264)
T ss_pred             cCCCCHHHEEEC-CCCCEEEccCcccee
Confidence            368899999997 789999999986543


No 233
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=58.38  E-value=10  Score=26.58  Aligned_cols=26  Identities=27%  Similarity=0.280  Sum_probs=22.3

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|-+|+||+++ .+|.+.=+|||.+.
T Consensus       138 H~dl~p~nIl~~-~~~~~kL~dfg~~~  163 (307)
T cd06607         138 HRDIKAGNILLT-EPGTVKLADFGSAS  163 (307)
T ss_pred             ecCCCcccEEEC-CCCCEEEeecCcce
Confidence            378899999997 78999999999664


No 234
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=58.29  E-value=5.2  Score=28.46  Aligned_cols=24  Identities=33%  Similarity=0.452  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.-+|||.+
T Consensus       120 ~dlkp~Nill~-~~~~~kl~Dfg~~  143 (318)
T cd05570         120 RDLKLDNVLLD-SEGHIKIADFGMC  143 (318)
T ss_pred             cCCCHHHeEEC-CCCcEEecccCCC
Confidence            67789999997 8899999999965


No 235
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=58.14  E-value=9  Score=26.14  Aligned_cols=25  Identities=32%  Similarity=0.357  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ ..|.+.=+|||.+-
T Consensus       126 ~dl~p~Nill~-~~~~~~L~dfg~~~  150 (262)
T cd05071         126 RDLRAANILVG-ENLVCKVADFGLAR  150 (262)
T ss_pred             cccCcccEEEc-CCCcEEeccCCcee
Confidence            67789999997 78999999999764


No 236
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=58.01  E-value=6.7  Score=26.58  Aligned_cols=25  Identities=28%  Similarity=0.216  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .++.+.-+|||.+-
T Consensus       119 ~dlkp~nill~-~~~~~kl~Dfg~~~  143 (257)
T cd05116         119 RDLAARNVLLV-TQHYAKISDFGLSK  143 (257)
T ss_pred             cccchhhEEEc-CCCeEEECCCcccc
Confidence            78899999997 68888889998653


No 237
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=57.79  E-value=7.8  Score=26.16  Aligned_cols=25  Identities=24%  Similarity=0.218  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .++++.=+|||.+-
T Consensus       137 ~dlkp~Nil~~-~~~~~kl~dfg~~~  161 (273)
T cd05035         137 RDLAARNCMLR-EDMTVCVADFGLSK  161 (273)
T ss_pred             cccchheEEEC-CCCeEEECCcccee
Confidence            67889999997 78999999999753


No 238
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=57.74  E-value=8.9  Score=26.22  Aligned_cols=25  Identities=32%  Similarity=0.202  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .++.+--+|||.+-
T Consensus       136 ~dikp~nili~-~~~~~kl~dfgl~~  160 (270)
T cd05047         136 RDLAARNILVG-ENYVAKIADFGLSR  160 (270)
T ss_pred             cccccceEEEc-CCCeEEECCCCCcc
Confidence            78889999996 88999999999653


No 239
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=57.59  E-value=7  Score=26.95  Aligned_cols=24  Identities=46%  Similarity=0.576  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+||+++ .+|.+.=+|||..
T Consensus       129 ~dl~p~nil~~-~~~~~~l~dfg~~  152 (288)
T cd05583         129 RDIKLENILLD-SEGHVVLTDFGLS  152 (288)
T ss_pred             cCCCHHHeEEC-CCCCEEEEECccc
Confidence            78899999997 7899999999864


No 240
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=57.57  E-value=5.4  Score=28.42  Aligned_cols=25  Identities=32%  Similarity=0.340  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       125 rdlkp~Nill~-~~~~~kL~Dfg~~~  149 (324)
T cd05589         125 RDLKLDNLLLD-TEGFVKIADFGLCK  149 (324)
T ss_pred             cCCCHHHeEEC-CCCcEEeCcccCCc
Confidence            67789999997 78999999999653


No 241
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=57.39  E-value=10  Score=26.42  Aligned_cols=25  Identities=32%  Similarity=0.218  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+|||++ .++.+.=+|||...
T Consensus       143 ~dlkp~Nill~-~~~~~kl~dfg~~~  167 (297)
T cd05089         143 RDLAARNVLVG-ENLASKIADFGLSR  167 (297)
T ss_pred             CcCCcceEEEC-CCCeEEECCcCCCc
Confidence            68899999997 78888889999754


No 242
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=57.32  E-value=8.4  Score=26.49  Aligned_cols=25  Identities=24%  Similarity=0.133  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .++.+-=+|||.+-
T Consensus       148 ~dlkp~nili~-~~~~~kl~dfg~~~  172 (283)
T cd05090         148 KDLAARNILIG-EQLHVKISDLGLSR  172 (283)
T ss_pred             hccccceEEEc-CCCcEEeccccccc
Confidence            67889999997 78889989999764


No 243
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=57.29  E-value=14  Score=24.91  Aligned_cols=29  Identities=24%  Similarity=0.236  Sum_probs=24.2

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      -+|-.|+||+++ ..|++.=+||+......
T Consensus       123 h~dl~~~nil~~-~~~~~~l~d~~~~~~~~  151 (258)
T cd05578         123 HRDIKPDNILLD-EQGHVHITDFNIATKVT  151 (258)
T ss_pred             ccCCCHHHeEEc-CCCCEEEeecccccccC
Confidence            378899999997 88999999999776543


No 244
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=57.03  E-value=7.1  Score=27.95  Aligned_cols=25  Identities=28%  Similarity=0.327  Sum_probs=22.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|++.=+|||.+.
T Consensus       126 rDlkp~Nili~-~~~~~kL~DfG~a~  150 (332)
T cd05623         126 RDIKPDNILMD-MNGHIRLADFGSCL  150 (332)
T ss_pred             cCCCHHHEEEC-CCCCEEEeecchhe
Confidence            67789999997 88999999999764


No 245
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=57.01  E-value=11  Score=25.58  Aligned_cols=26  Identities=31%  Similarity=0.231  Sum_probs=22.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .++.+.=+|||.+..
T Consensus       126 ~di~p~Nili~-~~~~~~l~dfg~~~~  151 (260)
T cd05070         126 RDLRSANILVG-DGLVCKIADFGLARL  151 (260)
T ss_pred             CCCccceEEEe-CCceEEeCCceeeee
Confidence            67789999997 788898899997743


No 246
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=56.87  E-value=8.1  Score=26.68  Aligned_cols=24  Identities=29%  Similarity=0.360  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|++.=+|||.+
T Consensus       127 ~dlkp~Nil~~-~~~~~~l~Dfg~~  150 (291)
T cd07870         127 RDLKPQNLLIS-YLGELKLADFGLA  150 (291)
T ss_pred             CCCChHHEEEc-CCCcEEEeccccc
Confidence            68899999997 8899999999965


No 247
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=56.82  E-value=8.5  Score=26.40  Aligned_cols=24  Identities=29%  Similarity=0.308  Sum_probs=20.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ ..+++.=+|||.+
T Consensus       133 ~dlkp~Nil~~-~~~~~kL~dfG~~  156 (279)
T cd05109         133 RDLAARNVLVK-SPNHVKITDFGLA  156 (279)
T ss_pred             cccccceEEEc-CCCcEEECCCCce
Confidence            67889999996 7889999999965


No 248
>KOG3087|consensus
Probab=56.63  E-value=12  Score=27.21  Aligned_cols=30  Identities=30%  Similarity=0.339  Sum_probs=25.3

Q ss_pred             CCCCCCcEEEEcCCCcE--EEEeeceeecccc
Q psy16910         13 GDRHLENTLVCTKTGRC--VGIDFGYSFGVAT   42 (82)
Q Consensus        13 gDRh~~nili~~~tG~v--~hiDfg~~~~~~~   42 (82)
                      ||=.-+||++....+++  +-||||.++.+..
T Consensus       137 GDLTTSNill~~~~~~~~~~lIdfgls~~s~~  168 (229)
T KOG3087|consen  137 GDLTTSNILLRSDGNQITPILIDFGLSSVSRL  168 (229)
T ss_pred             ccccccceEEecCCCcCceEEEeecchhcccC
Confidence            78889999998888888  8999998776643


No 249
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=56.49  E-value=7.9  Score=26.70  Aligned_cols=25  Identities=28%  Similarity=0.189  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .+|.+.=+|||..-
T Consensus       133 ~dlkp~Nil~~-~~~~~~l~dfg~~~  157 (284)
T cd05079         133 RDLAARNVLVE-SEHQVKIGDFGLTK  157 (284)
T ss_pred             cccchheEEEc-CCCCEEECCCcccc
Confidence            68899999997 78999989999653


No 250
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=56.48  E-value=7.7  Score=26.57  Aligned_cols=24  Identities=25%  Similarity=0.205  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||.+
T Consensus       143 ~dlkp~Nil~~-~~~~~~l~dfg~~  166 (277)
T cd05062         143 RDLAARNCMVA-EDFTVKIGDFGMT  166 (277)
T ss_pred             CCcchheEEEc-CCCCEEECCCCCc
Confidence            67789999997 7899999999965


No 251
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=56.30  E-value=7.7  Score=26.90  Aligned_cols=25  Identities=28%  Similarity=0.317  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+.
T Consensus       121 ~dlkp~Nili~-~~~~~~l~dfg~~~  145 (280)
T cd05608         121 RDLKPENVLLD-NDGNVRISDLGLAV  145 (280)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCccce
Confidence            56789999997 78999999999764


No 252
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=56.21  E-value=8.2  Score=25.72  Aligned_cols=26  Identities=31%  Similarity=0.298  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=+|+||+++ .+|.+.-+|||.+..
T Consensus       117 ~di~~~nil~~-~~~~~~l~dfg~~~~  142 (265)
T cd05579         117 RDLKPDNILID-SNGHLKLTDFGLSKV  142 (265)
T ss_pred             CCCCHHHeEEc-CCCCEEEEecccchh
Confidence            78899999997 789999999986543


No 253
>KOG0665|consensus
Probab=56.19  E-value=6.5  Score=30.47  Aligned_cols=42  Identities=26%  Similarity=0.301  Sum_probs=29.8

Q ss_pred             eeeCCC--CCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHH
Q psy16910         10 YSIGDR--HLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILA   61 (82)
Q Consensus        10 lgigDR--h~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~   61 (82)
                      .||..|  -|+||++. .++.+=-.|||++         ..|.+-||+||=++.
T Consensus       137 ~~IihRdLkPsnivv~-~~~~lKi~dfg~a---------r~e~~~~~mtpyVvt  180 (369)
T KOG0665|consen  137 AGIIHRDLKPSNIVVN-SDCTLKILDFGLA---------RTEDTDFMMTPYVVT  180 (369)
T ss_pred             cceeecccCcccceec-chhheeeccchhh---------cccCcccccCchhhe
Confidence            455555  89999994 8888888899853         234445788876553


No 254
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=56.01  E-value=8.9  Score=26.34  Aligned_cols=25  Identities=28%  Similarity=0.368  Sum_probs=21.7

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      -+|-+|+||+++ .+|.+.-+|||..
T Consensus       124 h~dl~p~Ni~i~-~~~~~~l~dfg~~  148 (277)
T cd06641         124 HRDIKAANVLLS-EHGEVKLADFGVA  148 (277)
T ss_pred             cCCCCHHhEEEC-CCCCEEEeecccc
Confidence            478899999997 8899999999854


No 255
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=56.00  E-value=9.5  Score=25.91  Aligned_cols=25  Identities=40%  Similarity=0.456  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      ||=+|+||+++ .+|.+.-+||+.+-
T Consensus       132 ~dl~~~nil~~-~~~~~~l~d~~~~~  156 (272)
T cd06629         132 RDLKADNLLVD-ADGICKISDFGISK  156 (272)
T ss_pred             cCCChhhEEEc-CCCeEEEeeccccc
Confidence            78899999997 89999999999664


No 256
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=55.93  E-value=6.6  Score=27.60  Aligned_cols=26  Identities=27%  Similarity=0.400  Sum_probs=22.3

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -||=+|+||+++ ..|.+.=+|||.+-
T Consensus       139 H~dl~p~Nilv~-~~~~~~l~dfg~~~  164 (292)
T cd06657         139 HRDIKSDSILLT-HDGRVKLSDFGFCA  164 (292)
T ss_pred             cCCCCHHHEEEC-CCCCEEEcccccce
Confidence            489999999997 77899999999653


No 257
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=55.90  E-value=6.4  Score=27.74  Aligned_cols=25  Identities=24%  Similarity=0.191  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|.+.=+|||.+-
T Consensus       127 ~dlkp~NIll~-~~~~~kL~Dfg~~~  151 (338)
T cd07859         127 RDLKPKNILAN-ADCKLKICDFGLAR  151 (338)
T ss_pred             CCCCHHHeEEC-CCCcEEEccCcccc
Confidence            67789999997 89999999999753


No 258
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=55.84  E-value=7.7  Score=26.74  Aligned_cols=25  Identities=36%  Similarity=0.361  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       119 ~dlkp~Nill~-~~~~~~l~dfg~~~  143 (279)
T cd06619         119 RDVKPSNMLVN-TRGQVKLCDFGVST  143 (279)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCcce
Confidence            78899999997 78999999999664


No 259
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=55.75  E-value=7.9  Score=26.07  Aligned_cols=25  Identities=36%  Similarity=0.307  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .+|.+.=+|||.+.
T Consensus       125 ~dl~~~ni~~~-~~~~~~l~d~g~~~  149 (265)
T cd06605         125 RDVKPSNILVN-SRGQIKLCDFGVSG  149 (265)
T ss_pred             CCCCHHHEEEC-CCCCEEEeecccch
Confidence            67889999997 68999999998653


No 260
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=55.69  E-value=11  Score=25.62  Aligned_cols=26  Identities=31%  Similarity=0.215  Sum_probs=22.3

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      =+|=+|+||+++ .+|++.=+||+..-
T Consensus       122 H~dl~~~ni~i~-~~~~~~l~d~~~~~  147 (283)
T cd07830         122 HRDLKPENLLVS-GPEVVKIADFGLAR  147 (283)
T ss_pred             cCCCChhhEEEc-CCCCEEEeecccce
Confidence            378899999997 79999999998653


No 261
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=55.65  E-value=6.9  Score=26.99  Aligned_cols=25  Identities=32%  Similarity=0.202  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .+|.+.=+|||.+-
T Consensus       154 ~dl~p~nil~~-~~~~~~l~dfg~~~  178 (288)
T cd05050         154 RDLATRNCLVG-ENMVVKIADFGLSR  178 (288)
T ss_pred             ccccHhheEec-CCCceEECccccce
Confidence            78899999996 88999999999653


No 262
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=55.45  E-value=8.1  Score=26.34  Aligned_cols=26  Identities=35%  Similarity=0.327  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.-+|||.+-.
T Consensus       125 ~dl~p~ni~i~-~~~~~~l~dfg~~~~  150 (277)
T cd06917         125 RDIKAANILVT-NTGNVKLCDFGVAAL  150 (277)
T ss_pred             CCcCHHHEEEc-CCCCEEEccCCceee
Confidence            67789999997 699999999996643


No 263
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=55.28  E-value=8.4  Score=26.39  Aligned_cols=26  Identities=31%  Similarity=0.335  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|-.|+||+++ ..|.+--+|||.+..
T Consensus       148 ~dlkp~nili~-~~~~~kl~dfg~~~~  173 (286)
T cd06638         148 RDVKGNNILLT-TEGGVKLVDFGVSAQ  173 (286)
T ss_pred             cCCCHHhEEEC-CCCCEEEccCCceee
Confidence            67889999997 788899999997643


No 264
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=55.16  E-value=9.4  Score=26.44  Aligned_cols=24  Identities=25%  Similarity=0.196  Sum_probs=21.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||.+
T Consensus       143 ~dikp~nili~-~~~~~~L~Dfg~~  166 (288)
T cd05061         143 RDLAARNCMVA-HDFTVKIGDFGMT  166 (288)
T ss_pred             CCCChheEEEc-CCCcEEECcCCcc
Confidence            67789999997 7899999999864


No 265
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=54.75  E-value=8.6  Score=26.79  Aligned_cols=26  Identities=27%  Similarity=0.262  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.=+|||.+..
T Consensus       126 ~dikp~Nil~~-~~~~~~l~Dfg~~~~  151 (285)
T cd05630         126 RDLKPENILLD-DHGHIRISDLGLAVH  151 (285)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeccceee
Confidence            67789999997 789999999997643


No 266
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=54.74  E-value=9.5  Score=26.01  Aligned_cols=24  Identities=29%  Similarity=0.281  Sum_probs=20.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .++.+-=+|||.+
T Consensus       119 ~dlkp~nil~~-~~~~~kl~dfg~~  142 (257)
T cd05115         119 RDLAARNVLLV-NQHYAKISDFGLS  142 (257)
T ss_pred             cccchheEEEc-CCCcEEeccCCcc
Confidence            68899999997 7888888999865


No 267
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=54.69  E-value=11  Score=25.81  Aligned_cols=24  Identities=25%  Similarity=0.177  Sum_probs=20.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .++.+.=+|||.+
T Consensus       131 ~dlkp~Nili~-~~~~~~l~dfg~~  154 (283)
T cd05080         131 RDLAARNVLLD-NDRLVKIGDFGLA  154 (283)
T ss_pred             cccChheEEEc-CCCcEEEeecccc
Confidence            67789999997 7789999999965


No 268
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=54.50  E-value=16  Score=25.35  Aligned_cols=25  Identities=24%  Similarity=0.255  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+.
T Consensus       121 ~dikp~Nil~~-~~~~~~l~dfg~~~  145 (279)
T cd05633         121 RDLKPANILLD-EHGHVRISDLGLAC  145 (279)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCCcce
Confidence            67789999997 88999999999764


No 269
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=54.32  E-value=8.3  Score=26.51  Aligned_cols=26  Identities=27%  Similarity=0.323  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.=+|||.+..
T Consensus       124 ~dlkp~Nill~-~~~~~kl~Dfg~~~~  149 (287)
T cd07848         124 RDIKPENLLIS-HNDVLKLCDFGFARN  149 (287)
T ss_pred             CCCCHHHEEEc-CCCcEEEeeccCccc
Confidence            57789999996 889999999997643


No 270
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=54.27  E-value=8.3  Score=26.40  Aligned_cols=24  Identities=29%  Similarity=0.372  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-+|+||+++ .+|.+.=+|||.+
T Consensus       124 ~~l~p~nill~-~~~~~~l~dfg~~  147 (284)
T cd07860         124 RDLKPQNLLIN-TEGAIKLADFGLA  147 (284)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeccch
Confidence            88899999997 8899999999865


No 271
>KOG0599|consensus
Probab=54.20  E-value=9.7  Score=29.42  Aligned_cols=23  Identities=30%  Similarity=0.340  Sum_probs=20.5

Q ss_pred             CCCCCcEEEEcCCCcEEEEeecee
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      |-.|+|||+| .+-++.-.|||++
T Consensus       148 DLKpENILld-dn~~i~isDFGFa  170 (411)
T KOG0599|consen  148 DLKPENILLD-DNMNIKISDFGFA  170 (411)
T ss_pred             ccChhheeec-cccceEEecccee
Confidence            5679999998 9999999999975


No 272
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=53.88  E-value=10  Score=25.77  Aligned_cols=24  Identities=38%  Similarity=0.362  Sum_probs=21.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+||+++ .+|.+.=+|||..
T Consensus       124 ~dl~p~nili~-~~~~~kl~d~g~~  147 (256)
T cd05113         124 RDLAARNCLVD-DQGCVKVSDFGLS  147 (256)
T ss_pred             cccCcceEEEc-CCCCEEECCCccc
Confidence            67899999997 7899999999864


No 273
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=53.87  E-value=10  Score=26.62  Aligned_cols=25  Identities=28%  Similarity=0.254  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .++.+.=+|||.+.
T Consensus       133 ~dikp~Nill~-~~~~~kL~Dfg~~~  157 (303)
T cd05110         133 RDLAARNVLVK-SPNHVKITDFGLAR  157 (303)
T ss_pred             cccccceeeec-CCCceEEccccccc
Confidence            57789999996 78899999999764


No 274
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=53.70  E-value=10  Score=26.44  Aligned_cols=25  Identities=28%  Similarity=0.255  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .+|.+.=+|||.+-
T Consensus       161 ~dlkp~Nili~-~~~~~kl~D~g~~~  185 (304)
T cd05101         161 RDLAARNVLVT-ENNVMKIADFGLAR  185 (304)
T ss_pred             cccccceEEEc-CCCcEEECCCccce
Confidence            68889999997 88999999998753


No 275
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=53.54  E-value=8.7  Score=26.32  Aligned_cols=25  Identities=28%  Similarity=0.335  Sum_probs=22.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-+|+||+++ .+|++.=+|||.+.
T Consensus       145 ~dl~~~nili~-~~~~~~l~dfg~~~  169 (282)
T cd06636         145 RDIKGQNVLLT-ENAEVKLVDFGVSA  169 (282)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCcchh
Confidence            78899999997 88999999998754


No 276
>PF14956 DUF4505:  Domain of unknown function (DUF4505)
Probab=53.45  E-value=9.5  Score=26.94  Aligned_cols=17  Identities=18%  Similarity=0.124  Sum_probs=15.4

Q ss_pred             CCCCcEEEEcCCCcEEE
Q psy16910         15 RHLENTLVCTKTGRCVG   31 (82)
Q Consensus        15 Rh~~nili~~~tG~v~h   31 (82)
                      =.|+++.+++.||+|+|
T Consensus       114 FqPe~L~m~~~sGRvYH  130 (183)
T PF14956_consen  114 FQPEKLCMDPSSGRVYH  130 (183)
T ss_pred             cccceEEEcCCCCcEec
Confidence            36999999999999998


No 277
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=53.23  E-value=12  Score=25.61  Aligned_cols=25  Identities=20%  Similarity=0.154  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+|||++ .+|.+.=+|||...
T Consensus       123 ~dikp~nil~~-~~~~~~l~Dfg~~~  147 (268)
T cd05086         123 SDLALRNCFLT-SDLTVKVGDYGIGP  147 (268)
T ss_pred             cCCccceEEEc-CCccEEeccccccc
Confidence            68889999996 78999999999754


No 278
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=52.99  E-value=7.5  Score=28.03  Aligned_cols=26  Identities=23%  Similarity=0.178  Sum_probs=22.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.-+|||.+-.
T Consensus       142 ~dlkp~Nil~~-~~~~~kL~Dfg~~~~  167 (353)
T cd07850         142 RDLKPSNIVVK-SDCTLKILDFGLART  167 (353)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCcccee
Confidence            67889999997 789999999997643


No 279
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=52.96  E-value=11  Score=26.07  Aligned_cols=25  Identities=32%  Similarity=0.135  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .+|.+.=+|||.+-
T Consensus       144 ~dlkp~Nili~-~~~~~kl~dfg~~~  168 (288)
T cd05093         144 RDLATRNCLVG-ENLLVKIGDFGMSR  168 (288)
T ss_pred             cccCcceEEEc-cCCcEEeccCCccc
Confidence            68889999997 88999999998653


No 280
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=52.89  E-value=12  Score=24.91  Aligned_cols=27  Identities=30%  Similarity=0.260  Sum_probs=22.6

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|=+|+||+++ .+|.+.=+|||.+..
T Consensus       122 H~dl~~~ni~~~-~~~~~~l~dfg~~~~  148 (256)
T cd06612         122 HRDIKAGNILLN-EEGQAKLADFGVSGQ  148 (256)
T ss_pred             cCCCCcceEEEC-CCCcEEEcccccchh
Confidence            378899999997 789999999987554


No 281
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain. subfamily of choline kinases
Probab=52.72  E-value=15  Score=24.92  Aligned_cols=30  Identities=27%  Similarity=0.252  Sum_probs=23.2

Q ss_pred             eeeeeCCCCCCcEEEEcC-CC---cEEEEeecee
Q psy16910          8 LEYSIGDRHLENTLVCTK-TG---RCVGIDFGYS   37 (82)
Q Consensus         8 yilgigDRh~~nili~~~-tG---~v~hiDfg~~   37 (82)
                      .++.=||=|++|+|+... +|   .+.-|||..+
T Consensus       120 ~vl~HgD~~~~N~~~~~~~~~~~~~~~liDfq~~  153 (196)
T smart00587      120 NVLNHGDLWANNIMFKYDDEGKPEDVALIDFQLS  153 (196)
T ss_pred             eEEeeCCCCccceeeccCCCCCccceEEEecccC
Confidence            356669999999999643 34   6999999754


No 282
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=52.66  E-value=8.7  Score=26.22  Aligned_cols=26  Identities=31%  Similarity=0.321  Sum_probs=22.7

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=.|+||+++ .+|++.-+|||.+.
T Consensus       123 h~dl~p~ni~~~-~~~~~~l~d~g~~~  148 (284)
T cd07836         123 HRDLKPQNLLIN-KRGELKLADFGLAR  148 (284)
T ss_pred             eCCCCHHHEEEC-CCCcEEEeecchhh
Confidence            478899999997 89999999998764


No 283
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=52.23  E-value=8.9  Score=26.35  Aligned_cols=24  Identities=33%  Similarity=0.385  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||.+
T Consensus       132 ~dlkp~Nil~~-~~~~~kl~dfg~~  155 (288)
T cd06616         132 RDVKPSNILLD-RNGNIKLCDFGIS  155 (288)
T ss_pred             cCCCHHHEEEc-cCCcEEEeecchh
Confidence            68899999997 7899999999865


No 284
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=52.22  E-value=7.8  Score=26.52  Aligned_cols=25  Identities=32%  Similarity=0.372  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ ..|.+.=+|||.+-
T Consensus       123 ~dl~~~nil~~-~~~~~~l~dfg~~~  147 (284)
T cd07839         123 RDLKPQNLLIN-KNGELKLADFGLAR  147 (284)
T ss_pred             CCCCHHHEEEc-CCCcEEECccchhh
Confidence            77889999997 78999999999653


No 285
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=51.98  E-value=10  Score=25.66  Aligned_cols=25  Identities=36%  Similarity=0.393  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .+|.+.=+|||.+-
T Consensus       126 ~dl~p~ni~i~-~~~~~~l~dfg~~~  150 (260)
T cd05067         126 RDLRAANILVS-ETLCCKIADFGLAR  150 (260)
T ss_pred             ccccHHhEEEc-CCCCEEEccCccee
Confidence            67889999997 88999999998764


No 286
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=51.94  E-value=11  Score=29.29  Aligned_cols=24  Identities=38%  Similarity=0.560  Sum_probs=21.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.-+|||.+
T Consensus       167 rDLKP~NILl~-~~~~vkL~DFGls  190 (496)
T PTZ00283        167 RDIKSANILLC-SNGLVKLGDFGFS  190 (496)
T ss_pred             CCCCHHHEEEe-CCCCEEEEecccC
Confidence            57789999997 7899999999965


No 287
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=51.90  E-value=8.5  Score=26.98  Aligned_cols=24  Identities=29%  Similarity=0.303  Sum_probs=20.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+||+++ .+|.+.=+|||.+
T Consensus       164 ~dlkp~Nill~-~~~~~kL~dfg~a  187 (307)
T cd05098         164 RDLAARNVLVT-EDNVMKIADFGLA  187 (307)
T ss_pred             ccccHHheEEc-CCCcEEECCCccc
Confidence            67889999997 7799999999865


No 288
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=51.89  E-value=11  Score=26.08  Aligned_cols=25  Identities=32%  Similarity=0.361  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .+|.+.=+|||.+-
T Consensus       152 ~dlkp~nili~-~~~~~kl~dfg~~~  176 (291)
T cd06639         152 RDVKGNNILLT-TEGGVKLVDFGVSA  176 (291)
T ss_pred             cCCCHHHEEEc-CCCCEEEeecccch
Confidence            68899999996 78899999998653


No 289
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=51.89  E-value=10  Score=26.19  Aligned_cols=24  Identities=33%  Similarity=0.170  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+||+++ .++.+.-+|||.+
T Consensus       146 ~dlkp~nil~~-~~~~~kL~dfg~~  169 (280)
T cd05092         146 RDLATRNCLVG-QGLVVKIGDFGMS  169 (280)
T ss_pred             ccccHhhEEEc-CCCCEEECCCCce
Confidence            68889999997 7899999999965


No 290
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=51.65  E-value=8  Score=26.71  Aligned_cols=26  Identities=27%  Similarity=0.244  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|-.|+||+++ ..|.+.=+||+.+..
T Consensus       139 ~dl~p~nil~~-~~~~~~l~dfg~~~~  164 (311)
T cd07866         139 RDIKAANILID-NQGILKIADFGLARP  164 (311)
T ss_pred             CCCCHHHEEEC-CCCCEEECcCccchh
Confidence            67889999997 889999999987643


No 291
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=51.65  E-value=11  Score=24.91  Aligned_cols=29  Identities=28%  Similarity=0.261  Sum_probs=23.7

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      -+|=+|+||+++ .+|.+.=+||+.+....
T Consensus       122 H~dl~p~ni~i~-~~~~~~l~d~~~~~~~~  150 (254)
T cd06627         122 HRDIKAANILTT-KDGVVKLADFGVATKLN  150 (254)
T ss_pred             cCCCCHHHEEEC-CCCCEEEeccccceecC
Confidence            478899999997 68999999999765443


No 292
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=51.56  E-value=9.4  Score=25.87  Aligned_cols=25  Identities=28%  Similarity=0.300  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+.
T Consensus       130 ~dl~p~nill~-~~~~~~l~dfg~~~  154 (267)
T cd06646         130 RDIKGANILLT-DNGDVKLADFGVAA  154 (267)
T ss_pred             cCCCHHHEEEC-CCCCEEECcCccce
Confidence            67789999996 88999999999764


No 293
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=51.51  E-value=12  Score=26.01  Aligned_cols=24  Identities=38%  Similarity=0.282  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||.+
T Consensus       154 ~dlkp~Nili~-~~~~~~l~dfg~~  177 (296)
T cd05095         154 RDLATRNCLVG-KNYTIKIADFGMS  177 (296)
T ss_pred             ccCChheEEEc-CCCCEEeccCccc
Confidence            67789999997 7899999999975


No 294
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=51.41  E-value=8.3  Score=26.07  Aligned_cols=24  Identities=38%  Similarity=0.308  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+||+++ .++.+.=+|||.+
T Consensus       130 ~di~p~nil~~-~~~~~~l~dfg~~  153 (267)
T cd06628         130 RDIKGANILVD-NKGGIKISDFGIS  153 (267)
T ss_pred             ccCCHHHEEEc-CCCCEEecccCCC
Confidence            68899999997 8899999999865


No 295
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=51.38  E-value=9.9  Score=26.28  Aligned_cols=24  Identities=33%  Similarity=0.349  Sum_probs=20.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+||+++ ..+.+.=+|||.+
T Consensus       151 ~dikp~nill~-~~~~~kl~dfg~~  174 (290)
T cd05045         151 RDLAARNVLVA-EGRKMKISDFGLS  174 (290)
T ss_pred             hhhhhheEEEc-CCCcEEecccccc
Confidence            78889999996 7888888899865


No 296
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=51.29  E-value=8.7  Score=27.41  Aligned_cols=26  Identities=31%  Similarity=0.230  Sum_probs=22.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|-.|+||+++ .+|.+.-+|||.+..
T Consensus       131 ~dlkp~Nil~~-~~~~~kl~dfg~~~~  156 (334)
T cd07855         131 RDLKPSNLLVN-EDCELRIGDFGMARG  156 (334)
T ss_pred             CCCCHHHEEEc-CCCcEEeccccccee
Confidence            68889999997 899999999997643


No 297
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=51.11  E-value=12  Score=26.00  Aligned_cols=25  Identities=32%  Similarity=0.114  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .++.+.=+|||.+-
T Consensus       147 ~dlkp~Nil~~-~~~~~~l~dfg~a~  171 (291)
T cd05094         147 RDLATRNCLVG-ANLLVKIGDFGMSR  171 (291)
T ss_pred             cccCcceEEEc-cCCcEEECCCCccc
Confidence            68889999997 78899999999653


No 298
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=51.02  E-value=10  Score=26.04  Aligned_cols=25  Identities=32%  Similarity=0.246  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|++.=+|||..-
T Consensus       132 ~dlkp~nili~-~~~~~~l~dfg~~~  156 (284)
T cd05081         132 RDLATRNILVE-SENRVKIGDFGLTK  156 (284)
T ss_pred             ccCCHhhEEEC-CCCeEEECCCcccc
Confidence            67889999996 88999999998653


No 299
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=50.99  E-value=8.6  Score=26.03  Aligned_cols=26  Identities=27%  Similarity=0.262  Sum_probs=22.2

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=.|+||+++ .+|.+.=+|||.+-
T Consensus       125 H~dl~p~nil~~-~~~~~~l~dfg~~~  150 (265)
T cd06631         125 HRDIKGNNVMLM-PNGIIKLIDFGCAR  150 (265)
T ss_pred             cCCcCHHhEEEC-CCCeEEeccchhhH
Confidence            378899999997 88999999998653


No 300
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=50.99  E-value=9.2  Score=26.76  Aligned_cols=27  Identities=26%  Similarity=0.278  Sum_probs=22.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|=.|+||+++ .+|.+.-+|||.+...
T Consensus       132 ~dl~p~nil~~-~~~~~kL~dfg~~~~~  158 (309)
T cd07845         132 RDLKVSNLLLT-DKGCLKIADFGLARTY  158 (309)
T ss_pred             CCCCHHHEEEC-CCCCEEECccceeeec
Confidence            67789999997 8899999999976543


No 301
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=50.92  E-value=15  Score=24.98  Aligned_cols=26  Identities=31%  Similarity=0.176  Sum_probs=21.9

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=.|+||+++ ..|.+.=+|||..-
T Consensus       130 H~dl~p~nili~-~~~~~~l~d~g~~~  155 (270)
T cd05056         130 HRDIAARNVLVS-SPDCVKLGDFGLSR  155 (270)
T ss_pred             ccccChheEEEe-cCCCeEEccCceee
Confidence            368889999997 78999999998653


No 302
>PF07804 HipA_C:  HipA-like C-terminal domain;  InterPro: IPR012893 The members of this entry are similar to a region close to the C terminus of the HipA protein expressed by various bacterial species (for example P23874 from SWISSPROT). This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis []. When expressed alone, it is toxic to bacterial cells [], but it is usually tightly associated with HipB [], and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products []. ; PDB: 3AKL_D 3AKJ_B 3AKK_D 2WIU_C 3HZI_A 3DNT_B 3FBR_A 3DNU_A 3DNV_A.
Probab=50.83  E-value=4.8  Score=23.69  Aligned_cols=31  Identities=19%  Similarity=0.186  Sum_probs=17.0

Q ss_pred             eeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910          5 SLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus         5 ~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      ++.|++|=+|||..|+=+-..++.+   -+.|+|
T Consensus        48 ~fn~ligN~D~H~kN~s~l~~~~~~---~LaP~Y   78 (79)
T PF07804_consen   48 VFNYLIGNTDRHLKNFSFLYDGGGW---RLAPAY   78 (79)
T ss_dssp             HHHHHCTBS---CCCSEEEEECCEE---EE--B-
T ss_pred             HHHHHHcCCcCCcCCEEEEEcCCeE---EecCCC
Confidence            3567888899999999885554443   355444


No 303
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]
Probab=50.76  E-value=21  Score=25.93  Aligned_cols=33  Identities=24%  Similarity=0.147  Sum_probs=26.8

Q ss_pred             eeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910          8 LEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus         8 yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      +++.=+|=+|+|++.+ ..|+++=|||-++--.+
T Consensus       153 ~v~cH~Dl~~~N~l~t-~~~~l~LIDWEyAg~~D  185 (269)
T COG0510         153 LVPCHNDLNPGNLLLT-DKGGLFLIDWEYAGLND  185 (269)
T ss_pred             eeeecCCCCccceEEc-CCCcEEEEecccCCCcc
Confidence            4566689999999995 67999999998875444


No 304
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=50.74  E-value=12  Score=25.49  Aligned_cols=24  Identities=29%  Similarity=0.252  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+||+++ .++.+.=+|||.+
T Consensus       124 ~dlkp~nil~~-~~~~~kL~dfg~~  147 (269)
T cd05087         124 SDLALRNCLLT-ADLTVKIGDYGLS  147 (269)
T ss_pred             cccCcceEEEc-CCCcEEECCcccc
Confidence            68889999997 7899999999865


No 305
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=50.73  E-value=10  Score=27.25  Aligned_cols=26  Identities=23%  Similarity=0.148  Sum_probs=22.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|-.|+||+++ .+|++.=+|||.+..
T Consensus       141 ~dlkp~NIll~-~~~~~kL~dfg~~~~  166 (342)
T cd07879         141 RDLKPGNLAVN-EDCELKILDFGLARH  166 (342)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCCCcC
Confidence            67889999997 789999999996543


No 306
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=50.53  E-value=12  Score=25.16  Aligned_cols=25  Identities=36%  Similarity=0.368  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .++.+.=+|||.+-
T Consensus       124 ~dl~p~ni~i~-~~~~~kl~d~g~~~  148 (256)
T cd05114         124 RDLAARNCLVS-STGVVKVSDFGMTR  148 (256)
T ss_pred             cccCcceEEEc-CCCeEEECCCCCcc
Confidence            67789999997 78899999998653


No 307
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=50.45  E-value=9.9  Score=25.69  Aligned_cols=25  Identities=24%  Similarity=0.197  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||...
T Consensus       130 ~dl~p~nili~-~~~~~~l~dfg~~~  154 (267)
T cd08229         130 RDIKPANVFIT-ATGVVKLGDLGLGR  154 (267)
T ss_pred             CCCCHHHEEEc-CCCCEEECcchhhh
Confidence            78899999997 78999999998653


No 308
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=50.43  E-value=8.6  Score=27.41  Aligned_cols=25  Identities=28%  Similarity=0.169  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+.
T Consensus       129 ~dlkp~Nili~-~~~~~kl~Dfg~a~  153 (332)
T cd07857         129 RDLKPGNLLVN-ADCELKICDFGLAR  153 (332)
T ss_pred             CCCCHHHeEEc-CCCCEEeCcCCCce
Confidence            67789999997 78999999999764


No 309
>PRK11768 serine/threonine protein kinase; Provisional
Probab=50.38  E-value=9.6  Score=27.99  Aligned_cols=28  Identities=25%  Similarity=0.058  Sum_probs=21.7

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .+.+-=||=|++||+++ .  .+.-|||+.+
T Consensus       195 ~~~liHgD~h~~NvL~~-d--~~~iIDFDd~  222 (325)
T PRK11768        195 RLLRLHGDCHPGNILWR-D--GPHFVDLDDA  222 (325)
T ss_pred             CccceecCCCchhcccc-C--CcEEEeCCCC
Confidence            45566699999999994 3  4667999965


No 310
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=50.22  E-value=25  Score=24.23  Aligned_cols=26  Identities=31%  Similarity=0.309  Sum_probs=22.0

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|-+|+||+++ .++.+.-+|||.+-
T Consensus       128 H~dl~~~nil~~-~~~~~~l~dfg~~~  153 (287)
T cd06621         128 HRDIKPSNILLT-RKGQVKLCDFGVSG  153 (287)
T ss_pred             cCCCCHHHEEEe-cCCeEEEeeccccc
Confidence            378899999997 78899999999653


No 311
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=49.94  E-value=13  Score=25.31  Aligned_cols=24  Identities=25%  Similarity=0.216  Sum_probs=20.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+||+++ .+|.+.=+|||.+
T Consensus       143 ~di~p~nill~-~~~~~kl~dfg~~  166 (277)
T cd05032         143 RDLAARNCMVA-EDLTVKIGDFGMT  166 (277)
T ss_pred             cccChheEEEc-CCCCEEECCcccc
Confidence            67889999997 7899998999865


No 312
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=49.42  E-value=11  Score=26.25  Aligned_cols=26  Identities=27%  Similarity=0.245  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=+|+||+++ .++.+.=+|||.+..
T Consensus       126 ~dikp~Nili~-~~~~~kl~Dfg~~~~  151 (285)
T cd05632         126 RDLKPENILLD-DYGHIRISDLGLAVK  151 (285)
T ss_pred             cCCCHHHEEEC-CCCCEEEecCCccee
Confidence            67789999997 778999999997643


No 313
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=49.38  E-value=14  Score=24.88  Aligned_cols=26  Identities=31%  Similarity=0.296  Sum_probs=21.9

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=.|+||+++ .++.+--+|||.+-
T Consensus       127 h~dl~~~nilv~-~~~~~kl~d~g~~~  152 (261)
T cd05148         127 HRDLAARNILVG-EDLVCKVADFGLAR  152 (261)
T ss_pred             ccccCcceEEEc-CCceEEEccccchh
Confidence            378899999997 88888888998764


No 314
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=49.36  E-value=9  Score=26.45  Aligned_cols=25  Identities=32%  Similarity=0.353  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .+|.+.-+|||.+.
T Consensus       143 ~dl~p~nil~~-~~~~~kl~dfg~~~  167 (310)
T cd07865         143 RDMKAANILIT-KDGILKLADFGLAR  167 (310)
T ss_pred             cCCCHHHEEEC-CCCcEEECcCCCcc
Confidence            68889999996 88999999999764


No 315
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=49.33  E-value=11  Score=30.41  Aligned_cols=25  Identities=32%  Similarity=0.404  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ .+|++.=+|||.+-
T Consensus       128 rDLKP~NILl~-~~g~vkL~DFGls~  152 (669)
T cd05610         128 RDLKPDNMLIS-NEGHIKLTDFGLSK  152 (669)
T ss_pred             CCccHHHEEEc-CCCCEEEEeCCCCc
Confidence            57789999997 78999999999763


No 316
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=49.27  E-value=8.8  Score=27.41  Aligned_cols=26  Identities=23%  Similarity=0.101  Sum_probs=22.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|-.|+||+++ .+|.+.=+|||.+..
T Consensus       130 ~dlkp~Nill~-~~~~~kl~dfg~~~~  155 (336)
T cd07849         130 RDLKPSNLLLN-TNCDLKICDFGLARI  155 (336)
T ss_pred             cCCCHHHEEEC-CCCCEEECcccceee
Confidence            68899999996 889999999997643


No 317
>COG3960 Glyoxylate carboligase [General function prediction only]
Probab=49.20  E-value=19  Score=28.60  Aligned_cols=30  Identities=23%  Similarity=0.389  Sum_probs=24.0

Q ss_pred             eeeeeeCC----CCCCcEEEEcCCCcEEEEeece
Q psy16910          7 LLEYSIGD----RHLENTLVCTKTGRCVGIDFGY   36 (82)
Q Consensus         7 ~yilgigD----Rh~~nili~~~tG~v~hiDfg~   36 (82)
                      -+++|||+    ||-++|-+.++.-+++|+|.-|
T Consensus       272 d~vfgignrwanrhtgsv~vyt~gr~fihvdiep  305 (592)
T COG3960         272 DMVFGIGNRWANRHTGSVEVYTEGRKFIHVDIEP  305 (592)
T ss_pred             hheeeccchhhhcccCceeeeecCceEEEEeccc
Confidence            36899996    5778898987777899999754


No 318
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=49.15  E-value=15  Score=25.00  Aligned_cols=25  Identities=36%  Similarity=0.476  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .+|.+.=+|||.+.
T Consensus       124 ~~l~p~ni~~~-~~~~~~l~dfg~~~  148 (286)
T cd07846         124 RDIKPENILVS-QSGVVKLCDFGFAR  148 (286)
T ss_pred             cCCCHHHEEEC-CCCcEEEEeeeeee
Confidence            67889999996 78999999998754


No 319
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=49.14  E-value=12  Score=25.34  Aligned_cols=28  Identities=18%  Similarity=0.189  Sum_probs=23.5

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      =+|=+|+||+++ ..|++.=+|||.+...
T Consensus       137 H~dl~~~nil~~-~~~~~~l~dfg~~~~~  164 (269)
T cd08528         137 HRDLTPNNIMLG-EDDKVTITDFGLAKQK  164 (269)
T ss_pred             ecCCCHHHEEEC-CCCcEEEecccceeec
Confidence            478889999996 8899999999977543


No 320
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=49.11  E-value=13  Score=25.85  Aligned_cols=24  Identities=29%  Similarity=0.488  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+||+++ .+|.+.-+|||..
T Consensus       139 ~dl~p~Nil~~-~~~~~~l~d~g~~  162 (285)
T cd06648         139 RDIKSDSILLT-SDGRVKLSDFGFC  162 (285)
T ss_pred             CCCChhhEEEc-CCCcEEEcccccc
Confidence            78899999997 7899999999854


No 321
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=49.07  E-value=10  Score=26.54  Aligned_cols=24  Identities=29%  Similarity=0.473  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+||+++ ..|.+.=+|||.+
T Consensus       142 ~dlkp~Nill~-~~~~~kL~dfg~~  165 (292)
T cd06658         142 RDIKSDSILLT-SDGRIKLSDFGFC  165 (292)
T ss_pred             cCCCHHHEEEc-CCCCEEEccCcch
Confidence            88899999997 7799999999965


No 322
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=49.00  E-value=10  Score=27.30  Aligned_cols=27  Identities=22%  Similarity=0.164  Sum_probs=23.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|-.|+||+++ .+|++.=+|||.+...
T Consensus       142 ~dlkp~Nill~-~~~~~kL~dfg~~~~~  168 (343)
T cd07851         142 RDLKPSNIAVN-EDCELKILDFGLARHT  168 (343)
T ss_pred             CCCCHHHeEEC-CCCCEEEccccccccc
Confidence            78889999997 7899999999987544


No 323
>KOG0581|consensus
Probab=48.89  E-value=11  Score=29.30  Aligned_cols=24  Identities=38%  Similarity=0.379  Sum_probs=20.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|=-|+||||+ +.|+|=-+|||.+
T Consensus       203 RDIKPsNlLvN-skGeVKicDFGVS  226 (364)
T KOG0581|consen  203 RDIKPSNLLVN-SKGEVKICDFGVS  226 (364)
T ss_pred             ccCCHHHeeec-cCCCEEecccccc
Confidence            35579999998 8999999999965


No 324
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=48.83  E-value=19  Score=26.56  Aligned_cols=24  Identities=25%  Similarity=0.255  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+|||++ .++.+.=+|||.+
T Consensus       236 rDLkp~Nil~~-~~~~~kL~DfGla  259 (374)
T cd05106         236 RDVAARNVLLT-DGRVAKICDFGLA  259 (374)
T ss_pred             ccCchheEEEe-CCCeEEEeeceee
Confidence            68889999997 7889999999975


No 325
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=48.80  E-value=23  Score=24.67  Aligned_cols=26  Identities=31%  Similarity=0.396  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEE---cCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVC---TKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~---~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||++.   ..+|.+.-+|||.+-
T Consensus       132 ~Dlkp~Nil~~~~~~~~~~~kl~DfG~a~  160 (317)
T cd07867         132 RDLKPANILVMGEGPERGRVKIADMGFAR  160 (317)
T ss_pred             CCCCHHHEEEccCCCCCCcEEEeecccee
Confidence            67889999993   467899999999763


No 326
>KOG0583|consensus
Probab=48.71  E-value=12  Score=28.46  Aligned_cols=26  Identities=35%  Similarity=0.316  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      .|=-|+|||+|..+|++--+|||.+=
T Consensus       144 RDLK~ENilld~~~~~~Kl~DFG~s~  169 (370)
T KOG0583|consen  144 RDLKPENILLDGNEGNLKLSDFGLSA  169 (370)
T ss_pred             CCCCHHHEEecCCCCCEEEecccccc
Confidence            45579999999666999999999763


No 327
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=48.52  E-value=10  Score=26.31  Aligned_cols=24  Identities=33%  Similarity=0.371  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||.+
T Consensus       139 ~dl~p~nill~-~~~~~kL~dfg~~  162 (296)
T cd06618         139 RDVKPSNILLD-ASGNVKLCDFGIS  162 (296)
T ss_pred             CCCcHHHEEEc-CCCCEEECccccc
Confidence            78899999997 8999999999865


No 328
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=48.52  E-value=10  Score=25.81  Aligned_cols=24  Identities=33%  Similarity=0.414  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-+|+||+++ .+|.+.=+|||.+
T Consensus       122 ~dl~p~ni~i~-~~~~~~l~d~g~~  145 (274)
T cd06609         122 RDIKAANILLS-EEGDVKLADFGVS  145 (274)
T ss_pred             CCCCHHHEEEC-CCCCEEEcccccc
Confidence            78899999997 7999999999865


No 329
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=48.16  E-value=13  Score=25.08  Aligned_cols=27  Identities=30%  Similarity=0.375  Sum_probs=22.5

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|=+|+||+++ .+|.+.=+||+..-.
T Consensus       116 h~dl~~~nilv~-~~~~~~l~df~~~~~  142 (262)
T cd05572         116 YRDLKPENLLLD-SNGYVKLVDFGFAKK  142 (262)
T ss_pred             cCCCCHHHEEEc-CCCCEEEeeCCcccc
Confidence            478889999997 789999999987543


No 330
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=48.06  E-value=12  Score=26.31  Aligned_cols=25  Identities=24%  Similarity=0.187  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .++.+.-+|||.+-
T Consensus       165 ~dlkp~Nil~~-~~~~~~l~dfg~~~  189 (302)
T cd05055         165 RDLAARNVLLT-HGKIVKICDFGLAR  189 (302)
T ss_pred             hhhccceEEEc-CCCeEEECCCcccc
Confidence            68899999997 78888889999653


No 331
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=47.99  E-value=12  Score=25.29  Aligned_cols=24  Identities=21%  Similarity=0.092  Sum_probs=20.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.-+||+.+
T Consensus       109 ~dlkp~Nil~~-~~~~~~l~df~~~  132 (237)
T cd05576         109 RDLNPNNILLD-DRGHIQLTYFSRW  132 (237)
T ss_pred             cCCCHHHEEEc-CCCCEEEecccch
Confidence            68889999997 7899999999843


No 332
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=47.91  E-value=12  Score=25.41  Aligned_cols=26  Identities=31%  Similarity=0.286  Sum_probs=22.1

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=.|+||+++ .+|.+.=+|||.+.
T Consensus       129 H~dlkp~nili~-~~~~~~l~dfg~~~  154 (267)
T cd06645         129 HRDIKGANILLT-DNGHVKLADFGVSA  154 (267)
T ss_pred             cCCCCHHHEEEC-CCCCEEECcceeee
Confidence            367789999996 88999999999764


No 333
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=47.88  E-value=20  Score=25.75  Aligned_cols=25  Identities=24%  Similarity=0.242  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .++.+.-+|||.+-
T Consensus       203 ~dikp~Nil~~-~~~~~kl~dfg~~~  227 (343)
T cd05103         203 RDLAARNILLS-ENNVVKICDFGLAR  227 (343)
T ss_pred             CCCccCeEEEc-CCCcEEEEeccccc
Confidence            67789999997 78999999999653


No 334
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=47.73  E-value=10  Score=25.70  Aligned_cols=25  Identities=32%  Similarity=0.147  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||..-
T Consensus       130 ~dl~p~nil~~-~~~~~~l~Dfg~~~  154 (265)
T cd06652         130 RDIKGANILRD-SVGNVKLGDFGASK  154 (265)
T ss_pred             CCCCHHHEEec-CCCCEEECcCcccc
Confidence            78899999996 88999999998653


No 335
>PHA03209 serine/threonine kinase US3; Provisional
Probab=47.63  E-value=11  Score=27.34  Aligned_cols=24  Identities=21%  Similarity=0.230  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ ..+.+.-+|||.+
T Consensus       181 rDlkp~Nill~-~~~~~kl~DfG~a  204 (357)
T PHA03209        181 RDVKTENIFIN-DVDQVCIGDLGAA  204 (357)
T ss_pred             CCCCHHHEEEC-CCCCEEEecCccc
Confidence            67789999997 8899999999975


No 336
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=47.42  E-value=18  Score=24.41  Aligned_cols=24  Identities=29%  Similarity=0.321  Sum_probs=20.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+||+.+
T Consensus       119 ~di~p~nili~-~~~~~kl~df~~~  142 (257)
T cd05060         119 RDLAARNVLLV-NRHQAKISDFGMS  142 (257)
T ss_pred             cCcccceEEEc-CCCcEEecccccc
Confidence            67889999996 8899999999864


No 337
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=47.31  E-value=13  Score=25.31  Aligned_cols=24  Identities=33%  Similarity=0.462  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ ..|.+.=+|||.+
T Consensus       128 ~dlkp~nil~~-~~~~~kl~dfg~~  151 (283)
T cd06617         128 RDVKPSNVLIN-RNGQVKLCDFGIS  151 (283)
T ss_pred             CCCCHHHEEEC-CCCCEEEeecccc
Confidence            78899999997 7899999999864


No 338
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]
Probab=47.11  E-value=20  Score=27.25  Aligned_cols=44  Identities=23%  Similarity=0.172  Sum_probs=33.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhh
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVN   63 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~   63 (82)
                      ||=.+-||+++ .+|.++-|||=-+-..+      .+..++.|-+++.+++
T Consensus       226 GDlSefNIlV~-~dg~~~vIDwPQ~v~~~------hp~a~e~l~RDv~nii  269 (304)
T COG0478         226 GDLSEFNILVT-EDGDIVVIDWPQAVPIS------HPDAEELLERDVENII  269 (304)
T ss_pred             cCCchheEEEe-cCCCEEEEeCcccccCC------CCCHHHHHHhHHHHHH
Confidence            78889999996 89999999994222211      4556888888888775


No 339
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=47.09  E-value=14  Score=25.89  Aligned_cols=25  Identities=28%  Similarity=0.411  Sum_probs=21.9

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      -+|-.|+||+++ .+|.+.=+|||.+
T Consensus       140 H~dl~p~Nill~-~~~~~kL~dfg~~  164 (297)
T cd06659         140 HRDIKSDSILLT-LDGRVKLSDFGFC  164 (297)
T ss_pred             cCCCCHHHeEEc-cCCcEEEeechhH
Confidence            378899999997 8899999999965


No 340
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]
Probab=46.98  E-value=20  Score=28.71  Aligned_cols=50  Identities=20%  Similarity=0.166  Sum_probs=33.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc-----------ccC-CCCCCCCCceeecHHHHHhhC
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV-----------ATQ-LLPIPELMPFRLTPHILAVNE   64 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~-----------~~~-~~~~~E~vPFRLT~~~~~~~g   64 (82)
                      -|=|.+||+|+  .|+|.-|||..+=-.           +.+ .|.-.|..-|++=+.|..++-
T Consensus       346 rnlt~~niLId--~GnvtLIDfklsRl~~~q~~isy~rldhp~lF~G~dd~QFeIYrlMr~l~~  407 (488)
T COG5072         346 RNLTLDNILID--EGNVTLIDFKLSRLSYSQGIISYNRLDHPDLFNGVDDYQFEIYRLMRRLLK  407 (488)
T ss_pred             ccccccceeee--cCceEEEEeeeeecccCCceeeccccCchhhhcCccceeeeHHHHHHHHhc
Confidence            35588999997  999999999876111           111 223345667777777776654


No 341
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=46.71  E-value=11  Score=25.89  Aligned_cols=25  Identities=28%  Similarity=0.309  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+.
T Consensus       119 ~di~p~Nil~~-~~~~~~l~dfg~~~  143 (277)
T cd05577         119 RDLKPENVLLD-DHGNVRISDLGLAV  143 (277)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCcchh
Confidence            67789999997 88999999998654


No 342
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=46.62  E-value=13  Score=25.65  Aligned_cols=25  Identities=44%  Similarity=0.517  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|++.=+|||.+-
T Consensus       129 ~dl~p~nil~~-~~~~~kl~dfg~~~  153 (290)
T cd05613         129 RDIKLENILLD-SNGHVVLTDFGLSK  153 (290)
T ss_pred             cCCCHHHeEEC-CCCCEEEeeCccce
Confidence            67789999997 78999999998653


No 343
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only]
Probab=46.62  E-value=18  Score=27.23  Aligned_cols=25  Identities=36%  Similarity=0.361  Sum_probs=19.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      ||=||+|++++-.+.-+--|||+.+
T Consensus       202 ~D~~~~NVl~d~~~~~~g~iDFdDa  226 (331)
T COG2334         202 GDLHPDNVLFDDDTDVSGFIDFDDA  226 (331)
T ss_pred             cCCCccceeEcCCCCeeeEEEcccc
Confidence            7999999999744432556899876


No 344
>PHA03210 serine/threonine kinase US3; Provisional
Probab=46.55  E-value=13  Score=28.91  Aligned_cols=24  Identities=38%  Similarity=0.447  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ ..|.+.=+|||.+
T Consensus       291 rDLKP~NILl~-~~~~vkL~DFGla  314 (501)
T PHA03210        291 RDIKLENIFLN-CDGKIVLGDFGTA  314 (501)
T ss_pred             CCCCHHHEEEC-CCCCEEEEeCCCc
Confidence            57789999997 8899999999976


No 345
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=46.41  E-value=16  Score=25.02  Aligned_cols=24  Identities=29%  Similarity=0.289  Sum_probs=20.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+||+++ ..+.+.=+|||.+
T Consensus       133 ~di~p~nil~~-~~~~~kL~dfg~~  156 (279)
T cd05057         133 RDLAARNVLVK-TPQHVKITDFGLA  156 (279)
T ss_pred             cccCcceEEEc-CCCeEEECCCccc
Confidence            68899999996 8889998999865


No 346
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=46.33  E-value=13  Score=23.97  Aligned_cols=29  Identities=28%  Similarity=0.291  Sum_probs=23.8

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeeccc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~~   41 (82)
                      -||=.|+||+++ ..|.+.-+||+......
T Consensus       110 h~~i~~~ni~~~-~~~~~~l~d~~~~~~~~  138 (244)
T smart00220      110 HRDLKPENILLD-EDGHVKLADFGLARQLD  138 (244)
T ss_pred             cCCcCHHHeEEC-CCCcEEEccccceeeec
Confidence            378889999997 67999999999876544


No 347
>PHA03211 serine/threonine kinase US3; Provisional
Probab=46.32  E-value=11  Score=29.19  Aligned_cols=24  Identities=33%  Similarity=0.261  Sum_probs=21.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .+|.+.=+|||.+
T Consensus       284 rDLKP~NILl~-~~~~vkL~DFGla  307 (461)
T PHA03211        284 RDIKTENVLVN-GPEDICLGDFGAA  307 (461)
T ss_pred             CcCCHHHEEEC-CCCCEEEcccCCc
Confidence            67789999997 8899999999965


No 348
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=46.09  E-value=15  Score=25.01  Aligned_cols=24  Identities=38%  Similarity=0.392  Sum_probs=20.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=+|+||+++ .++.+.-+|||..
T Consensus       130 ~dl~p~nili~-~~~~~kl~dfg~~  153 (269)
T cd05065         130 RDLAARNILVN-SNLVCKVSDFGLS  153 (269)
T ss_pred             cccChheEEEc-CCCcEEECCCccc
Confidence            68899999997 7888888999865


No 349
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=46.04  E-value=16  Score=26.05  Aligned_cols=25  Identities=28%  Similarity=0.259  Sum_probs=21.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-.|+||+++ .+|.+--+|||.+.
T Consensus       131 ~dl~p~nill~-~~~~~kl~d~g~~~  155 (337)
T cd07852         131 RDLKPSNILLN-SDCRVKLADFGLAR  155 (337)
T ss_pred             CCCCHHHEEEc-CCCcEEEeeccchh
Confidence            68899999997 88999999998664


No 350
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=45.98  E-value=11  Score=25.88  Aligned_cols=26  Identities=27%  Similarity=0.354  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-.
T Consensus       127 ~dl~p~nil~~-~~~~~kl~dfg~~~~  152 (291)
T cd07844         127 RDLKPQNLLIS-ERGELKLADFGLARA  152 (291)
T ss_pred             ccCCHHHEEEc-CCCCEEECccccccc
Confidence            67789999997 889999999997643


No 351
>KOG0696|consensus
Probab=45.84  E-value=16  Score=29.73  Aligned_cols=26  Identities=27%  Similarity=0.350  Sum_probs=22.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      .|-.++|+|+| ..|+|--.|||++=+
T Consensus       474 RDLKLDNvmLd-~eGHiKi~DFGmcKE  499 (683)
T KOG0696|consen  474 RDLKLDNVMLD-SEGHIKIADFGMCKE  499 (683)
T ss_pred             eeccccceEec-cCCceEeeecccccc
Confidence            36678999998 999999999998743


No 352
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=45.79  E-value=19  Score=25.44  Aligned_cols=25  Identities=28%  Similarity=0.343  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ ..|.+.=+|||.+.
T Consensus       149 ~dL~p~Nil~~-~~~~~kl~dfg~~~  173 (317)
T cd06635         149 RDIKAGNILLT-EPGQVKLADFGSAS  173 (317)
T ss_pred             CCCCcccEEEC-CCCCEEEecCCCcc
Confidence            78899999996 78999999998654


No 353
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=45.76  E-value=17  Score=24.41  Aligned_cols=25  Identities=20%  Similarity=0.166  Sum_probs=20.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       122 ~dlk~~nili~-~~~~~kl~dfg~~~  146 (262)
T cd05058         122 RDLAARNCMLD-ESFTVKVADFGLAR  146 (262)
T ss_pred             cccCcceEEEc-CCCcEEECCccccc
Confidence            56789999997 78888889999653


No 354
>PRK05618 50S ribosomal protein L25/general stress protein Ctc; Reviewed
Probab=45.29  E-value=17  Score=25.36  Aligned_cols=31  Identities=10%  Similarity=0.107  Sum_probs=20.3

Q ss_pred             EEcCCCcEEEEeeceeeccccCCCCCCCCCceeec
Q psy16910         22 VCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLT   56 (82)
Q Consensus        22 i~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT   56 (82)
                      .|.-++++.|+||-. ...+.   .+.=.||.+++
T Consensus        81 ~~pv~~~i~HvDF~~-v~~~~---~v~v~VPv~~~  111 (197)
T PRK05618         81 RHPVKDFILHVDFLR-VDAGE---KVKVEVPVHFV  111 (197)
T ss_pred             eccCCCCEEeEEEEE-eCCCC---EEEEEeeEEEE
Confidence            378899999999973 22222   22335687776


No 355
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=45.29  E-value=17  Score=23.45  Aligned_cols=28  Identities=29%  Similarity=0.221  Sum_probs=22.7

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -+|=+|+||+++ .++++.-+||+.....
T Consensus       121 h~di~~~ni~v~-~~~~~~l~d~g~~~~~  148 (225)
T smart00221      121 HRDLKPENILLG-MDGLVKLADFGLARFI  148 (225)
T ss_pred             cCCCCHHHEEEc-CCCCEEEeeCceeeEe
Confidence            367889999997 6699999999966443


No 356
>PRK14751 tetracycline resistance determinant leader peptide; Provisional
Probab=45.10  E-value=15  Score=18.15  Aligned_cols=17  Identities=18%  Similarity=0.075  Sum_probs=13.1

Q ss_pred             EcCCCcEEEEeeceeec
Q psy16910         23 CTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        23 ~~~tG~v~hiDfg~~~~   39 (82)
                      .+++-.++|.||...|+
T Consensus        11 ~psdksi~hwdf~~l~g   27 (28)
T PRK14751         11 NPSDKSIYHWDFYALLG   27 (28)
T ss_pred             CCCcCceeeeeehhhhc
Confidence            46778899999976554


No 357
>TIGR02904 spore_ysxE spore coat protein YsxE. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YsxE, are found only in the family Bacillaceae, from among the endospore-forming members of the Firmicutes branch of the Bacteria. As a rule, the ysxE gene is found immediately downstream of spoVID, a gene necessary for spore coat assembly. The protein has been shown to be part of the spore coat.
Probab=45.04  E-value=16  Score=26.36  Aligned_cols=29  Identities=21%  Similarity=0.071  Sum_probs=23.4

Q ss_pred             eeeeeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910          8 LEYSIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus         8 yilgigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      ..+.=||=+++|+|++ .+|.+.-|||-.+
T Consensus       196 ~~lcHgD~~~~Nvl~~-~~~~~~iIDfd~~  224 (309)
T TIGR02904       196 TVLVHGKLSLSHFLYD-ETRGGYFINFEKA  224 (309)
T ss_pred             eeeeCCCCcHHhEEEc-CCCCEEEEEhhhc
Confidence            3455699999999997 7788888998754


No 358
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=44.88  E-value=14  Score=24.84  Aligned_cols=25  Identities=40%  Similarity=0.400  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      ||=+|+||+++ .++.+.=+|||..-
T Consensus       121 ~dl~p~nil~~-~~~~~~l~dfg~~~  145 (260)
T cd05611         121 RDIKPENLLID-QTGHLKLTDFGLSR  145 (260)
T ss_pred             CCCCHHHeEEC-CCCcEEEeecccce
Confidence            67789999997 78999999998653


No 359
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=44.86  E-value=15  Score=25.26  Aligned_cols=26  Identities=31%  Similarity=0.441  Sum_probs=22.1

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=+|+||+++ .+|.+.=+||+...
T Consensus       139 H~dl~p~ni~i~-~~~~~~l~d~~~~~  164 (286)
T cd06614         139 HRDIKSDNILLS-KDGSVKLADFGFAA  164 (286)
T ss_pred             eCCCChhhEEEc-CCCCEEECccchhh
Confidence            378899999997 89999999998654


No 360
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=44.78  E-value=13  Score=26.60  Aligned_cols=26  Identities=23%  Similarity=0.141  Sum_probs=22.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|-.|+||+++ .+|.+.=+|||.+..
T Consensus       132 ~dl~p~Nili~-~~~~~~l~dfg~~~~  157 (328)
T cd07856         132 RDLKPSNILIN-ENCDLKICDFGLARI  157 (328)
T ss_pred             CCCCHHHEeEC-CCCCEEeCccccccc
Confidence            67789999997 789999999997643


No 361
>KOG0670|consensus
Probab=44.73  E-value=17  Score=30.27  Aligned_cols=36  Identities=25%  Similarity=0.281  Sum_probs=25.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCce
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPF   53 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPF   53 (82)
                      .|=-|+|||++...--+--+|||.+...+.     .|..|+
T Consensus       560 aDIKPDNiLVNE~k~iLKLCDfGSA~~~~e-----neitPY  595 (752)
T KOG0670|consen  560 ADIKPDNILVNESKNILKLCDFGSASFASE-----NEITPY  595 (752)
T ss_pred             cccCccceEeccCcceeeeccCcccccccc-----ccccHH
Confidence            367899999987766777889996544442     455565


No 362
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=44.69  E-value=15  Score=25.04  Aligned_cols=24  Identities=33%  Similarity=0.353  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|++.-+|||..
T Consensus       127 ~dl~p~nili~-~~~~~~l~d~g~~  150 (280)
T cd06611         127 RDLKAGNILLT-LDGDVKLADFGVS  150 (280)
T ss_pred             CCCChhhEEEC-CCCCEEEccCccc
Confidence            78899999996 8899999999854


No 363
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=44.49  E-value=11  Score=26.21  Aligned_cols=26  Identities=27%  Similarity=0.144  Sum_probs=22.1

Q ss_pred             eCCCCCCcEEEEcC----CCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTK----TGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~----tG~v~hiDfg~~~   38 (82)
                      -+|-.|+||+++ .    +|.+.=+|||.+.
T Consensus       131 h~dlkp~Nil~~-~~~~~~~~~kl~Dfg~~~  160 (316)
T cd07842         131 HRDLKPANILVM-GEGPERGVVKIGDLGLAR  160 (316)
T ss_pred             eCCCCHHHEEEc-CCCCccceEEECCCcccc
Confidence            378899999997 6    8999999999654


No 364
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=44.25  E-value=12  Score=26.50  Aligned_cols=25  Identities=28%  Similarity=0.409  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-+|+||+++ ..|.+.-+|||.+-
T Consensus       143 ~dl~~~nill~-~~~~~kl~dfg~~~  167 (335)
T PTZ00024        143 RDLSPANIFIN-SKGICKIADFGLAR  167 (335)
T ss_pred             ccccHHHeEEC-CCCCEEECCcccee
Confidence            78899999997 88999999999763


No 365
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=44.17  E-value=22  Score=24.05  Aligned_cols=26  Identities=27%  Similarity=0.330  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      ||=+|+||+++ ..|.+.=+|||.+..
T Consensus       122 ~~l~~~ni~~~-~~~~~~l~d~g~~~~  147 (282)
T cd07829         122 RDLKPQNILIN-RDGVLKLADFGLARA  147 (282)
T ss_pred             CCCChheEEEc-CCCCEEEecCCcccc
Confidence            78899999997 689999999987643


No 366
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=44.01  E-value=19  Score=25.38  Aligned_cols=25  Identities=28%  Similarity=0.248  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|++.=+|||.+-
T Consensus       158 ~dlkp~Nill~-~~~~~kL~Dfg~~~  182 (314)
T cd05099         158 RDLAARNVLVT-EDNVMKIADFGLAR  182 (314)
T ss_pred             ccccceeEEEc-CCCcEEEccccccc
Confidence            67789999996 78999999999764


No 367
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=43.82  E-value=17  Score=26.23  Aligned_cols=25  Identities=24%  Similarity=0.173  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.-+|||.+-
T Consensus       142 ~dlkp~Nill~-~~~~~kl~dfg~~~  166 (343)
T cd07880         142 RDLKPGNLAVN-EDCELKILDFGLAR  166 (343)
T ss_pred             CCCCHHHEEEc-CCCCEEEeeccccc
Confidence            67789999997 78999999999654


No 368
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=43.81  E-value=17  Score=25.56  Aligned_cols=25  Identities=28%  Similarity=0.234  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ ..+.+.=+|||.+-
T Consensus       133 ~dlkp~Nill~-~~~~~kl~DfG~a~  157 (316)
T cd05108         133 RDLAARNVLVK-TPQHVKITDFGLAK  157 (316)
T ss_pred             cccchhheEec-CCCcEEEccccccc
Confidence            67789999996 78899999999763


No 369
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=43.66  E-value=18  Score=24.89  Aligned_cols=24  Identities=38%  Similarity=0.282  Sum_probs=20.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ ..+.+.=+|||.+
T Consensus       154 ~dlkp~Nili~-~~~~~~l~dfg~~  177 (296)
T cd05051         154 RDLATRNCLVG-KNYTIKIADFGMS  177 (296)
T ss_pred             cccchhceeec-CCCceEEccccce
Confidence            57789999997 7799999999965


No 370
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=43.59  E-value=19  Score=24.09  Aligned_cols=25  Identities=28%  Similarity=0.287  Sum_probs=21.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .++.+.=+||+..-
T Consensus       125 ~~l~~~nil~~-~~~~~~l~d~~~~~  149 (256)
T cd08218         125 RDIKSQNIFLT-KDGTIKLGDFGIAR  149 (256)
T ss_pred             CCCCHHHEEEc-CCCCEEEeecccee
Confidence            67889999997 78899999998664


No 371
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=43.36  E-value=18  Score=25.50  Aligned_cols=24  Identities=38%  Similarity=0.376  Sum_probs=21.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||..
T Consensus       124 ~dl~p~nil~~-~~~~~~l~dfg~~  147 (308)
T cd06615         124 RDVKPSNILVN-SRGEIKLCDFGVS  147 (308)
T ss_pred             CCCChHHEEEe-cCCcEEEccCCCc
Confidence            67889999997 7899999999864


No 372
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=43.22  E-value=16  Score=25.19  Aligned_cols=28  Identities=25%  Similarity=0.188  Sum_probs=22.9

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -+|=.|+||+++ ..|.+.=+|||.+...
T Consensus       129 H~dl~p~nili~-~~~~~~l~d~g~~~~~  156 (293)
T cd07843         129 HRDLKTSNLLLN-NRGILKICDFGLAREY  156 (293)
T ss_pred             eccCCHHHEEEC-CCCcEEEeecCceeec
Confidence            378889999997 7899999999866543


No 373
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=43.14  E-value=18  Score=24.65  Aligned_cols=25  Identities=36%  Similarity=0.452  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .+|.+.=+|||.+-
T Consensus       124 ~dl~~~ni~~~-~~~~~kl~d~g~~~  148 (288)
T cd07833         124 RDIKPENILVS-ESGVLKLCDFGFAR  148 (288)
T ss_pred             CCCCHHHeEEC-CCCCEEEEeeeccc
Confidence            77899999997 79999999998653


No 374
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=42.91  E-value=26  Score=24.53  Aligned_cols=26  Identities=31%  Similarity=0.396  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEE---cCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVC---TKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~---~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++   ..+|.+-=+|||.+-
T Consensus       132 rDlkp~Nil~~~~~~~~~~~kl~DfG~a~  160 (317)
T cd07868         132 RDLKPANILVMGEGPERGRVKIADMGFAR  160 (317)
T ss_pred             CCCCHHHEEEecCCCCcCcEEEeecCcee
Confidence            57789999994   467899999999763


No 375
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=42.78  E-value=21  Score=24.54  Aligned_cols=26  Identities=31%  Similarity=0.312  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++...+++.=+|||.+-
T Consensus       133 ~dl~p~nil~~~~~~~~~l~dfg~~~  158 (267)
T PHA03390        133 NDIKLENVLYDRAKDRIYLCDYGLCK  158 (267)
T ss_pred             CCCCHHHEEEeCCCCeEEEecCccce
Confidence            67789999998555599999999653


No 376
>KOG0694|consensus
Probab=42.77  E-value=15  Score=30.70  Aligned_cols=23  Identities=35%  Similarity=0.486  Sum_probs=21.0

Q ss_pred             CCCCCcEEEEcCCCcEEEEeecee
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      |=-++|||+| ..|.+--+|||.|
T Consensus       493 DlKLdNiLLD-~eGh~kiADFGlc  515 (694)
T KOG0694|consen  493 DLKLDNLLLD-TEGHVKIADFGLC  515 (694)
T ss_pred             ecchhheEEc-ccCcEEecccccc
Confidence            5678999999 9999999999987


No 377
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=42.52  E-value=19  Score=28.62  Aligned_cols=25  Identities=40%  Similarity=0.456  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|-+|+|||++ .++.+.-+|||.+.
T Consensus       333 rDLKp~NILl~-~~~~~kL~DFGla~  357 (507)
T PLN03224        333 RDIKPENLLVT-VDGQVKIIDFGAAV  357 (507)
T ss_pred             CCCchHhEEEC-CCCcEEEEeCcCcc
Confidence            67899999997 77899999999763


No 378
>PF15232 DUF4585:  Domain of unknown function (DUF4585)
Probab=42.27  E-value=29  Score=21.22  Aligned_cols=19  Identities=16%  Similarity=0.179  Sum_probs=16.7

Q ss_pred             CCCcEEEEcCCCcEEEEee
Q psy16910         16 HLENTLVCTKTGRCVGIDF   34 (82)
Q Consensus        16 h~~nili~~~tG~v~hiDf   34 (82)
                      +..++|+|..||+-+-+|.
T Consensus         6 tqrKvL~DP~SG~Yy~vd~   24 (75)
T PF15232_consen    6 TQRKVLQDPESGQYYVVDA   24 (75)
T ss_pred             cCccEeecCCCCCEEEEec
Confidence            4568999999999999996


No 379
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=42.23  E-value=14  Score=25.84  Aligned_cols=26  Identities=27%  Similarity=0.345  Sum_probs=22.1

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=.|+||+++ .+|.+.=+|||.+.
T Consensus       139 H~dLkp~Nill~-~~~~~kl~dfg~~~  164 (296)
T cd06654         139 HRDIKSDNILLG-MDGSVKLTDFGFCA  164 (296)
T ss_pred             cCCCCHHHEEEc-CCCCEEECccccch
Confidence            378889999997 78999999999654


No 380
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=42.10  E-value=19  Score=24.80  Aligned_cols=25  Identities=28%  Similarity=0.224  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       156 ~dlkp~Nil~~-~~~~~kL~Dfg~~~  180 (293)
T cd05053         156 RDLAARNVLVT-EDHVMKIADFGLAR  180 (293)
T ss_pred             cccceeeEEEc-CCCeEEeCcccccc
Confidence            57789999997 89999999998654


No 381
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=41.59  E-value=14  Score=26.57  Aligned_cols=25  Identities=24%  Similarity=0.154  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++..++.+.-+|||.+
T Consensus       138 ~dikp~Nili~~~~~~~kl~dfg~~  162 (342)
T cd07854         138 RDLKPANVFINTEDLVLKIGDFGLA  162 (342)
T ss_pred             CCCCHHHEEEcCCCceEEECCcccc
Confidence            5678999999877888888999865


No 382
>PRK10593 hypothetical protein; Provisional
Probab=41.28  E-value=25  Score=25.52  Aligned_cols=26  Identities=15%  Similarity=0.190  Sum_probs=19.6

Q ss_pred             eeeCCCCCCcEEEEcCCCc-EEEEeec
Q psy16910         10 YSIGDRHLENTLVCTKTGR-CVGIDFG   35 (82)
Q Consensus        10 lgigDRh~~nili~~~tG~-v~hiDfg   35 (82)
                      |-=||=|++|++++..+|+ ..-||..
T Consensus       195 LlHGDlw~gNvl~~~~~~~i~~liDPa  221 (297)
T PRK10593        195 LVHGNFTLRSMLKDPRSDQLLAMLNPG  221 (297)
T ss_pred             eEeCCCCcccEEECCCCCceEEEECch
Confidence            3448999999999866676 5667765


No 383
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=41.27  E-value=20  Score=25.85  Aligned_cols=27  Identities=22%  Similarity=0.155  Sum_probs=22.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|=.|+||+++ .+|.+.=+|||.+...
T Consensus       144 ~dlkp~NIll~-~~~~~kl~dfg~~~~~  170 (345)
T cd07877         144 RDLKPSNLAVN-EDCELKILDFGLARHT  170 (345)
T ss_pred             cCCChHHEEEc-CCCCEEEecccccccc
Confidence            57789999997 7899999999976543


No 384
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=41.08  E-value=22  Score=24.06  Aligned_cols=26  Identities=31%  Similarity=0.305  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ ..|.+.-+||+.+..
T Consensus       126 ~dl~p~ni~i~-~~~~~~l~d~~~~~~  151 (260)
T cd05073         126 RDLRAANILVS-ASLVCKIADFGLARV  151 (260)
T ss_pred             cccCcceEEEc-CCCcEEECCCcceee
Confidence            67789999996 789999999987643


No 385
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=41.04  E-value=20  Score=24.28  Aligned_cols=24  Identities=29%  Similarity=0.187  Sum_probs=20.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++.  |.+-=+|||.+-
T Consensus       124 ~dl~p~ni~l~~--~~~kl~dfg~~~  147 (282)
T cd07831         124 RDIKPENILIKD--DILKLADFGSCR  147 (282)
T ss_pred             cccCHHHEEEcC--CCeEEEeccccc
Confidence            678999999985  999999998764


No 386
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=40.95  E-value=22  Score=24.18  Aligned_cols=24  Identities=33%  Similarity=0.135  Sum_probs=20.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ ..|.+-=+|||.+
T Consensus       146 ~dlkp~nili~-~~~~~kl~d~g~~  169 (280)
T cd05049         146 RDLATRNCLVG-YDLVVKIGDFGMS  169 (280)
T ss_pred             cccccceEEEc-CCCeEEECCcccc
Confidence            67789999997 7799999999865


No 387
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=40.94  E-value=15  Score=26.23  Aligned_cols=27  Identities=22%  Similarity=0.133  Sum_probs=22.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|-.|+||+++ .+|.+.=+|||.+...
T Consensus       132 ~dlkp~Nil~~-~~~~~kL~Dfg~~~~~  158 (337)
T cd07858         132 RDLKPSNLLLN-ANCDLKICDFGLARTT  158 (337)
T ss_pred             CCCCHHHEEEc-CCCCEEECcCcccccc
Confidence            78899999996 7899999999976543


No 388
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=40.83  E-value=18  Score=24.22  Aligned_cols=25  Identities=32%  Similarity=0.331  Sum_probs=21.4

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      -+|=.|+||+++ .+|.+.=+||+.+
T Consensus       125 h~~l~p~ni~~~-~~~~~~l~df~~~  149 (267)
T cd06610         125 HRDIKAGNILLG-EDGSVKIADFGVS  149 (267)
T ss_pred             cCCCCHHhEEEc-CCCCEEEcccchH
Confidence            378899999997 6899999999865


No 389
>PF15535 Toxin_57:  Putative toxin 57
Probab=40.60  E-value=16  Score=22.43  Aligned_cols=15  Identities=27%  Similarity=0.020  Sum_probs=12.5

Q ss_pred             EEEcCCCcEEEEeec
Q psy16910         21 LVCTKTGRCVGIDFG   35 (82)
Q Consensus        21 li~~~tG~v~hiDfg   35 (82)
                      -++.+||+++|+|--
T Consensus        35 w~d~~tG~~~~pd~~   49 (77)
T PF15535_consen   35 WIDPKTGNQWHPDGP   49 (77)
T ss_pred             cccCCCCceeeeCCC
Confidence            367899999999965


No 390
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=40.57  E-value=14  Score=25.06  Aligned_cols=24  Identities=33%  Similarity=0.207  Sum_probs=20.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|.+.=+|||.+
T Consensus       130 ~dl~p~ni~i~-~~~~~~l~dfg~~  153 (264)
T cd06653         130 RDIKGANILRD-SAGNVKLGDFGAS  153 (264)
T ss_pred             CCCCHHHEEEc-CCCCEEECccccc
Confidence            67889999997 7899988999865


No 391
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=39.78  E-value=21  Score=24.42  Aligned_cols=24  Identities=25%  Similarity=0.128  Sum_probs=20.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .++.+-=+|||.+
T Consensus       148 ~dlkp~Nil~~-~~~~~kl~Dfg~~  171 (283)
T cd05091         148 KDLATRNVLVF-DKLNVKISDLGLF  171 (283)
T ss_pred             cccchhheEec-CCCceEecccccc
Confidence            67789999996 7889999999964


No 392
>PRK06148 hypothetical protein; Provisional
Probab=39.74  E-value=27  Score=30.02  Aligned_cols=26  Identities=35%  Similarity=0.330  Sum_probs=20.1

Q ss_pred             CCCCCCcEEEEcCC-CcEE-EEeeceee
Q psy16910         13 GDRHLENTLVCTKT-GRCV-GIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~t-G~v~-hiDfg~~~   38 (82)
                      ||=|++||+++... +++. -|||+.+.
T Consensus       208 gDln~~NiLv~~~~~~~isGiIDFgDa~  235 (1013)
T PRK06148        208 NDANDYNILVDADDGERISGLIDFGDAV  235 (1013)
T ss_pred             CCCCcccEEEcCCCCcceEEEEECcccc
Confidence            78899999998443 2676 89999763


No 393
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=39.57  E-value=28  Score=25.58  Aligned_cols=25  Identities=24%  Similarity=0.174  Sum_probs=20.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ ..+.+--+|||.+-
T Consensus       238 ~Dlkp~Nill~-~~~~~kl~DfG~a~  262 (375)
T cd05104         238 RDLAARNILLT-HGRITKICDFGLAR  262 (375)
T ss_pred             cCCchhhEEEE-CCCcEEEecCccce
Confidence            67789999997 67888888999753


No 394
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=39.42  E-value=19  Score=24.95  Aligned_cols=26  Identities=27%  Similarity=0.249  Sum_probs=21.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.=+|||.+..
T Consensus       126 ~dlkp~Nil~~-~~~~~~l~Dfg~~~~  151 (285)
T cd05605         126 RDLKPENILLD-DYGHIRISDLGLAVE  151 (285)
T ss_pred             cCCCHHHEEEC-CCCCEEEeeCCCcee
Confidence            57789999997 789999999997644


No 395
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=39.23  E-value=16  Score=25.22  Aligned_cols=25  Identities=24%  Similarity=0.255  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+.-+|||.+.
T Consensus       121 ~di~p~nili~-~~~~~kl~dfg~~~  145 (278)
T cd05606         121 RDLKPANILLD-EHGHVRISDLGLAC  145 (278)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCcCcc
Confidence            67789999997 78999999999753


No 396
>KOG1165|consensus
Probab=39.19  E-value=34  Score=27.09  Aligned_cols=25  Identities=28%  Similarity=0.306  Sum_probs=18.1

Q ss_pred             CCCCCCcEEEEcC----CCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTK----TGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~----tG~v~hiDfg~~   37 (82)
                      -|--|+|+||.+.    -..|.-||||.+
T Consensus       148 RDIKPdNFLIGrp~~k~~n~IhiiDFGmA  176 (449)
T KOG1165|consen  148 RDIKPDNFLIGRPGTKDANVIHIIDFGMA  176 (449)
T ss_pred             cccCccceeecCCCCCCCceEEEEeccch
Confidence            4678999999532    334666899976


No 397
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=38.83  E-value=20  Score=25.27  Aligned_cols=26  Identities=27%  Similarity=0.190  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.=+|||.+..
T Consensus       139 ~dl~p~nil~~-~~~~~kl~dfg~~~~  164 (308)
T cd06634         139 RDVKAGNILLS-EPGLVKLGDFGSASI  164 (308)
T ss_pred             CCCCHHhEEEC-CCCcEEECCccccee
Confidence            78889999996 789999999997644


No 398
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=38.78  E-value=18  Score=24.07  Aligned_cols=27  Identities=26%  Similarity=0.091  Sum_probs=20.6

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=.|+||+++...+.+-=+||+..-
T Consensus       124 h~dl~~~nil~~~~~~~~~l~d~~~~~  150 (256)
T cd08220         124 HRDLKTQNILLDKHKMVVKIGDFGISK  150 (256)
T ss_pred             cCCCCHHHEEEcCCCCEEEEccCCCce
Confidence            367889999998666666678998654


No 399
>TIGR01767 MTRK 5-methylthioribose kinase. This enzyme is involved in the methionine salvage pathway in certain bacteria.
Probab=38.69  E-value=24  Score=27.33  Aligned_cols=29  Identities=24%  Similarity=0.250  Sum_probs=21.2

Q ss_pred             eeeeCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910          9 EYSIGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus         9 ilgigDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      .|--||=|++|||++ . ....-||+-+++-
T Consensus       193 ~llHGDl~~gNi~~~-~-~~~~~iD~e~~~~  221 (370)
T TIGR01767       193 TLLHGDLHSGSIFVS-E-HETKVIDPEFAFY  221 (370)
T ss_pred             eeeeccCCcccEEEc-C-CCCEEEcCccccc
Confidence            345699999999995 3 3467899875543


No 400
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=38.60  E-value=18  Score=24.16  Aligned_cols=27  Identities=22%  Similarity=0.213  Sum_probs=22.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|-.|+||+++ .+|.+.=+|||.....
T Consensus       123 ~dl~~~nil~~-~~~~~kl~d~g~~~~~  149 (264)
T cd06626         123 RDIKPANIFLD-HNGVIKLGDFGCAVKL  149 (264)
T ss_pred             CCCCHHHEEEC-CCCCEEEccccccccc
Confidence            67789999997 6999999999876443


No 401
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=38.59  E-value=27  Score=30.21  Aligned_cols=25  Identities=28%  Similarity=0.384  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ ..|++.=+|||.+-
T Consensus       137 RDLKPeNILLd-~dg~vKLiDFGLAk  161 (932)
T PRK13184        137 RDLKPDNILLG-LFGEVVILDWGAAI  161 (932)
T ss_pred             cCCchheEEEc-CCCCEEEEecCcce
Confidence            57789999997 88999999999764


No 402
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=37.69  E-value=28  Score=24.62  Aligned_cols=26  Identities=27%  Similarity=0.316  Sum_probs=22.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+.=+||+.+..
T Consensus       145 ~dl~p~nili~-~~~~~kL~dfg~~~~  170 (313)
T cd06633         145 RDIKAGNILLT-EPGQVKLADFGSASK  170 (313)
T ss_pred             CCCChhhEEEC-CCCCEEEeecCCCcc
Confidence            78889999996 889999999987643


No 403
>KOG0585|consensus
Probab=37.68  E-value=29  Score=28.44  Aligned_cols=27  Identities=30%  Similarity=0.277  Sum_probs=23.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      +|=-|+|+|++ .+|.|=-.|||.+...
T Consensus       234 RDIKPsNLLl~-~~g~VKIsDFGVs~~~  260 (576)
T KOG0585|consen  234 RDIKPSNLLLS-SDGTVKISDFGVSNEF  260 (576)
T ss_pred             cccchhheEEc-CCCcEEeeccceeeec
Confidence            46689999997 8899999999998754


No 404
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=37.59  E-value=35  Score=23.75  Aligned_cols=25  Identities=20%  Similarity=0.271  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+--.||+.+.
T Consensus       125 ~dlk~~Nili~-~~~~~kl~d~~~~~  149 (314)
T cd08216         125 RSVKASHILLS-GDGKVVLSGLRYSV  149 (314)
T ss_pred             CCCCcceEEEe-cCCceEEecCccce
Confidence            78899999997 78999888998653


No 405
>KOG4750|consensus
Probab=37.54  E-value=13  Score=27.49  Aligned_cols=12  Identities=50%  Similarity=0.886  Sum_probs=8.9

Q ss_pred             eeCCCCC---CcEEE
Q psy16910         11 SIGDRHL---ENTLV   22 (82)
Q Consensus        11 gigDRh~---~nili   22 (82)
                      ++|||||   +|.+|
T Consensus       195 ~~gdrhP~Igd~vli  209 (269)
T KOG4750|consen  195 GSGDRHPKIGDNVLI  209 (269)
T ss_pred             cccccCCcccCCeEE
Confidence            6899999   34555


No 406
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=37.52  E-value=27  Score=24.82  Aligned_cols=25  Identities=28%  Similarity=0.248  Sum_probs=20.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .++.+.=+|||.+-
T Consensus       158 ~dlkp~Nill~-~~~~~kL~Dfg~~~  182 (334)
T cd05100         158 RDLAARNVLVT-EDNVMKIADFGLAR  182 (334)
T ss_pred             cccccceEEEc-CCCcEEECCcccce
Confidence            57779999997 78899989998653


No 407
>KOG4714|consensus
Probab=37.46  E-value=29  Score=26.36  Aligned_cols=22  Identities=18%  Similarity=0.342  Sum_probs=19.3

Q ss_pred             CCCCCcEEEEcCCCcEEEEeec
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFG   35 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg   35 (82)
                      -..|+|++.....|.+||+|=.
T Consensus       233 pk~p~~Lft~sedGslw~wdas  254 (319)
T KOG4714|consen  233 PKNPEHLFTCSEDGSLWHWDAS  254 (319)
T ss_pred             CCCchheeEecCCCcEEEEcCC
Confidence            3468999999999999999976


No 408
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=37.37  E-value=29  Score=23.13  Aligned_cols=26  Identities=27%  Similarity=0.203  Sum_probs=20.1

Q ss_pred             CCCCCCcEEEEcCCC-------cEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTG-------RCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG-------~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ ..+       .+-=+|||....
T Consensus       125 ~dlkp~Nill~-~~~~~~~~~~~~kl~Dfg~a~~  157 (259)
T cd05037         125 GNVCGKNILVA-RYGLNEGYVPFIKLSDPGIPIT  157 (259)
T ss_pred             ccCccceEEEe-cCccccCCceeEEeCCCCcccc
Confidence            67889999998 444       577889986544


No 409
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=36.91  E-value=29  Score=23.18  Aligned_cols=27  Identities=30%  Similarity=0.133  Sum_probs=22.0

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|=.|+||+++ ..+.+-=+||+.+..
T Consensus       124 h~dl~p~ni~~~-~~~~~kl~d~~~~~~  150 (256)
T cd08221         124 HRDIKTLNIFLT-KAGLIKLGDFGISKI  150 (256)
T ss_pred             ccCCChHhEEEe-CCCCEEECcCcceEE
Confidence            367789999997 788898899987643


No 410
>KOG0690|consensus
Probab=35.96  E-value=19  Score=28.47  Aligned_cols=24  Identities=42%  Similarity=0.497  Sum_probs=21.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|-.++|+|+| ++|++--.|||.|
T Consensus       292 RDlKLENLlLD-kDGHIKitDFGLC  315 (516)
T KOG0690|consen  292 RDLKLENLLLD-KDGHIKITDFGLC  315 (516)
T ss_pred             eechhhhheec-cCCceEeeecccc
Confidence            36678999998 9999999999987


No 411
>KOG0667|consensus
Probab=35.93  E-value=26  Score=28.81  Aligned_cols=25  Identities=44%  Similarity=0.440  Sum_probs=20.6

Q ss_pred             CCCCCCcEEE-EcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLV-CTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili-~~~tG~v~hiDfg~~   37 (82)
                      .|=-|+|||+ +...-+|==||||.+
T Consensus       313 cDLKPENILL~~~~r~~vKVIDFGSS  338 (586)
T KOG0667|consen  313 CDLKPENILLKDPKRSRIKVIDFGSS  338 (586)
T ss_pred             ccCChhheeeccCCcCceeEEecccc
Confidence            5788999999 556668999999975


No 412
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=35.52  E-value=21  Score=24.25  Aligned_cols=24  Identities=33%  Similarity=0.207  Sum_probs=20.9

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .++++.=+|||..
T Consensus       130 ~~l~p~nil~~-~~~~~~l~dfg~~  153 (266)
T cd06651         130 RDIKGANILRD-SAGNVKLGDFGAS  153 (266)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCCCc
Confidence            67889999997 8899999999864


No 413
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=35.48  E-value=25  Score=23.33  Aligned_cols=26  Identities=31%  Similarity=0.234  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      +|=.|+||+++ .+|.+-=+||+.+..
T Consensus       126 ~dl~~~ni~~~-~~~~~kl~d~~~~~~  151 (258)
T cd06632         126 RDIKGANILVD-TNGVVKLADFGMAKQ  151 (258)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCcccee
Confidence            67889999997 789999999986643


No 414
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=35.15  E-value=24  Score=23.76  Aligned_cols=28  Identities=25%  Similarity=0.138  Sum_probs=21.3

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      -+|=.|+||+++.....+.=+||+.+..
T Consensus       126 H~~i~~~nil~~~~~~~~~l~dfg~~~~  153 (268)
T cd06630         126 HRDVKGANLLIDSTGQRLRIADFGAAAR  153 (268)
T ss_pred             cCCCCHHHEEEcCCCCEEEEcccccccc
Confidence            3788899999974445688889987643


No 415
>KOG0611|consensus
Probab=35.02  E-value=29  Score=28.27  Aligned_cols=23  Identities=39%  Similarity=0.459  Sum_probs=20.1

Q ss_pred             CCCCCcEEEEcCCCcEEEEeecee
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      |-.++|||+| .++++--.|||.+
T Consensus       178 DLKLENILLD-~N~NiKIADFGLS  200 (668)
T KOG0611|consen  178 DLKLENILLD-QNNNIKIADFGLS  200 (668)
T ss_pred             ccchhheeec-CCCCeeeeccchh
Confidence            4467999998 9999999999976


No 416
>PF02958 EcKinase:  Ecdysteroid kinase;  InterPro: IPR004119 This family includes proteins of unknown function. All known members of this group are proteins from drosophila and Caenorhabditis elegans.
Probab=34.96  E-value=23  Score=25.05  Aligned_cols=29  Identities=31%  Similarity=0.313  Sum_probs=22.4

Q ss_pred             eeeeCCCCCCcEEEEcC-CC---cEEEEeecee
Q psy16910          9 EYSIGDRHLENTLVCTK-TG---RCVGIDFGYS   37 (82)
Q Consensus         9 ilgigDRh~~nili~~~-tG---~v~hiDfg~~   37 (82)
                      +|.=||=|.+|||+... .|   ++.-|||-.+
T Consensus       216 vl~HGD~w~nNilf~~~~~g~~~~~~liDfQ~~  248 (294)
T PF02958_consen  216 VLCHGDFWTNNILFKYDDDGKPIDVVLIDFQLA  248 (294)
T ss_pred             EEEcCccCHHhEeEccccccccccceeeccccc
Confidence            56669999999999654 34   6999999643


No 417
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only]
Probab=34.94  E-value=33  Score=28.09  Aligned_cols=24  Identities=25%  Similarity=0.360  Sum_probs=21.2

Q ss_pred             eeCCCCCCcEEEEcCCCcEEEEeec
Q psy16910         11 SIGDRHLENTLVCTKTGRCVGIDFG   35 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~hiDfg   35 (82)
                      .+||-.++|+|++ ++++|.-+|--
T Consensus       139 ~vGDVn~~~~lVs-d~~~V~LVdsD  162 (637)
T COG4248         139 VVGDVNQNSFLVS-DDSKVVLVDSD  162 (637)
T ss_pred             cccccCccceeee-cCceEEEEccc
Confidence            4799999999997 99999999854


No 418
>KOG1167|consensus
Probab=34.91  E-value=24  Score=27.88  Aligned_cols=25  Identities=36%  Similarity=0.389  Sum_probs=22.9

Q ss_pred             CCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      |=-|+|+|.++.|++-.-+|||...
T Consensus       157 DiKpsNFL~n~~t~rg~LvDFgLA~  181 (418)
T KOG1167|consen  157 DIKPSNFLYNRRTQRGVLVDFGLAQ  181 (418)
T ss_pred             CCCccccccccccCCceEEechhHH
Confidence            4579999999999999999999887


No 419
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=34.81  E-value=28  Score=23.51  Aligned_cols=24  Identities=25%  Similarity=0.285  Sum_probs=20.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .++.+.=+|||..
T Consensus       137 ~dikp~nili~-~~~~~kl~dfg~~  160 (273)
T cd05074         137 RDLAARNCMLN-ENMTVCVADFGLS  160 (273)
T ss_pred             cccchhhEEEc-CCCCEEECccccc
Confidence            56779999996 7899998899854


No 420
>PRK09550 mtnK methylthioribose kinase; Reviewed
Probab=34.42  E-value=35  Score=26.48  Aligned_cols=28  Identities=25%  Similarity=0.317  Sum_probs=22.0

Q ss_pred             eeeeCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910          9 EYSIGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus         9 ilgigDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      .|-=||=|++|||+. . +.+.-||+-+++
T Consensus       224 ~l~HgDl~~gni~~~-~-~~~~viD~E~a~  251 (401)
T PRK09550        224 ALLHGDLHTGSIFVT-E-EETKVIDPEFAF  251 (401)
T ss_pred             ceeeccCCcccEEee-C-CCcEEEeccccc
Confidence            466799999999995 3 368889997554


No 421
>KOG2464|consensus
Probab=34.39  E-value=38  Score=24.10  Aligned_cols=16  Identities=50%  Similarity=0.594  Sum_probs=13.0

Q ss_pred             eeCCCCCCcEEEEcCCC
Q psy16910         11 SIGDRHLENTLVCTKTG   27 (82)
Q Consensus        11 gigDRh~~nili~~~tG   27 (82)
                      .--|.|++||||+ +||
T Consensus       160 ~hrdl~~gnili~-k~~  175 (246)
T KOG2464|consen  160 EHRDLHLGNILIK-KTG  175 (246)
T ss_pred             cccccCcCcEEEe-ccc
Confidence            4468999999996 766


No 422
>PRK10345 hypothetical protein; Provisional
Probab=34.21  E-value=34  Score=23.83  Aligned_cols=24  Identities=17%  Similarity=-0.168  Sum_probs=18.1

Q ss_pred             eCCCCCCcEEEEcCC---CcEEEEeec
Q psy16910         12 IGDRHLENTLVCTKT---GRCVGIDFG   35 (82)
Q Consensus        12 igDRh~~nili~~~t---G~v~hiDfg   35 (82)
                      -.|=.|+|||+++.+   +++.=||++
T Consensus       128 hrDlKp~NILl~~~~~~~~~~~LiDg~  154 (210)
T PRK10345        128 TMELKPQNILCQRISESEVIPVVCDNI  154 (210)
T ss_pred             ecCCCHHHEEEeccCCCCCcEEEEECC
Confidence            357789999998533   479999943


No 423
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=34.16  E-value=22  Score=24.54  Aligned_cols=25  Identities=28%  Similarity=0.335  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=+|+||+++ .+|.+.=+|||.+-
T Consensus       140 ~dl~p~nili~-~~~~~kl~dfg~~~  164 (302)
T cd07864         140 RDIKCSNILLN-NKGQIKLADFGLAR  164 (302)
T ss_pred             CCCCHHHEEEC-CCCcEEeCcccccc
Confidence            67889999996 88999999998653


No 424
>TIGR00731 ctc_TL5 ribosomal protein L25, Ctc-form. The C-terminal domain of sll1824, an apparent L25 of Synechocystis PCC6803, matches the N-terminal domain of this family. Examples of L25 and Ctc are not separated by a UPGMA tree built on the region of shared homology.
Probab=33.77  E-value=27  Score=23.96  Aligned_cols=37  Identities=19%  Similarity=0.175  Sum_probs=25.0

Q ss_pred             CcEEE-----EcCCCcEEEEeeceeeccccCCCCCCCCCceeecHH
Q psy16910         18 ENTLV-----CTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPH   58 (82)
Q Consensus        18 ~nili-----~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~   58 (82)
                      .+.++     |.-++++.|+||--. ..+.   .+.=.||.+++-.
T Consensus        66 ~~vlikevQ~~pv~~~i~HvDF~~v-~~~~---~v~v~VPv~~~G~  107 (176)
T TIGR00731        66 FKVLVKDYQYNPVTNEVIHVDFLEV-VEGV---KLKVEVPIKLIGT  107 (176)
T ss_pred             EEEEEehhhhccCCCCeEEEEeEEe-CCCC---EEEEEeeEEEecc
Confidence            35666     778999999999743 3332   2334679998854


No 425
>PTZ00284 protein kinase; Provisional
Probab=33.59  E-value=41  Score=25.48  Aligned_cols=25  Identities=32%  Similarity=0.254  Sum_probs=18.4

Q ss_pred             CCCCCCcEEEEcCCC----------------cEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTG----------------RCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG----------------~v~hiDfg~~~   38 (82)
                      +|=.|+|||++. .|                ++-=+|||.+.
T Consensus       256 rDlKP~NILl~~-~~~~~~~~~~~~~~~~~~~vkl~DfG~~~  296 (467)
T PTZ00284        256 TDLKPENILMET-SDTVVDPVTNRALPPDPCRVRICDLGGCC  296 (467)
T ss_pred             CCCCHHHEEEec-CCcccccccccccCCCCceEEECCCCccc
Confidence            566799999974 33                47778999654


No 426
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=33.33  E-value=38  Score=23.14  Aligned_cols=25  Identities=24%  Similarity=0.280  Sum_probs=18.4

Q ss_pred             CCCCCCcEEEEcCCCc-------EEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGR-------CVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~-------v~hiDfg~~~   38 (82)
                      +|-.|+|||++ .+|.       +.-+|||...
T Consensus       129 ~dlkp~Nill~-~~~~~~~~~~~~~l~d~g~~~  160 (262)
T cd05077         129 GNVCTKNILLA-REGIDGECGPFIKLSDPGIPI  160 (262)
T ss_pred             CCCCcccEEEe-cCCccCCCCceeEeCCCCCCc
Confidence            67789999997 4443       6778888653


No 427
>KOG1163|consensus
Probab=33.02  E-value=41  Score=25.64  Aligned_cols=44  Identities=23%  Similarity=0.360  Sum_probs=29.3

Q ss_pred             CCCCCCcEEE--EcCCCcEEEEeeceeeccccCCCCC--CCCCceeecHHHH
Q psy16910         13 GDRHLENTLV--CTKTGRCVGIDFGYSFGVATQLLPI--PELMPFRLTPHIL   60 (82)
Q Consensus        13 gDRh~~nili--~~~tG~v~hiDfg~~~~~~~~~~~~--~E~vPFRLT~~~~   60 (82)
                      -|=-|+|.|.  .+-..+++-||||.+    ++....  .--+|+|=.+++.
T Consensus       135 RDIKPdNFLMGlgrh~~kl~LIDFGLa----Kky~d~~t~~HIpyre~r~lt  182 (341)
T KOG1163|consen  135 RDIKPDNFLMGLGRHCNKLYLIDFGLA----KKYRDIRTRQHIPYREDRNLT  182 (341)
T ss_pred             ccCCccceeeccccccceEEEEeccch----hhhccccccccCccccCCccc
Confidence            3667999997  666789999999853    332222  3346888766653


No 428
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=32.94  E-value=25  Score=24.20  Aligned_cols=25  Identities=36%  Similarity=0.302  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|++.=+|||.+.
T Consensus       128 ~dl~p~nil~~-~~~~~~l~d~gl~~  152 (284)
T cd06620         128 RDIKPSNILVN-SRGQIKLCDFGVSG  152 (284)
T ss_pred             cCCCHHHEEEC-CCCcEEEccCCccc
Confidence            67789999997 88999999999653


No 429
>KOG4250|consensus
Probab=32.86  E-value=40  Score=28.51  Aligned_cols=24  Identities=25%  Similarity=0.369  Sum_probs=20.2

Q ss_pred             CCCCCcEEEEcCC-CcEEE--Eeecee
Q psy16910         14 DRHLENTLVCTKT-GRCVG--IDFGYS   37 (82)
Q Consensus        14 DRh~~nili~~~t-G~v~h--iDfg~~   37 (82)
                      |=-|+|||+-..+ |+.+|  +|||.+
T Consensus       145 DlKP~NIvl~~Gedgq~IyKLtDfG~A  171 (732)
T KOG4250|consen  145 DLKPGNIVLQIGEDGQSIYKLTDFGAA  171 (732)
T ss_pred             cCCCCcEEEeecCCCceEEeeeccccc
Confidence            5579999997777 99887  899975


No 430
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=32.75  E-value=35  Score=23.34  Aligned_cols=25  Identities=28%  Similarity=0.264  Sum_probs=19.0

Q ss_pred             CCCCCCcEEEEcCCC---cEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTG---RCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG---~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|   .+.=+|||.+.
T Consensus       140 ~dlkp~nil~~-~~~~~~~~kl~dfg~~~  167 (277)
T cd05036         140 RDIAARNCLLT-CKGPGRVAKIADFGMAR  167 (277)
T ss_pred             cccchheEEEe-ccCCCcceEeccCcccc
Confidence            68899999997 443   46778998654


No 431
>PHA02988 hypothetical protein; Provisional
Probab=31.06  E-value=33  Score=23.96  Aligned_cols=24  Identities=17%  Similarity=0.008  Sum_probs=20.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|--|+||+++ .+|.+-=+|||.+
T Consensus       147 rdlkp~nill~-~~~~~kl~dfg~~  170 (283)
T PHA02988        147 KNLTSVSFLVT-ENYKLKIICHGLE  170 (283)
T ss_pred             CcCChhhEEEC-CCCcEEEcccchH
Confidence            56668999997 7899999999865


No 432
>PF14531 Kinase-like:  Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=30.83  E-value=39  Score=25.15  Aligned_cols=30  Identities=30%  Similarity=0.280  Sum_probs=21.6

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeeccccC
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGVATQ   43 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~~~~   43 (82)
                      ||=.|+|++++ .+|.++=-||+.....+..
T Consensus       169 gdi~~~nfll~-~~G~v~Lg~F~~~~r~g~~  198 (288)
T PF14531_consen  169 GDIKPENFLLD-QDGGVFLGDFSSLVRAGTR  198 (288)
T ss_dssp             ST-SGGGEEE--TTS-EEE--GGGEEETTEE
T ss_pred             cccceeeEEEc-CCCCEEEcChHHHeecCce
Confidence            78889999998 7899999999998877753


No 433
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=30.65  E-value=32  Score=23.42  Aligned_cols=24  Identities=17%  Similarity=0.016  Sum_probs=20.2

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+||+++ .++.+-=.|||..
T Consensus       131 ~dikp~nili~-~~~~~~l~dfg~~  154 (266)
T cd05064         131 KGLAAHKVLVN-SDLVCKISGFRRL  154 (266)
T ss_pred             ccccHhhEEEc-CCCcEEECCCccc
Confidence            67789999997 7888888899854


No 434
>PRK12396 5-methylribose kinase; Reviewed
Probab=29.45  E-value=38  Score=26.60  Aligned_cols=24  Identities=25%  Similarity=0.302  Sum_probs=16.5

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      =||=|++|||++...  +.=||.-++
T Consensus       231 HGDlHtGSI~v~~~~--~kvIDpEFA  254 (409)
T PRK12396        231 HGDLHTGSVFVKNDS--TKVIDPEFA  254 (409)
T ss_pred             cCcCCCCCEEecCCc--eEEEccccc
Confidence            489999999997543  444564433


No 435
>KOG0597|consensus
Probab=28.93  E-value=37  Score=28.67  Aligned_cols=49  Identities=29%  Similarity=0.359  Sum_probs=33.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec-----------cccCCCCCCC---CCceeecHHHHHh
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG-----------VATQLLPIPE---LMPFRLTPHILAV   62 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~-----------~~~~~~~~~E---~vPFRLT~~~~~~   62 (82)
                      -|=.|+|||++ ..|.+--+|||.+=.           ++++.+.-||   .-||-.|.++..+
T Consensus       124 rd~kPqniLl~-~~~~~KlcdFg~Ar~m~~~t~vltsikGtPlYmAPElv~e~pyd~~sDlWsl  186 (808)
T KOG0597|consen  124 RDMKPQNILLE-KGGTLKLCDFGLARAMSTNTSVLTSIKGTPLYMAPELVEEQPYDHTSDLWSL  186 (808)
T ss_pred             ccCCcceeeec-CCCceeechhhhhhhcccCceeeeeccCcccccCHHHHcCCCccchhhHHHH
Confidence            36679999997 889999999987622           2334455454   3467777666653


No 436
>KOG0662|consensus
Probab=28.68  E-value=46  Score=24.40  Aligned_cols=24  Identities=29%  Similarity=0.425  Sum_probs=20.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|-.|+|++|+ .+|++--.|||.+
T Consensus       125 rdlkpqnllin-~ngelkladfgla  148 (292)
T KOG0662|consen  125 RDLKPQNLLIN-RNGELKLADFGLA  148 (292)
T ss_pred             ccCCcceEEec-cCCcEEecccchh
Confidence            36679999997 9999999999864


No 437
>KOG0659|consensus
Probab=28.45  E-value=47  Score=25.33  Aligned_cols=24  Identities=29%  Similarity=0.411  Sum_probs=21.0

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      -|=-|.|+||+ ++|.+=-.|||.+
T Consensus       125 RDlKPnNLLis-~~g~lKiADFGLA  148 (318)
T KOG0659|consen  125 RDLKPNNLLIS-SDGQLKIADFGLA  148 (318)
T ss_pred             ccCCccceEEc-CCCcEEeecccch
Confidence            36679999997 9999999999965


No 438
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=27.98  E-value=54  Score=24.69  Aligned_cols=24  Identities=25%  Similarity=0.266  Sum_probs=20.5

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+|||++ .++.+.-+|||.+
T Consensus       261 ~dikp~Nill~-~~~~~kL~DfGla  284 (400)
T cd05105         261 RDLAARNVLLA-QGKIVKICDFGLA  284 (400)
T ss_pred             CCCChHhEEEe-CCCEEEEEeCCcc
Confidence            67789999997 7888888999865


No 439
>PF14435 SUKH-4:  SUKH-4 immunity protein
Probab=27.84  E-value=73  Score=21.07  Aligned_cols=26  Identities=15%  Similarity=0.106  Sum_probs=20.2

Q ss_pred             eeCCCC-CCcEEEEcCCCcEEEEeece
Q psy16910         11 SIGDRH-LENTLVCTKTGRCVGIDFGY   36 (82)
Q Consensus        11 gigDRh-~~nili~~~tG~v~hiDfg~   36 (82)
                      -+|.-- .+-|.|+..||+|+.+|..-
T Consensus        79 vlG~~~~~~~i~ld~~tG~V~~~~~~~  105 (179)
T PF14435_consen   79 VLGSDGSGGSICLDPATGAVYALDPDE  105 (179)
T ss_pred             EEEEcCCCCeEEEECCCCeEEEecCCc
Confidence            344444 77799999999999999874


No 440
>KOG0986|consensus
Probab=27.80  E-value=45  Score=27.34  Aligned_cols=27  Identities=26%  Similarity=0.311  Sum_probs=22.7

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeecc
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFGV   40 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~~   40 (82)
                      -|=-|+|||+| ..|+|=-.|+|.+-+-
T Consensus       311 RDLKPeNILLD-d~GhvRISDLGLAvei  337 (591)
T KOG0986|consen  311 RDLKPENILLD-DHGHVRISDLGLAVEI  337 (591)
T ss_pred             ccCChhheeec-cCCCeEeeccceEEec
Confidence            36679999999 9999999999976543


No 441
>KOG4645|consensus
Probab=27.76  E-value=73  Score=29.12  Aligned_cols=43  Identities=21%  Similarity=0.193  Sum_probs=32.5

Q ss_pred             CCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCC
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEP   65 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~   65 (82)
                      |=-|.||+++ .+|-+=..|||.+.--.    +..|.+|    ++++..||.
T Consensus      1359 DIK~aNI~Ld-~~g~iK~~DFGsa~ki~----~~~~~~~----~el~~~~GT 1401 (1509)
T KOG4645|consen 1359 DIKPANILLD-FNGLIKYGDFGSAVKIK----NNAQTMP----GELQSMMGT 1401 (1509)
T ss_pred             CCCccceeee-cCCcEEeecccceeEec----CchhcCC----HHHHhhcCC
Confidence            5568999998 89999999999654444    3356667    788887775


No 442
>PF11720 Inhibitor_I78:  Peptidase inhibitor I78 family;  InterPro: IPR021719  This family includes Aspergillus elastase inhibitor and belongs to MEROPS peptidase inhibitor family I78. 
Probab=27.75  E-value=56  Score=18.44  Aligned_cols=16  Identities=25%  Similarity=0.268  Sum_probs=12.0

Q ss_pred             cEEEEcCCCcEEEEeec
Q psy16910         19 NTLVCTKTGRCVGIDFG   35 (82)
Q Consensus        19 nili~~~tG~v~hiDfg   35 (82)
                      ||.+| .+|.|..+..|
T Consensus        45 nv~~D-~~g~I~~v~CG   60 (60)
T PF11720_consen   45 NVEVD-DDGVITRVRCG   60 (60)
T ss_pred             EEEEC-CCCcEEEEecC
Confidence            67777 67888887664


No 443
>COG4499 Predicted membrane protein [Function unknown]
Probab=27.47  E-value=65  Score=25.60  Aligned_cols=27  Identities=19%  Similarity=-0.017  Sum_probs=19.1

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeec
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFG   35 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg   35 (82)
                      |+-.++++     ||+||+++ ..+..+-+-+|
T Consensus       103 ~tr~~~~l-----aPeNilf~-~~l~p~~vH~G  129 (434)
T COG4499         103 NTRYTFFL-----APENILFD-GGLTPFFVHRG  129 (434)
T ss_pred             ccceeEEe-----cchheEEc-CCCceEEEecc
Confidence            45555555     79999997 66777766665


No 444
>PRK06149 hypothetical protein; Provisional
Probab=27.07  E-value=54  Score=28.07  Aligned_cols=25  Identities=32%  Similarity=0.278  Sum_probs=19.2

Q ss_pred             CCCCCCcEEEEcCC-CcE---EEEeecee
Q psy16910         13 GDRHLENTLVCTKT-GRC---VGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~t-G~v---~hiDfg~~   37 (82)
                      ||=|++||+++..+ |+.   --||||.+
T Consensus       213 ~Dl~~~Nilv~~~~~~~~~v~giIDFgD~  241 (972)
T PRK06149        213 LDITDDNVVGSRDADGRWQPDGVIDFGDL  241 (972)
T ss_pred             CCCCcccEEEcCCCCCCcceeEEEEcccc
Confidence            78899999998543 443   56999976


No 445
>COG1871 CheD Chemotaxis protein; stimulates methylation of MCP proteins [Cell motility and secretion / Signal transduction mechanisms]
Probab=27.06  E-value=62  Score=22.51  Aligned_cols=19  Identities=21%  Similarity=0.160  Sum_probs=17.3

Q ss_pred             eCCCCCCcEEEEcCCCcEE
Q psy16910         12 IGDRHLENTLVCTKTGRCV   30 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~   30 (82)
                      +|..|+.+|.+++.||+++
T Consensus       135 ~Gg~~gR~i~F~p~tG~v~  153 (164)
T COG1871         135 TGGDSGRTIEFNPSTGRVR  153 (164)
T ss_pred             hCCCCCcEEEEecCCCcEE
Confidence            5788999999999999987


No 446
>PF03975 CheD:  CheD chemotactic sensory transduction;  InterPro: IPR005659 CheD deamidates glutamine residues to glutamate on methyl-accepting chemotaxis receptors (MCPs). CheD-mediated MCP deamidation is required for productive communication of the conformational signals of the chemoreceptors to the cheA kinase []. CheC is a CheY-P phosphatase (CheY controls flagellar rotation and is activated by phosphorylation). The activity of CheC is enhanced by its interaction with CheD, forming a CheC-CheD heterodimer. It is suggested that CheC exerts its effect on MCP methylation in Bacillus subtilis by controlling the binding of CheD to the MCPs [].; GO: 0050568 protein-glutamine glutaminase activity, 0006935 chemotaxis; PDB: 2F9Z_D.
Probab=26.98  E-value=53  Score=20.76  Aligned_cols=21  Identities=14%  Similarity=0.086  Sum_probs=16.5

Q ss_pred             eeCCCCCCcEEEEcCCCcEEE
Q psy16910         11 SIGDRHLENTLVCTKTGRCVG   31 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~h   31 (82)
                      -+|.-+..+|.++..||+|+.
T Consensus        84 dvGG~~~R~v~f~~~tG~v~v  104 (114)
T PF03975_consen   84 DVGGNFGRKVRFDPATGEVWV  104 (114)
T ss_dssp             EE-SSS-EEEEEETTTTEEEE
T ss_pred             eCCCCCCcEEEEEcCCCEEEE
Confidence            467788899999999999984


No 447
>PF03413 PepSY:  Peptidase propeptide and YPEB domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ;  InterPro: IPR005075  This signature, PepSY, is found in the propeptide of members of the MEROPS peptidase family M4 (clan MA(E)), which contains the thermostable thermolysins (3.4.24.27 from EC), and related thermolabile neutral proteases (bacillolysins) (3.4.24.28 from EC) from various species of Bacillus. It is also in many non-peptidase proteins, including Bacillus subtilis YpeB protein - a regulator of SleB spore cortex lytic enzyme - and a large number of eubacterial and archaeal cell wall-associated and secreted proteins which are mostly annotated as 'hypothetical protein'. Many extracellular bacterial proteases are produced as proenzymes. The propeptides usually have a dual function, i.e. they function as an intramolecular chaperone required for the folding of the polypeptide and as an inhibitor preventing premature activation of the enzyme. Analysis of the propeptide region of the M4 family of peptidases reveals two regions of conservation, the PepSY domain and a second domain, proximate to the N terminus, the FTP domain (IPR011096 from INTERPRO), which is also found in isolation in the propeptide of eukaryotic peptidases belong to MEROPS peptidase family M36.  Propeptide domain swapping experiments, for example swapping the propeptide domain of PA protease with that of vibrolysin, both propeptides contain the FTP and PepSY domains, allows the PA protease domain to fold correctly and inhibits the C-terminal autoprocessing activity. However, swapping the propeptide of PA protease for the thermolysin propeptide, does not facilitate the correct folding nor the processing of the chimaeric protein into an active peptidase []. Mutational analysis of the Pseudomonas aeruginosa elastase gene revealed two mutations in the propeptide which resulted in the loss of inhibitory activity but not chaperone activity: A-15V and T-153I (where +1 is defined as the first residue of the mature peptidase). Both mutations resulted in peptidase activity, the T-153V mutation being much less effective than the A-15I mutation [] in activating peptidase activity. The T-153V mutation lies N-terminal to the FTP domain while the A-15I mutation is C-terminal to the PepSY domain.  Given the diverse range of other proteins, both domains occur in in isolation, the exact function of each is still unclear; though it has been proposed that the PepSY domain primarily has inhibitory activity and in conjunction with the FTP domain in chaperone activity. ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 2GU3_A 3NQZ_A 3NQY_A 2KGY_A.
Probab=26.97  E-value=93  Score=16.48  Aligned_cols=26  Identities=19%  Similarity=0.148  Sum_probs=13.0

Q ss_pred             eeeeeeeCC---CCCCcE--EEEcCCCcEEE
Q psy16910          6 LLLEYSIGD---RHLENT--LVCTKTGRCVG   31 (82)
Q Consensus         6 ~~yilgigD---Rh~~ni--li~~~tG~v~h   31 (82)
                      ..|-+.+-+   -.+..+  .||..||+|+-
T Consensus        32 ~~Y~v~~~~~~~~~~~~~~v~VDa~tG~Il~   62 (64)
T PF03413_consen   32 LVYEVEVVSDDDPDGGEYEVYVDAYTGEILS   62 (64)
T ss_dssp             EEEEEEEEBTTSTTTEEEEEEEETTT--EEE
T ss_pred             EEEEEEEEEEecCCCCEEEEEEECCCCeEEE
Confidence            345555442   333334  48889998874


No 448
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family. PQQ, or pyrroloquinoline-quinone, serves as a cofactor for a number of sugar and alcohol dehydrogenases in a limited number of bacterial species. Most characterized PQQ-dependent enzymes have multiple repeats of a sequence region described by pfam01011 (PQQ enzyme repeat), but this protein family in unusual in lacking that repeat. Below the noise cutoff are related proteins mostly from species that lack PQQ biosynthesis.
Probab=26.53  E-value=71  Score=25.35  Aligned_cols=29  Identities=14%  Similarity=0.177  Sum_probs=25.8

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcEEEEeece
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRCVGIDFGY   36 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v~hiDfg~   36 (82)
                      ..|...|-|+|..+-+++ +|++|-.|-|+
T Consensus       222 ~eIyA~G~RNp~Gla~dp-~G~Lw~~e~Gp  250 (454)
T TIGR03606       222 SHIFTYGHRNPQGLAFTP-DGTLYASEQGP  250 (454)
T ss_pred             ceEEEEeccccceeEECC-CCCEEEEecCC
Confidence            468889999999999996 99999998886


No 449
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=26.40  E-value=65  Score=21.78  Aligned_cols=25  Identities=20%  Similarity=0.012  Sum_probs=20.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+||+++ .+|.+--.||+...
T Consensus       141 ~dlkp~Nili~-~~~~~~l~~~~~~~  165 (275)
T cd05046         141 RDLAARNCLVS-SQREVKVSLLSLSK  165 (275)
T ss_pred             CcCccceEEEe-CCCcEEEccccccc
Confidence            68889999997 67888777887653


No 450
>KOG0582|consensus
Probab=26.39  E-value=57  Score=26.47  Aligned_cols=52  Identities=21%  Similarity=0.247  Sum_probs=33.2

Q ss_pred             CCCCCcEEEEcCCCcEEEEeeceee---ccccC---CCCCCCCCceeecHHH-HHhhCCC
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYSF---GVATQ---LLPIPELMPFRLTPHI-LAVNEPY   66 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~~---~~~~~---~~~~~E~vPFRLT~~~-~~~~g~~   66 (82)
                      |=-++||||+ .+|.|---|||..-   ..+..   .+...--+|..+.|+. .+-+.++
T Consensus       151 dvKAgnILi~-~dG~VkLadFgvsa~l~~~G~R~~~rf~tfvgtp~wmAPEvl~q~~~GY  209 (516)
T KOG0582|consen  151 DVKAGNILID-SDGTVKLADFGVSASLFDSGDRQVTRFNTFVGTPCWMAPEVLMQQLHGY  209 (516)
T ss_pred             ccccccEEEc-CCCcEEEcCceeeeeecccCceeeEeeccccCcccccChHHhhhcccCc
Confidence            3457899998 99999999998762   22211   0122234677788887 4444443


No 451
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=26.35  E-value=44  Score=21.68  Aligned_cols=25  Identities=32%  Similarity=0.302  Sum_probs=19.1

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|=.|+||+++.....+.-+|||.+
T Consensus       125 rd~kp~nil~~~~~~~~~l~dfg~~  149 (384)
T COG0515         125 RDIKPENILLDRDGRVVKLIDFGLA  149 (384)
T ss_pred             cCCCHHHeeecCCCCeEEEeccCcc
Confidence            3555999999844448999999964


No 452
>KOG2686|consensus
Probab=26.28  E-value=82  Score=24.53  Aligned_cols=29  Identities=31%  Similarity=0.410  Sum_probs=25.2

Q ss_pred             eeeeCCCCCCcEEEEcCCCcEEEEeecee
Q psy16910          9 EYSIGDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus         9 ilgigDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      ++.=.|=...|||+...|++++-|||-++
T Consensus       213 vFcHNDlq~gNiL~~~~t~~Lv~IDfEYa  241 (366)
T KOG2686|consen  213 VFCHNDLQYGNILLLNSTKELVLIDFEYA  241 (366)
T ss_pred             eeecccccccceeeecCCCceeEEeeccc
Confidence            45667888899999989999999999876


No 453
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=26.28  E-value=54  Score=23.21  Aligned_cols=24  Identities=8%  Similarity=0.076  Sum_probs=19.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++ .+|++.-.||+..
T Consensus       125 ~dlkp~Nil~~-~~~~~~l~~~~~~  148 (327)
T cd08227         125 RSVKASHILIS-VDGKVYLSGLRSN  148 (327)
T ss_pred             CCCChhhEEEe-cCCcEEEcccchh
Confidence            67789999997 7888888888654


No 454
>PRK13497 chemoreceptor glutamine deamidase CheD; Provisional
Probab=26.14  E-value=68  Score=22.42  Aligned_cols=25  Identities=20%  Similarity=0.182  Sum_probs=21.0

Q ss_pred             eeCCCCCCcEEEEcCCCcEEEEeec
Q psy16910         11 SIGDRHLENTLVCTKTGRCVGIDFG   35 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~hiDfg   35 (82)
                      -+|..+..+|.++..||+++.--.+
T Consensus       132 DvGG~~gR~v~f~~~tG~v~~k~~~  156 (184)
T PRK13497        132 STGGEHGRKLEYWPVSGRARQYPLT  156 (184)
T ss_pred             eCCCCCCcEEEEECCCCeEEEEEcC
Confidence            3688899999999999999866554


No 455
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=26.04  E-value=40  Score=22.97  Aligned_cols=24  Identities=17%  Similarity=0.007  Sum_probs=20.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|-.|+||+++ .++.+.=+|||.+
T Consensus       141 ~di~p~nil~~-~~~~~kl~d~g~~  164 (280)
T cd05043         141 KDIAARNCVID-EELQVKITDNALS  164 (280)
T ss_pred             cccCHhhEEEc-CCCcEEECCCCCc
Confidence            78899999996 7798888999865


No 456
>PF10246 MRP-S35:  Mitochondrial ribosomal protein MRP-S35;  InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This is a family of short mitochondrial ribosomal proteins, less than 200 amino acids long. MRP-S35 was proposed as a more appropriate name to this group of proteins [].
Probab=25.75  E-value=91  Score=20.16  Aligned_cols=42  Identities=24%  Similarity=0.349  Sum_probs=25.5

Q ss_pred             eeeeCCCCCCcEEEEcCCCcEEE-------Eeeceeecccc-------CCCCCCCCCceee
Q psy16910          9 EYSIGDRHLENTLVCTKTGRCVG-------IDFGYSFGVAT-------QLLPIPELMPFRL   55 (82)
Q Consensus         9 ilgigDRh~~nili~~~tG~v~h-------iDfg~~~~~~~-------~~~~~~E~vPFRL   55 (82)
                      ++.+|| --+++++    |+|+|       ||||--|..--       +.+....+|-.||
T Consensus        16 fi~lG~-~~gk~V~----G~I~hvv~ddLYIDfG~KFhcVc~rp~~~~~~y~~G~rV~lrL   71 (104)
T PF10246_consen   16 FIQLGD-PEGKIVI----GKIFHVVDDDLYIDFGGKFHCVCKRPAVNGEKYVRGSRVRLRL   71 (104)
T ss_pred             hhhcCC-ccCCEEE----EEEEEEecCceEEEeCCceeEEEecccccccccccCCEEEEEE
Confidence            456787 3555555    77776       68987665421       2244455677776


No 457
>PF08534 Redoxin:  Redoxin;  InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins. Peroxiredoxins (Prxs) constitute a family of thiol peroxidases that reduce hydrogen peroxide, peroxinitrite, and hydroperoxides using a strictly conserved cysteine []. Chloroplast thioredoxin systems in plants regulate the enzymes involved in photosynthetic carbon assimilation []. It is thought that redoxins have a large role to play in anti-oxidant defence. Cadmium-sensitive proteins are also regulated via thioredoxin and glutaredoxin thiol redox systems [].; GO: 0016491 oxidoreductase activity; PDB: 2H30_A 1TP9_A 1Y25_A 1XVQ_A 2B1K_A 2G0F_A 2B1L_B 3K8N_A 1Z5Y_E 3OR5_A ....
Probab=25.60  E-value=77  Score=19.79  Aligned_cols=21  Identities=24%  Similarity=0.162  Sum_probs=18.9

Q ss_pred             CCCCcEEEEcCCCcEEEEeece
Q psy16910         15 RHLENTLVCTKTGRCVGIDFGY   36 (82)
Q Consensus        15 Rh~~nili~~~tG~v~hiDfg~   36 (82)
                      +.|..++|| .+|+|.+...|.
T Consensus       114 ~~P~~~lId-~~G~V~~~~~g~  134 (146)
T PF08534_consen  114 GIPTTFLID-KDGKVVYRHVGP  134 (146)
T ss_dssp             SSSEEEEEE-TTSBEEEEEESS
T ss_pred             eecEEEEEE-CCCEEEEEEeCC
Confidence            789999999 999999998874


No 458
>PF12260 PIP49_C:  Protein-kinase domain of FAM69;  InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C). Proteins in this uncharacterised family are described as transmembrane proteins.
Probab=25.49  E-value=68  Score=21.89  Aligned_cols=38  Identities=24%  Similarity=0.196  Sum_probs=31.4

Q ss_pred             cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeecccc
Q psy16910          3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   42 (82)
Q Consensus         3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~   42 (82)
                      ++..++ +-+-|=+++|+-++ .+|++.-||...++-..+
T Consensus        77 ~~~~~~-~~lcDv~~~nfgv~-~~~~lk~iDld~v~~~~~  114 (188)
T PF12260_consen   77 HGPLGF-FYLCDVSPDNFGVN-DDGRLKLIDLDDVFVEDK  114 (188)
T ss_pred             cCCCCc-EEEeecchHHeEEe-CCCcEEEEechhcchhHH
Confidence            455566 78889999999997 889999999998876654


No 459
>PF11776 DUF3315:  Domain of unknown function (DUF3315);  InterPro: IPR024572 This is a bacterial family of uncharacterised proteins, which include YohN from Escherichia coli K12.; PDB: 2L1S_A.
Probab=25.11  E-value=83  Score=17.39  Aligned_cols=14  Identities=29%  Similarity=0.351  Sum_probs=10.0

Q ss_pred             cEEEEcCCCcEEEE
Q psy16910         19 NTLVCTKTGRCVGI   32 (82)
Q Consensus        19 nili~~~tG~v~hi   32 (82)
                      =+||+..||.|..|
T Consensus        39 yvLv~~~tG~I~~V   52 (52)
T PF11776_consen   39 YVLVAIATGIIASV   52 (52)
T ss_dssp             EEEEETTT-BEEEE
T ss_pred             EEEEEcCCCeEEeC
Confidence            36788899998765


No 460
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=24.82  E-value=41  Score=22.32  Aligned_cols=25  Identities=20%  Similarity=0.155  Sum_probs=18.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      +|=.|+||+++.....+.=+||+.+
T Consensus       125 ~dl~~~nil~~~~~~~~~l~d~~~~  149 (257)
T cd08225         125 RDIKSQNIFLSKNGMVAKLGDFGIA  149 (257)
T ss_pred             ccCCHHHEEEcCCCCeEEecccccc
Confidence            6888999999744444567888754


No 461
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=24.79  E-value=77  Score=23.88  Aligned_cols=25  Identities=28%  Similarity=0.375  Sum_probs=20.8

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      +|=.|+|||++ ..+.+.-+|||.+-
T Consensus       263 rdlkp~NiLl~-~~~~~kL~DfGla~  287 (401)
T cd05107         263 RDLAARNVLIC-EGKLVKICDFGLAR  287 (401)
T ss_pred             ccCCcceEEEe-CCCEEEEEecCcce
Confidence            56789999997 68888889999753


No 462
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=24.77  E-value=46  Score=23.17  Aligned_cols=26  Identities=27%  Similarity=0.345  Sum_probs=21.5

Q ss_pred             eCCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         12 IGDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        12 igDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      -+|=.|+||+++ ..|.+.=+|||.+-
T Consensus       138 H~dL~p~Nili~-~~~~~kL~dfg~~~  163 (293)
T cd06647         138 HRDIKSDNILLG-MDGSVKLTDFGFCA  163 (293)
T ss_pred             eccCCHHHEEEc-CCCCEEEccCccee
Confidence            377889999997 78889999998653


No 463
>smart00135 LY Low-density lipoprotein-receptor YWTD domain. Type "B" repeats in low-density lipoprotein (LDL) receptor that  plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.
Probab=24.72  E-value=96  Score=14.82  Aligned_cols=24  Identities=29%  Similarity=0.246  Sum_probs=20.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeece
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGY   36 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~   36 (82)
                      +-.+|..|-+|...++++.+|...
T Consensus         7 ~~~~~~~la~d~~~~~lYw~D~~~   30 (43)
T smart00135        7 GLGHPNGLAVDWIEGRLYWTDWGL   30 (43)
T ss_pred             CCCCcCEEEEeecCCEEEEEeCCC
Confidence            566788899999999999999764


No 464
>KOG0578|consensus
Probab=24.40  E-value=66  Score=26.40  Aligned_cols=21  Identities=29%  Similarity=0.501  Sum_probs=18.8

Q ss_pred             CCCcEEEEcCCCcEEEEeecee
Q psy16910         16 HLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        16 h~~nili~~~tG~v~hiDfg~~   37 (82)
                      --+|||+. .+|.|--+|||+|
T Consensus       396 KSDnILL~-~~g~vKltDFGFc  416 (550)
T KOG0578|consen  396 KSDNILLT-MDGSVKLTDFGFC  416 (550)
T ss_pred             ccceeEec-cCCcEEEeeeeee
Confidence            35899995 9999999999998


No 465
>PF06588 Muskelin_N:  Muskelin N-terminus;  InterPro: IPR010565 This entry represents the N-terminal region of muskelin and is found in conjunction with several IPR006652 from INTERPRO repeats. Muskelin is an intracellular, kelch repeat protein that is needed in cell-spreading responses to the matrix adhesion molecule, thrombospondin-1 [].
Probab=24.22  E-value=41  Score=24.10  Aligned_cols=18  Identities=28%  Similarity=0.187  Sum_probs=12.7

Q ss_pred             eeeCCCCCCcEEEEcCCC
Q psy16910         10 YSIGDRHLENTLVCTKTG   27 (82)
Q Consensus        10 lgigDRh~~nili~~~tG   27 (82)
                      ---++=||+|||+|+.+-
T Consensus        14 sys~~y~P~NIlvd~P~d   31 (199)
T PF06588_consen   14 SYSSNYHPENILVDKPND   31 (199)
T ss_pred             ccCCccChhheeecCCCC
Confidence            334566899999986543


No 466
>PRK13488 chemoreceptor glutamine deamidase CheD; Provisional
Probab=24.15  E-value=79  Score=21.43  Aligned_cols=20  Identities=20%  Similarity=0.267  Sum_probs=17.8

Q ss_pred             eeCCCCCCcEEEEcCCCcEE
Q psy16910         11 SIGDRHLENTLVCTKTGRCV   30 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~   30 (82)
                      -+|..+..+|.++..||+++
T Consensus       127 dvGG~~gR~i~f~~~tG~v~  146 (157)
T PRK13488        127 DVGGDYGRTVKFDLKTGKVI  146 (157)
T ss_pred             EcCCCCCcEEEEECCCCEEE
Confidence            46788899999999999997


No 467
>PRK13498 chemoreceptor glutamine deamidase CheD; Provisional
Probab=24.14  E-value=79  Score=21.70  Aligned_cols=20  Identities=10%  Similarity=0.124  Sum_probs=17.6

Q ss_pred             eeCCCCCCcEEEEcCCCcEE
Q psy16910         11 SIGDRHLENTLVCTKTGRCV   30 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~   30 (82)
                      -+|..++.+|.++..||+++
T Consensus       135 DvGG~~gR~i~f~~~tG~v~  154 (167)
T PRK13498        135 DLGSTGHRSIIFDLWNGNVW  154 (167)
T ss_pred             eCCCCCCcEEEEECCCCEEE
Confidence            36788899999999999997


No 468
>PF14433 SUKH-3:  SUKH-3 immunity protein
Probab=23.89  E-value=1.5e+02  Score=19.03  Aligned_cols=26  Identities=15%  Similarity=0.111  Sum_probs=19.4

Q ss_pred             eeeeCCCCCCcEEEEcCCCcEEEEeec
Q psy16910          9 EYSIGDRHLENTLVCTKTGRCVGIDFG   35 (82)
Q Consensus         9 ilgigDRh~~nili~~~tG~v~hiDfg   35 (82)
                      -+|--++....++|| .+|+|++.+-.
T Consensus        95 PiG~~~~~~~~l~id-e~Grvy~~~~~  120 (142)
T PF14433_consen   95 PIGEEHDGHAILAID-ESGRVYGLDDT  120 (142)
T ss_pred             EEEEecCCCEEEEEe-CCCCEEEecCC
Confidence            345555666777888 99999999864


No 469
>KOG0695|consensus
Probab=23.83  E-value=51  Score=26.31  Aligned_cols=26  Identities=27%  Similarity=0.339  Sum_probs=22.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceeec
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSFG   39 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~~   39 (82)
                      .|-.++|+|+| ..|++--+|||+|=+
T Consensus       375 rdlkldnvlld-aeghikltdygmcke  400 (593)
T KOG0695|consen  375 RDLKLDNVLLD-AEGHIKLTDYGMCKE  400 (593)
T ss_pred             eeccccceEEc-cCCceeecccchhhc
Confidence            36678999998 999999999998744


No 470
>KOG0668|consensus
Probab=23.56  E-value=58  Score=24.69  Aligned_cols=24  Identities=21%  Similarity=0.297  Sum_probs=21.5

Q ss_pred             CCCCCcEEEEcCCCcEEEEeecee
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      |--|+|+|||...-++--||+|.+
T Consensus       157 DVKPhNvmIdh~~rkLrlIDWGLA  180 (338)
T KOG0668|consen  157 DVKPHNVMIDHELRKLRLIDWGLA  180 (338)
T ss_pred             cCCcceeeechhhceeeeeecchH
Confidence            557999999999999999999965


No 471
>COG3536 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.53  E-value=2e+02  Score=18.98  Aligned_cols=40  Identities=23%  Similarity=0.386  Sum_probs=28.0

Q ss_pred             CCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCC
Q psy16910         14 DRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYG   67 (82)
Q Consensus        14 DRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g   67 (82)
                      ++.|-.|.+++. -++..+.|.    .+         -||||+.+++.+..|..
T Consensus         2 ~~~P~~lrvsk~-r~~L~l~f~----dg---------~~~~L~ae~LRv~sPsA   41 (120)
T COG3536           2 TQWPTELRVSKD-RKVLSLTFA----DG---------APFRLPAEFLRVLSPSA   41 (120)
T ss_pred             CCCCceeEEecc-CcEEEEEeC----CC---------CcccCCHHHHHhcCchH
Confidence            356778888744 445555553    33         29999999999999863


No 472
>COG2139 RPL21A Ribosomal protein L21E [Translation, ribosomal structure and biogenesis]
Probab=23.48  E-value=46  Score=21.31  Aligned_cols=28  Identities=29%  Similarity=0.162  Sum_probs=22.9

Q ss_pred             CCCcEEEEcCCCcEEEEeeceeeccccC
Q psy16910         16 HLENTLVCTKTGRCVGIDFGYSFGVATQ   43 (82)
Q Consensus        16 h~~nili~~~tG~v~hiDfg~~~~~~~~   43 (82)
                      +++..|-+.+-|..+|||.-+++.++.+
T Consensus        25 plsr~l~ey~~Gd~V~I~IdpSv~kGmP   52 (98)
T COG2139          25 PLSRYLQEYKVGDKVHIDIDPSVHKGMP   52 (98)
T ss_pred             chhhHHhhccCCCEEEEEeCcccccCCC
Confidence            4566677778999999999999888764


No 473
>PLN00181 protein SPA1-RELATED; Provisional
Probab=23.18  E-value=70  Score=26.26  Aligned_cols=25  Identities=4%  Similarity=-0.140  Sum_probs=19.3

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeeceee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~~   38 (82)
                      .|=-|+||||+ ..|++--+||+.+-
T Consensus       104 rDlKP~NiLl~-~~~~~k~~d~~~~~  128 (793)
T PLN00181        104 HNVRPSCFVMS-SFNHVSFIESASCS  128 (793)
T ss_pred             ccCCchhEEEc-ccCcEEEeeccccC
Confidence            46789999996 77788877777553


No 474
>PRK13493 chemoreceptor glutamine deamidase CheD; Provisional
Probab=23.05  E-value=83  Score=22.53  Aligned_cols=21  Identities=19%  Similarity=0.254  Sum_probs=18.7

Q ss_pred             eeCCCCCCcEEEEcCCCcEEE
Q psy16910         11 SIGDRHLENTLVCTKTGRCVG   31 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~h   31 (82)
                      -+|..++.+|.++..||+++-
T Consensus       159 DvGG~~gRki~f~~~tG~v~v  179 (213)
T PRK13493        159 DLGGAQPRKLLFDPQTGQAWV  179 (213)
T ss_pred             eCCCCCCcEEEEECCCCEEEE
Confidence            478889999999999999983


No 475
>PF11094 UL11:  Membrane-associated tegument protein;  InterPro: IPR024351 The UL11 gene product of herpes simplex virus is a membrane-associated tegument protein that is incorporated into the HSV virion and functions in viral envelopment []. UL11 is acylated, which is crucial for lipid raft association [].
Probab=21.73  E-value=92  Score=16.70  Aligned_cols=17  Identities=41%  Similarity=0.579  Sum_probs=13.8

Q ss_pred             CCcEEEEcCCCcEEEEee
Q psy16910         17 LENTLVCTKTGRCVGIDF   34 (82)
Q Consensus        17 ~~nili~~~tG~v~hiDf   34 (82)
                      -.|+|+ ..+|+++..|=
T Consensus        14 R~N~Lv-T~~Ge~vsL~a   30 (39)
T PF11094_consen   14 RRNVLV-THSGETVSLDA   30 (39)
T ss_pred             ecCEEE-ccCCeEEEeCh
Confidence            479999 59999997763


No 476
>PF01436 NHL:  NHL repeat;  InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins. For example, the repeat is found in a variety of enzymes of the copper type II, ascorbate-dependent monooxygenase family which catalyse the C terminus alpha-amidation of biological peptides []. In many it occurs in tandem arrays, for example in the ringfinger beta-box, coiled-coil (RBCC) eukaryotic growth regulators []. The 'Brain Tumor' protein (Brat) is one such growth regulator that contains a 6-bladed NHL-repeat beta-propeller [, ].  The NHL repeats are also found in serine/threonine protein kinase (STPK) in diverse range of pathogenic bacteria. These STPK are transmembrane receptors with a intracellular N-terminal kinase domain and extracellular C-terminal sensor domain. In the STPK, PknD, from Mycobacterium tuberculosis, the sensor domain forms a rigid, six-bladed b-propeller composed of NHL repeats with a flexible tether to the transmembrane domain.; GO: 0005515 protein binding; PDB: 3FVZ_A 3FW0_A 1RWL_A 1RWI_A 1Q7F_A.
Probab=21.72  E-value=98  Score=14.53  Aligned_cols=20  Identities=20%  Similarity=0.082  Sum_probs=15.6

Q ss_pred             CCCCcEEEEcCCCcEEEEeec
Q psy16910         15 RHLENTLVCTKTGRCVGIDFG   35 (82)
Q Consensus        15 Rh~~nili~~~tG~v~hiDfg   35 (82)
                      +.|.-|-++ .+|+++=.|.+
T Consensus         2 ~~P~gvav~-~~g~i~VaD~~   21 (28)
T PF01436_consen    2 NYPHGVAVD-SDGNIYVADSG   21 (28)
T ss_dssp             SSEEEEEEE-TTSEEEEEECC
T ss_pred             cCCcEEEEe-CCCCEEEEECC
Confidence            357778888 89999988864


No 477
>KOG3078|consensus
Probab=21.64  E-value=38  Score=24.72  Aligned_cols=15  Identities=20%  Similarity=0.481  Sum_probs=12.1

Q ss_pred             EEcCCCcEEEEeece
Q psy16910         22 VCTKTGRCVGIDFGY   36 (82)
Q Consensus        22 i~~~tG~v~hiDfg~   36 (82)
                      ++..||+++|+||-+
T Consensus       140 ihp~sG~~Yh~~~~p  154 (235)
T KOG3078|consen  140 IHPASGRVYHLEFNP  154 (235)
T ss_pred             ccCcccceecccccC
Confidence            456899999999964


No 478
>PRK13490 chemoreceptor glutamine deamidase CheD; Provisional
Probab=21.45  E-value=96  Score=21.13  Aligned_cols=20  Identities=20%  Similarity=0.310  Sum_probs=17.7

Q ss_pred             eeCCCCCCcEEEEcCCCcEE
Q psy16910         11 SIGDRHLENTLVCTKTGRCV   30 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~   30 (82)
                      -+|..+..+|.++..||+|+
T Consensus       132 dvGG~~gR~i~f~~~tG~v~  151 (162)
T PRK13490        132 DIGGNKGRTMIFDTSDGKVY  151 (162)
T ss_pred             ECCCCCCcEEEEECCCCEEE
Confidence            36788899999999999997


No 479
>KOG1166|consensus
Probab=21.03  E-value=1.1e+02  Score=26.75  Aligned_cols=29  Identities=31%  Similarity=0.398  Sum_probs=22.8

Q ss_pred             CCCCCCcEEEE------cCCCcEEEEeeceeeccc
Q psy16910         13 GDRHLENTLVC------TKTGRCVGIDFGYSFGVA   41 (82)
Q Consensus        13 gDRh~~nili~------~~tG~v~hiDfg~~~~~~   41 (82)
                      ||=-|+|.||-      ..+-.+.-||||.+++-.
T Consensus       818 gDiKPDNfll~~~~~~~~~~~~l~lIDfG~siDm~  852 (974)
T KOG1166|consen  818 GDIKPDNFLLRREICADSDSKGLYLIDFGRSIDMK  852 (974)
T ss_pred             ccCCcceeEeecccCCCCcccceEEEecccceeee
Confidence            89999999993      235568889999887765


No 480
>PF07995 GSDH:  Glucose / Sorbosone dehydrogenase;  InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases. The best characterised of these proteins is soluble glucose dehydrogenase (P13650 from SWISSPROT) from Acinetobacter calcoaceticus, which oxidises glucose to gluconolactone. The enzyme is a calcium-dependent homodimer which uses PQQ as a cofactor [].; GO: 0016901 oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor, 0048038 quinone binding, 0005975 carbohydrate metabolic process; PDB: 2ISM_A 2WG3_D 3HO5_A 3HO4_A 3HO3_A 2WFT_A 2WG4_B 2WFX_B 1CRU_A 1CQ1_B ....
Probab=20.92  E-value=83  Score=23.23  Aligned_cols=30  Identities=27%  Similarity=0.148  Sum_probs=24.3

Q ss_pred             eeeeeeCCCCCCcEEEEcCCCcEEEEeece
Q psy16910          7 LLEYSIGDRHLENTLVCTKTGRCVGIDFGY   36 (82)
Q Consensus         7 ~yilgigDRh~~nili~~~tG~v~hiDfg~   36 (82)
                      ..|+..|=|+|..+-++..||++|..|-|.
T Consensus       173 ~~i~A~GlRN~~~~~~d~~tg~l~~~d~G~  202 (331)
T PF07995_consen  173 SEIYAYGLRNPFGLAFDPNTGRLWAADNGP  202 (331)
T ss_dssp             TTEEEE--SEEEEEEEETTTTEEEEEEE-S
T ss_pred             EEEEEeCCCccccEEEECCCCcEEEEccCC
Confidence            467889999999999999999999999774


No 481
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx). Tpx is a bacterial periplasmic peroxidase which differs from other PRXs in that it shows substrate specificity toward alkyl hydroperoxides over hydrogen peroxide. As with all other PRXs, the peroxidatic cysteine (N-terminal) of Tpx is oxidized into a sulfenic acid intermediate upon reaction with peroxides. Tpx is able to resolve this intermediate by forming an intramolecular disulfide bond with a conserved C-terminal cysteine (the resolving cysteine), which can then be reduced by thioredoxin. This differs from the typical 2-cys PRX which resolves the oxidized cysteine by forming an intermolecular disulfide bond with the resolving cysteine from the other subunit of the homodimer. Atypical 2-cys PRX homodimers have a loop-based 
Probab=20.68  E-value=99  Score=19.25  Aligned_cols=22  Identities=5%  Similarity=0.108  Sum_probs=18.4

Q ss_pred             CCCcEEEEcCCCcEEEEeeceee
Q psy16910         16 HLENTLVCTKTGRCVGIDFGYSF   38 (82)
Q Consensus        16 h~~nili~~~tG~v~hiDfg~~~   38 (82)
                      .|..++|| .+|+|.+++.++..
T Consensus       110 ~~~~~iid-~~G~I~~~~~~~~~  131 (143)
T cd03014         110 ARAVFVID-ENGKVIYVELVPEI  131 (143)
T ss_pred             ceEEEEEc-CCCeEEEEEECCCc
Confidence            47889998 89999999988643


No 482
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.
Probab=20.66  E-value=90  Score=19.18  Aligned_cols=20  Identities=25%  Similarity=0.263  Sum_probs=16.4

Q ss_pred             CCCcEEEEcCCCcEEEEeece
Q psy16910         16 HLENTLVCTKTGRCVGIDFGY   36 (82)
Q Consensus        16 h~~nili~~~tG~v~hiDfg~   36 (82)
                      -|..++|| ..|++.++-.|.
T Consensus       106 ~P~~~vid-~~G~v~~~~~G~  125 (126)
T cd03012         106 WPALYLID-PTGNVRHVHFGE  125 (126)
T ss_pred             CCeEEEEC-CCCcEEEEEecC
Confidence            48999998 679999887763


No 483
>PF02201 SWIB:  SWIB/MDM2 domain;  InterPro: IPR003121 The SWI/SNF family of complexes, which are conserved from yeast to humans, are ATP-dependent chromatin-remodelling proteins that facilitate transcription activation []. The mammalian complexes are made up of 9-12 proteins called BAFs (BRG1-associated factors). The BAF60 family have at least three members: BAF60a, which is ubiquitous, BAF60b and BAF60c, which are expressed in muscle and pancreatic tissues, respectively. BAF60b is present in alternative forms of the SWI/SNF complex, including complex B (SWIB), which lacks BAF60a. The SWIB domain is a conserved region found within the BAF60b proteins [], and can be found fused to the C terminus of DNA topoisomerase in Chlamydia. MDM2 is an oncoprotein that acts as a cellular inhibitor of the p53 tumour suppressor by binding to the transactivation domain of p53 and suppressing its ability to activate transcription []. p53 acts in response to DNA damage, inducing cell cycle arrest and apoptosis. Inactivation of p53 is a common occurrence in neoplastic transformations. The core of MDM2 folds into an open bundle of four helices, which is capped by two small 3-stranded beta-sheets. It consists of a duplication of two structural repeats. MDM2 has a deep hydrophobic cleft on which the p53 alpha-helix binds; p53 residues involved in transactivation are buried deep within the cleft of MDM2, thereby concealing the p53 transactivation domain.  The SWIB and MDM2 domains are homologous and share a common fold.; GO: 0005515 protein binding; PDB: 1V31_A 3FE7_A 3JZQ_B 3EQY_B 2VYR_A 3JZO_A 3DAB_E 3LBJ_E 3FEA_A 3FDO_A ....
Probab=20.60  E-value=41  Score=19.75  Aligned_cols=16  Identities=19%  Similarity=0.337  Sum_probs=13.4

Q ss_pred             ceeecHHHHHhhCCCC
Q psy16910         52 PFRLTPHILAVNEPYG   67 (82)
Q Consensus        52 PFRLT~~~~~~~g~~g   67 (82)
                      ||+++|++..++|...
T Consensus         4 ~~~ls~~L~~~lg~~~   19 (76)
T PF02201_consen    4 RFKLSPELAEFLGEDE   19 (76)
T ss_dssp             EEHHHHHHHHHTT-SC
T ss_pred             CccCCHHHHHHhCCCC
Confidence            8999999999998754


No 484
>PRK13487 chemoreceptor glutamine deamidase CheD; Provisional
Probab=20.40  E-value=1e+02  Score=21.86  Aligned_cols=20  Identities=15%  Similarity=0.185  Sum_probs=17.9

Q ss_pred             eeCCCCCCcEEEEcCCCcEE
Q psy16910         11 SIGDRHLENTLVCTKTGRCV   30 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~   30 (82)
                      -+|..+..+|.++..||+|+
T Consensus       147 DvGG~~gR~v~f~~~tG~v~  166 (201)
T PRK13487        147 DLLDIYPRKVYFFPTTGKVL  166 (201)
T ss_pred             ECCCCCCcEEEEECCCCEEE
Confidence            46888899999999999998


No 485
>PRK13489 chemoreceptor glutamine deamidase CheD; Provisional
Probab=20.22  E-value=1e+02  Score=22.51  Aligned_cols=21  Identities=19%  Similarity=0.298  Sum_probs=18.5

Q ss_pred             eeCCCCCCcEEEEcCCCcEEE
Q psy16910         11 SIGDRHLENTLVCTKTGRCVG   31 (82)
Q Consensus        11 gigDRh~~nili~~~tG~v~h   31 (82)
                      -+|..++.+|.++..||+++-
T Consensus       145 DvGG~~gRkV~f~~~TG~v~V  165 (233)
T PRK13489        145 DLQGVHPRKVAFMPRTGRAMV  165 (233)
T ss_pred             eCCCCCCcEEEEECCCCEEEE
Confidence            478889999999999999983


No 486
>KOG0614|consensus
Probab=20.17  E-value=59  Score=27.16  Aligned_cols=24  Identities=33%  Similarity=0.472  Sum_probs=21.4

Q ss_pred             CCCCCCcEEEEcCCCcEEEEeecee
Q psy16910         13 GDRHLENTLVCTKTGRCVGIDFGYS   37 (82)
Q Consensus        13 gDRh~~nili~~~tG~v~hiDfg~~   37 (82)
                      .|-.|+|+|++ .+|-+--+|||++
T Consensus       544 RDLKPENllLd-~~Gy~KLVDFGFA  567 (732)
T KOG0614|consen  544 RDLKPENLLLD-NRGYLKLVDFGFA  567 (732)
T ss_pred             ccCChhheeec-cCCceEEeehhhH
Confidence            46789999998 9999999999975


Done!