Query         psy16923
Match_columns 159
No_of_seqs    177 out of 2264
Neff          10.4
Searched_HMMs 46136
Date          Fri Aug 16 17:09:44 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16923.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16923hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 1.1E-25 2.3E-30  155.0   4.5  117    3-122   138-258 (279)
  2 KOG2462|consensus               99.9   3E-24 6.5E-29  147.9   4.6   98    3-101   169-266 (279)
  3 KOG1074|consensus               99.7 5.2E-19 1.1E-23  137.1   2.4   56   51-106   606-661 (958)
  4 KOG1074|consensus               99.7 3.6E-18 7.8E-23  132.5   3.2   54   51-104   880-933 (958)
  5 KOG3576|consensus               99.7 1.3E-17 2.7E-22  110.6   1.4   86   20-105   115-200 (267)
  6 KOG3576|consensus               99.7   3E-17 6.6E-22  108.8   2.1  106    3-108   125-242 (267)
  7 KOG3623|consensus               99.6 3.4E-16 7.4E-21  120.3   5.8   94    9-102   224-333 (1007)
  8 KOG3623|consensus               99.6 2.7E-16 5.9E-21  120.8   1.8   81   19-99    891-971 (1007)
  9 KOG3608|consensus               99.6 1.1E-15 2.3E-20  109.1   1.9   97    3-99    187-313 (467)
 10 KOG3608|consensus               99.5 4.3E-15 9.4E-20  106.0   4.0   72    2-74    244-316 (467)
 11 PHA00733 hypothetical protein   99.4   9E-13 1.9E-17   83.7   4.4   84   19-104    37-125 (128)
 12 PLN03086 PRLI-interacting fact  99.2 6.3E-11 1.4E-15   91.2   7.9   91    8-103   465-565 (567)
 13 PHA00733 hypothetical protein   99.2 8.5E-11 1.8E-15   74.7   5.6   64   10-75     61-124 (128)
 14 PHA02768 hypothetical protein;  99.1 6.6E-11 1.4E-15   63.0   2.0   42   51-94      6-47  (55)
 15 PHA02768 hypothetical protein;  99.1 8.2E-11 1.8E-15   62.6   2.0   44   22-67      5-48  (55)
 16 PLN03086 PRLI-interacting fact  98.9 2.8E-09   6E-14   82.3   6.0   89   20-115   451-549 (567)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.9 9.3E-10   2E-14   50.3   1.4   23   11-33      2-25  (26)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.8   3E-09 6.4E-14   48.6   1.9   24   66-89      2-25  (26)
 19 PHA00616 hypothetical protein   98.7 6.3E-09 1.4E-13   52.8   1.6   34   22-55      1-34  (44)
 20 KOG3993|consensus               98.6 4.8E-09   1E-13   77.1  -0.5   83   23-105   268-383 (500)
 21 KOG3993|consensus               98.6 3.3E-08 7.2E-13   72.8   3.2  102    5-106   277-486 (500)
 22 PHA00732 hypothetical protein   98.5 1.2E-07 2.6E-12   55.0   3.5   48   22-75      1-49  (79)
 23 PHA00616 hypothetical protein   98.5 5.4E-08 1.2E-12   49.4   1.4   34   50-83      1-34  (44)
 24 PHA00732 hypothetical protein   98.4 2.3E-07 4.9E-12   53.9   2.7   47   50-102     1-48  (79)
 25 PF05605 zf-Di19:  Drought indu  98.3 1.8E-06 3.9E-11   46.5   3.9   49   51-102     3-53  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  98.2 9.2E-07   2E-11   39.0   1.3   22   23-44      1-22  (23)
 27 PF05605 zf-Di19:  Drought indu  98.1 8.5E-06 1.8E-10   43.9   4.2   50   22-74      2-53  (54)
 28 PF00096 zf-C2H2:  Zinc finger,  98.0 2.7E-06 5.8E-11   37.4   1.6   22   79-100     1-22  (23)
 29 PF12756 zf-C2H2_2:  C2H2 type   98.0 2.8E-06   6E-11   51.6   2.1   74   24-102     1-74  (100)
 30 PF13894 zf-C2H2_4:  C2H2-type   98.0 4.6E-06 9.9E-11   36.9   1.8   24   79-102     1-24  (24)
 31 COG5189 SFP1 Putative transcri  97.9 3.6E-06 7.8E-11   60.3   1.0   51   49-99    348-419 (423)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.9 7.9E-06 1.7E-10   36.1   1.8   23   23-45      1-23  (24)
 33 PF09237 GAGA:  GAGA factor;  I  97.9 6.2E-06 1.3E-10   42.9   1.4   39   12-50     12-52  (54)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.9 7.2E-06 1.6E-10   37.5   1.3   24   22-45      1-24  (27)
 35 COG5189 SFP1 Putative transcri  97.8 5.9E-06 1.3E-10   59.2   0.7   53   19-71    346-419 (423)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.3E-05 2.8E-10   36.7   1.4   24   79-102     2-25  (27)
 37 smart00355 ZnF_C2H2 zinc finge  97.4 0.00021 4.5E-09   31.8   2.6   24   23-46      1-24  (26)
 38 KOG1146|consensus               97.2 0.00049 1.1E-08   58.0   4.1  100   19-118   462-629 (1406)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.2 0.00022 4.7E-09   31.5   1.2   24   79-103     1-24  (24)
 40 smart00355 ZnF_C2H2 zinc finge  97.1  0.0004 8.6E-09   30.8   1.7   22   79-100     1-22  (26)
 41 PF12874 zf-met:  Zinc-finger o  97.0 0.00029 6.2E-09   31.4   1.0   20   24-43      2-21  (25)
 42 PF09237 GAGA:  GAGA factor;  I  97.0 0.00086 1.9E-08   35.0   2.6   30   75-104    21-50  (54)
 43 PRK04860 hypothetical protein;  96.9  0.0006 1.3E-08   45.1   2.2   39   49-91    118-156 (160)
 44 PF12874 zf-met:  Zinc-finger o  96.9 0.00066 1.4E-08   30.2   1.7   21   51-71      1-21  (25)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00057 1.2E-08   30.1   1.2   22   23-45      1-22  (24)
 46 PRK04860 hypothetical protein;  96.8 0.00072 1.6E-08   44.7   1.6   37   22-62    119-155 (160)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5 0.00068 1.5E-08   30.8   0.1   21   23-43      2-22  (27)
 48 KOG4173|consensus               96.5  0.0012 2.7E-08   44.7   1.2   80   21-103    78-171 (253)
 49 KOG1146|consensus               96.4  0.0028   6E-08   53.7   3.1   76   25-100   439-540 (1406)
 50 PF12171 zf-C2H2_jaz:  Zinc-fin  96.4  0.0013 2.8E-08   29.9   0.7   21   79-99      2-22  (27)
 51 KOG2482|consensus               96.2   0.015 3.2E-07   42.7   5.4   28   79-106   280-307 (423)
 52 PF12756 zf-C2H2_2:  C2H2 type   96.0  0.0062 1.4E-07   36.6   2.5   65    4-73      8-73  (100)
 53 KOG2893|consensus               95.9  0.0027 5.9E-08   44.1   0.5   49   52-104    12-60  (341)
 54 PF13913 zf-C2HC_2:  zinc-finge  95.6   0.014 3.1E-07   25.9   2.1   20   23-43      3-22  (25)
 55 KOG2482|consensus               95.2   0.022 4.8E-07   41.8   3.2   78   23-100   196-356 (423)
 56 smart00451 ZnF_U1 U1-like zinc  95.1   0.022 4.7E-07   27.3   2.1   23   22-44      3-25  (35)
 57 COG5048 FOG: Zn-finger [Genera  94.3   0.012 2.7E-07   44.5   0.1   63   21-83    288-356 (467)
 58 smart00451 ZnF_U1 U1-like zinc  94.1   0.048   1E-06   26.1   2.0   22   50-71      3-24  (35)
 59 KOG2231|consensus               94.1    0.13 2.7E-06   41.5   5.2   21   52-72    184-204 (669)
 60 KOG2231|consensus               94.1   0.098 2.1E-06   42.1   4.5   86    6-99    160-260 (669)
 61 cd00350 rubredoxin_like Rubred  94.0   0.032   7E-07   26.6   1.2   10   77-86     16-25  (33)
 62 PF12013 DUF3505:  Protein of u  93.7    0.16 3.5E-06   31.3   4.3   83   20-103     9-109 (109)
 63 COG4049 Uncharacterized protei  93.2   0.038 8.2E-07   29.4   0.7   26   19-44     14-39  (65)
 64 PF12013 DUF3505:  Protein of u  93.1    0.19 4.1E-06   31.0   3.8   22   50-72     11-32  (109)
 65 KOG2186|consensus               92.4   0.086 1.9E-06   37.2   1.7   47   22-71      3-49  (276)
 66 COG5236 Uncharacterized conser  92.2    0.11 2.4E-06   38.4   2.2   47   52-102   222-275 (493)
 67 KOG2893|consensus               92.1   0.048   1E-06   38.1   0.3   44   24-71     12-55  (341)
 68 COG5236 Uncharacterized conser  90.9    0.84 1.8E-05   34.0   5.5   92    9-105   202-308 (493)
 69 COG4049 Uncharacterized protei  90.7    0.11 2.3E-06   27.7   0.6   29   75-103    14-42  (65)
 70 TIGR00373 conserved hypothetic  90.6    0.29 6.4E-06   32.4   2.8   18   21-38    108-125 (158)
 71 PF09986 DUF2225:  Uncharacteri  90.4   0.065 1.4E-06   37.3  -0.5   13   79-91     49-61  (214)
 72 COG5048 FOG: Zn-finger [Genera  90.2    0.08 1.7E-06   40.1  -0.2   57   49-105   288-350 (467)
 73 PF09538 FYDLN_acid:  Protein o  89.9    0.14   3E-06   31.7   0.8   30   51-91     10-39  (108)
 74 cd00729 rubredoxin_SM Rubredox  89.7     0.2 4.3E-06   24.0   1.1   10   51-60      3-12  (34)
 75 PF13719 zinc_ribbon_5:  zinc-r  89.2    0.28 6.1E-06   24.0   1.4   13   24-36      4-16  (37)
 76 COG1592 Rubrerythrin [Energy p  88.7    0.31 6.6E-06   32.5   1.7   24   50-86    134-157 (166)
 77 TIGR00622 ssl1 transcription f  88.6    0.65 1.4E-05   28.8   3.0   81   20-102    13-105 (112)
 78 KOG2785|consensus               88.3     0.7 1.5E-05   34.7   3.5   28   20-47    164-191 (390)
 79 PRK06266 transcription initiat  88.2    0.48   1E-05   32.1   2.4   16   50-65    117-132 (178)
 80 PF13717 zinc_ribbon_4:  zinc-r  88.0    0.44 9.6E-06   23.1   1.6   13   24-36      4-16  (36)
 81 PF15135 UPF0515:  Uncharacteri  87.3    0.78 1.7E-05   32.5   3.1   25    6-30     90-120 (278)
 82 TIGR02098 MJ0042_CXXC MJ0042 f  86.7    0.47   1E-05   23.1   1.4   10   24-33      4-13  (38)
 83 PF09986 DUF2225:  Uncharacteri  86.4   0.095 2.1E-06   36.5  -1.7   44   20-63      3-61  (214)
 84 smart00531 TFIIE Transcription  86.3     1.1 2.4E-05   29.3   3.3   16   21-36     98-113 (147)
 85 PF02892 zf-BED:  BED zinc fing  85.8    0.58 1.3E-05   23.7   1.5   26   77-102    15-44  (45)
 86 TIGR00373 conserved hypothetic  85.5     1.3 2.8E-05   29.4   3.3   35   46-89    105-139 (158)
 87 smart00659 RPOLCX RNA polymera  84.3    0.71 1.5E-05   23.5   1.3   11   51-61      3-13  (44)
 88 smart00614 ZnF_BED BED zinc fi  83.7    0.91   2E-05   23.7   1.7   24   79-102    19-47  (50)
 89 KOG2186|consensus               83.1       1 2.2E-05   32.0   2.1   50   50-102     3-52  (276)
 90 TIGR02300 FYDLN_acid conserved  83.1     0.6 1.3E-05   29.5   0.9   34   51-95     10-43  (129)
 91 COG1997 RPL43A Ribosomal prote  82.8    0.83 1.8E-05   26.8   1.4   11   50-60     53-63  (89)
 92 PF04959 ARS2:  Arsenite-resist  82.3    0.79 1.7E-05   31.9   1.4   32   76-107    75-106 (214)
 93 COG2888 Predicted Zn-ribbon RN  81.8     1.3 2.9E-05   24.0   1.8   50   22-86      9-58  (61)
 94 PRK06266 transcription initiat  81.5     1.9 4.2E-05   29.1   3.0   33   20-61    115-147 (178)
 95 smart00734 ZnF_Rad18 Rad18-lik  79.4     2.4 5.2E-05   18.9   2.0   19   24-43      3-21  (26)
 96 PF12907 zf-met2:  Zinc-binding  78.4     1.4 3.1E-05   21.9   1.2   27   79-105     2-31  (40)
 97 KOG4377|consensus               78.1     2.2 4.8E-05   32.5   2.6   98    2-102   280-427 (480)
 98 PF02176 zf-TRAF:  TRAF-type zi  77.8     2.2 4.9E-05   22.9   2.0   40   49-89      8-53  (60)
 99 KOG4173|consensus               77.7     1.2 2.7E-05   30.6   1.1   50   50-102    79-130 (253)
100 COG1996 RPC10 DNA-directed RNA  77.5     1.4 3.1E-05   23.0   1.1   11   50-60      6-16  (49)
101 TIGR02605 CxxC_CxxC_SSSS putat  77.3    0.69 1.5E-05   24.3  -0.1   11   51-61      6-16  (52)
102 PRK00398 rpoP DNA-directed RNA  76.1     1.7 3.6E-05   22.2   1.1   10   51-60      4-13  (46)
103 KOG2785|consensus               75.8     3.6 7.8E-05   31.1   3.1   49   52-100   168-242 (390)
104 PF09723 Zn-ribbon_8:  Zinc rib  75.3     1.2 2.5E-05   22.4   0.4   12   51-62      6-17  (42)
105 PRK00464 nrdR transcriptional   75.2    0.66 1.4E-05   30.6  -0.7   14   51-64     29-42  (154)
106 smart00834 CxxC_CXXC_SSSS Puta  74.8    0.84 1.8E-05   22.5  -0.2   11   51-61      6-16  (41)
107 PF06524 NOA36:  NOA36 protein;  72.5     1.6 3.4E-05   31.2   0.6   83   16-100   136-231 (314)
108 PF05443 ROS_MUCR:  ROS/MUCR tr  72.3       3 6.6E-05   26.7   1.8   31   79-112    73-103 (132)
109 PF13878 zf-C2H2_3:  zinc-finge  72.1     4.8  0.0001   20.1   2.2   25   22-46     13-39  (41)
110 PF15269 zf-C2H2_7:  Zinc-finge  71.7     3.4 7.3E-05   21.0   1.5   22   23-44     21-42  (54)
111 COG1655 Uncharacterized protei  71.3       1 2.2E-05   31.6  -0.5    9   79-87     63-71  (267)
112 PRK14890 putative Zn-ribbon RN  70.3       3 6.4E-05   22.7   1.2   53   20-87      5-57  (59)
113 PF05191 ADK_lid:  Adenylate ki  70.3     3.3 7.1E-05   20.1   1.3   10   79-88     22-31  (36)
114 PF03604 DNA_RNApol_7kD:  DNA d  69.1     4.7  0.0001   19.0   1.6   10   78-87     17-26  (32)
115 PF10571 UPF0547:  Uncharacteri  66.3     2.9 6.2E-05   18.7   0.6   10   80-89     16-25  (26)
116 PTZ00255 60S ribosomal protein  66.0     2.7 5.9E-05   25.0   0.6   11   50-60     54-64  (90)
117 COG1198 PriA Primosomal protei  64.4     2.6 5.6E-05   34.9   0.4   13   75-87    472-484 (730)
118 PF01780 Ribosomal_L37ae:  Ribo  64.3     1.8 3.9E-05   25.7  -0.4   11   79-89     54-64  (90)
119 KOG3408|consensus               64.0     4.9 0.00011   25.3   1.4   23   49-71     56-78  (129)
120 KOG4167|consensus               64.0     1.2 2.5E-05   36.5  -1.5   27   20-46    790-816 (907)
121 TIGR00280 L37a ribosomal prote  63.6     3.1 6.8E-05   24.8   0.6   10   79-88     54-63  (91)
122 PF07975 C1_4:  TFIIH C1-like d  62.4     1.5 3.3E-05   23.1  -0.8   20   22-41     21-40  (51)
123 KOG2593|consensus               61.5      13 0.00028   28.8   3.5   36   21-59    127-162 (436)
124 KOG2593|consensus               61.3      11 0.00023   29.2   3.1   39   46-87    124-162 (436)
125 PF13453 zf-TFIIB:  Transcripti  61.2     4.1 8.8E-05   20.2   0.6   18   50-67     19-36  (41)
126 PF14353 CpXC:  CpXC protein     60.7      11 0.00024   23.8   2.8    9   24-32      3-11  (128)
127 COG5151 SSL1 RNA polymerase II  60.2     4.8  0.0001   29.7   1.1   47   53-102   365-412 (421)
128 PF07754 DUF1610:  Domain of un  60.1     4.6 9.9E-05   17.7   0.6   10   21-30     15-24  (24)
129 KOG2807|consensus               59.9      13 0.00028   27.7   3.2   70   20-102   288-369 (378)
130 KOG3408|consensus               59.9     4.9 0.00011   25.2   1.0   26   75-100    54-79  (129)
131 PF08274 PhnA_Zn_Ribbon:  PhnA   59.8     4.4 9.4E-05   18.8   0.6    7   51-57     20-26  (30)
132 PRK03824 hypA hydrogenase nick  58.4     4.4 9.6E-05   26.1   0.6   14   50-63     70-83  (135)
133 PF04780 DUF629:  Protein of un  58.1     6.5 0.00014   30.8   1.6   30   76-105    55-84  (466)
134 PRK03976 rpl37ae 50S ribosomal  58.1     4.1 8.9E-05   24.2   0.4   10   79-88     55-64  (90)
135 PF04959 ARS2:  Arsenite-resist  57.1     5.8 0.00013   27.7   1.1   26   47-72     74-99  (214)
136 PRK09678 DNA-binding transcrip  56.5     2.9 6.4E-05   23.8  -0.4   16   76-91     25-42  (72)
137 PF07800 DUF1644:  Protein of u  55.9      33 0.00071   22.8   4.3   53   51-105    81-135 (162)
138 COG4530 Uncharacterized protei  55.8     4.3 9.4E-05   25.0   0.2   28   52-90     11-38  (129)
139 COG3364 Zn-ribbon containing p  55.2     8.2 0.00018   23.5   1.3   12   51-62      3-14  (112)
140 KOG4167|consensus               54.7     2.8   6E-05   34.5  -0.9   28   79-106   793-820 (907)
141 PLN02294 cytochrome c oxidase   53.9     3.5 7.6E-05   27.6  -0.4   15   19-33    138-152 (174)
142 PF08790 zf-LYAR:  LYAR-type C2  53.0     3.6 7.9E-05   18.7  -0.3    9   52-60      2-10  (28)
143 COG4888 Uncharacterized Zn rib  53.0     3.4 7.4E-05   25.0  -0.5   38   49-90     21-58  (104)
144 PHA00626 hypothetical protein   52.3       8 0.00017   20.8   0.9   16   21-36     22-37  (59)
145 KOG2907|consensus               51.3     8.2 0.00018   23.9   0.9   38   51-90     75-114 (116)
146 COG1675 TFA1 Transcription ini  50.7      21 0.00045   24.2   2.9   17   20-36    111-127 (176)
147 cd00924 Cyt_c_Oxidase_Vb Cytoc  50.4     3.8 8.3E-05   24.8  -0.6   15   19-33     76-90  (97)
148 COG4957 Predicted transcriptio  50.3     9.5 0.00021   24.5   1.1   23   52-77     78-100 (148)
149 COG2331 Uncharacterized protei  50.0     6.1 0.00013   22.6   0.2   10   23-32     13-22  (82)
150 smart00440 ZnF_C2C2 C2C2 Zinc   49.9       2 4.4E-05   21.3  -1.5   10   79-88     29-38  (40)
151 PF07282 OrfB_Zn_ribbon:  Putat  49.7      15 0.00032   20.3   1.8   12   77-88     45-56  (69)
152 KOG1842|consensus               48.6     9.5 0.00021   29.6   1.1   23   50-72     15-37  (505)
153 KOG0978|consensus               48.4     6.3 0.00014   32.4   0.2   20   78-97    678-697 (698)
154 smart00154 ZnF_AN1 AN1-like Zi  48.3     9.6 0.00021   18.7   0.8   13   22-34     12-24  (39)
155 KOG2071|consensus               48.2      13 0.00027   30.0   1.7   28   19-46    415-442 (579)
156 PRK14873 primosome assembly pr  47.6      14 0.00031   30.5   2.0   11   77-87    421-431 (665)
157 PF10013 DUF2256:  Uncharacteri  47.2      11 0.00024   18.9   0.9   14   80-93     10-23  (42)
158 PF05495 zf-CHY:  CHY zinc fing  47.2     3.8 8.2E-05   23.2  -0.9   59   22-88     10-71  (71)
159 PF12760 Zn_Tnp_IS1595:  Transp  47.0      18 0.00039   18.3   1.7    8   78-85     37-44  (46)
160 COG3091 SprT Zn-dependent meta  46.4      10 0.00022   24.9   0.9   35   48-87    115-149 (156)
161 COG1571 Predicted DNA-binding   46.3      11 0.00025   29.1   1.2   29   52-91    352-380 (421)
162 PF13451 zf-trcl:  Probable zin  46.2      14  0.0003   19.3   1.2   11   51-61      5-15  (49)
163 PF04780 DUF629:  Protein of un  45.4      16 0.00035   28.7   1.9   24   49-72     56-79  (466)
164 KOG1280|consensus               44.5      21 0.00045   26.9   2.2   36   50-85     79-116 (381)
165 KOG0717|consensus               43.5      14  0.0003   29.0   1.3   22   23-44    293-314 (508)
166 TIGR00100 hypA hydrogenase nic  43.4      11 0.00024   23.5   0.7   24   51-86     71-94  (115)
167 KOG0782|consensus               41.1     3.5 7.5E-05   33.1  -2.2   52   36-92    239-290 (1004)
168 KOG2636|consensus               40.0      21 0.00046   27.8   1.8   29   71-99    394-423 (497)
169 TIGR00595 priA primosomal prot  39.6      27 0.00059   27.8   2.4   10   77-86    252-261 (505)
170 PRK12380 hydrogenase nickel in  39.3      15 0.00033   22.8   0.8   24   51-86     71-94  (113)
171 PF01363 FYVE:  FYVE zinc finge  39.2      21 0.00045   19.7   1.3   10   24-33     11-20  (69)
172 KOG0402|consensus               37.8      28 0.00061   20.4   1.7    9   22-30     36-44  (92)
173 PF10537 WAC_Acf1_DNA_bd:  ATP-  37.5      57  0.0012   19.9   3.1   38   21-59      2-39  (102)
174 COG1773 Rubredoxin [Energy pro  37.5      16 0.00035   19.6   0.6   14   78-91      3-16  (55)
175 PF04810 zf-Sec23_Sec24:  Sec23  37.4     9.4  0.0002   18.8  -0.3   13   75-87     21-33  (40)
176 PF10263 SprT-like:  SprT-like   37.1      10 0.00022   24.7  -0.2   33   49-89    122-154 (157)
177 PRK04023 DNA polymerase II lar  36.9      29 0.00064   30.1   2.3   12   20-31    624-635 (1121)
178 PRK00432 30S ribosomal protein  36.5      17 0.00037   19.0   0.6    8   79-86     38-45  (50)
179 PF13824 zf-Mss51:  Zinc-finger  36.1      29 0.00062   18.6   1.4   13   76-88     12-24  (55)
180 PF01428 zf-AN1:  AN1-like Zinc  35.8      10 0.00022   19.0  -0.3   13   21-33     12-24  (43)
181 PTZ00448 hypothetical protein;  35.6      32  0.0007   26.2   2.1   23   22-44    314-336 (373)
182 KOG0717|consensus               34.6      21 0.00045   28.0   1.1   21   79-99    293-313 (508)
183 PF09845 DUF2072:  Zn-ribbon co  34.3      23  0.0005   22.7   1.1   12   51-62      2-13  (131)
184 smart00661 RPOL9 RNA polymeras  34.2      29 0.00064   17.7   1.3   11   78-88     20-30  (52)
185 COG3357 Predicted transcriptio  34.0      19 0.00041   21.5   0.6   15   76-90     56-70  (97)
186 PF05290 Baculo_IE-1:  Baculovi  33.9      24 0.00053   22.7   1.1   57   19-92     77-135 (140)
187 PF14311 DUF4379:  Domain of un  33.9      34 0.00073   18.0   1.5   11   51-61     29-39  (55)
188 PRK12496 hypothetical protein;  33.7      33 0.00071   22.9   1.8   27   51-89    128-154 (164)
189 PF04423 Rad50_zn_hook:  Rad50   33.4      17 0.00037   19.1   0.3   12   52-63     22-33  (54)
190 COG1656 Uncharacterized conser  33.1      38 0.00083   22.7   2.0   43   51-95     98-147 (165)
191 KOG4124|consensus               32.5     9.4  0.0002   28.7  -1.0   24   76-99    396-419 (442)
192 PRK00564 hypA hydrogenase nick  31.8      22 0.00047   22.3   0.7   12   51-62     72-83  (117)
193 PF10276 zf-CHCC:  Zinc-finger   31.7      18  0.0004   18.0   0.3   12   77-88     28-39  (40)
194 PRK04351 hypothetical protein;  31.6      22 0.00047   23.4   0.6   33   50-90    112-144 (149)
195 cd00065 FYVE FYVE domain; Zinc  31.3      39 0.00084   17.6   1.6   11   24-34      4-14  (57)
196 KOG2071|consensus               31.2      34 0.00075   27.7   1.8   30   76-105   416-445 (579)
197 cd00730 rubredoxin Rubredoxin;  30.6      23 0.00049   18.6   0.5   13   79-91      2-14  (50)
198 TIGR01562 FdhE formate dehydro  30.5      45 0.00098   24.8   2.2   35   23-59    185-219 (305)
199 PLN02748 tRNA dimethylallyltra  30.2      43 0.00093   26.5   2.2   23   21-43    417-440 (468)
200 PTZ00043 cytochrome c oxidase   29.7      15 0.00032   25.9  -0.4   17   18-34    177-193 (268)
201 smart00731 SprT SprT homologue  29.7      30 0.00066   22.4   1.1   32   50-88    112-143 (146)
202 PHA02998 RNA polymerase subuni  29.6       9 0.00019   25.9  -1.4   39   51-91    144-184 (195)
203 KOG1994|consensus               29.6      33 0.00072   24.3   1.3   24   48-71    237-260 (268)
204 PF01155 HypA:  Hydrogenase exp  29.5      23  0.0005   22.0   0.5   25   51-87     71-95  (113)
205 KOG1280|consensus               29.4      39 0.00084   25.5   1.7   30   77-106    78-107 (381)
206 COG5112 UFD2 U1-like Zn-finger  29.4      30 0.00065   21.3   0.9   22   50-71     55-76  (126)
207 KOG1842|consensus               29.4      33 0.00071   26.9   1.3   27   21-47     14-41  (505)
208 PRK12860 transcriptional activ  29.2      42 0.00091   23.1   1.7   48   29-85    114-161 (189)
209 KOG2636|consensus               28.7      39 0.00085   26.4   1.7   29   43-71    394-423 (497)
210 PRK03681 hypA hydrogenase nick  28.0      21 0.00045   22.2   0.1   12   51-62     71-82  (114)
211 TIGR00627 tfb4 transcription f  27.9      44 0.00096   24.5   1.8   25   50-88    255-279 (279)
212 PF00301 Rubredoxin:  Rubredoxi  27.2      26 0.00057   18.1   0.4   14   79-92      2-15  (47)
213 PF11672 DUF3268:  Protein of u  27.1      26 0.00056   21.4   0.4   11   21-31      1-11  (102)
214 PRK03564 formate dehydrogenase  26.9      41 0.00089   25.0   1.5   36   21-59    186-221 (309)
215 KOG4118|consensus               26.8      36 0.00078   18.9   0.9   27   79-105    39-65  (74)
216 smart00064 FYVE Protein presen  26.5      50  0.0011   18.0   1.5   11   23-33     11-21  (68)
217 PF03811 Zn_Tnp_IS1:  InsA N-te  26.5      19 0.00041   17.4  -0.2   18   67-84     18-35  (36)
218 KOG3214|consensus               26.4      20 0.00043   21.8  -0.2   13   79-91     48-60  (109)
219 COG4896 Uncharacterized protei  26.0      37 0.00081   18.6   0.8   12   76-87     29-40  (68)
220 PF01215 COX5B:  Cytochrome c o  24.7     9.8 0.00021   24.6  -1.8   12   21-32    111-122 (136)
221 PRK12722 transcriptional activ  24.6      49  0.0011   22.7   1.4   47   31-86    116-162 (187)
222 COG1326 Uncharacterized archae  24.6      71  0.0015   22.1   2.1   10   79-88     31-40  (201)
223 KOG1729|consensus               24.6      23 0.00049   26.1  -0.2   57   21-88    167-224 (288)
224 COG1594 RPB9 DNA-directed RNA   24.2      16 0.00035   22.7  -0.9   16   20-35     20-35  (113)
225 PRK00762 hypA hydrogenase nick  23.9      36 0.00077   21.6   0.6   12   51-63     71-82  (124)
226 COG5188 PRP9 Splicing factor 3  23.9      50  0.0011   25.1   1.4   29   71-99    367-396 (470)
227 PF09963 DUF2197:  Uncharacteri  23.6      29 0.00063   18.7   0.1   10   77-86     30-39  (56)
228 PRK05978 hypothetical protein;  23.5      31 0.00068   22.6   0.3   11   80-90     54-64  (148)
229 PRK10220 hypothetical protein;  23.1      52  0.0011   20.4   1.2   12   79-90     21-32  (111)
230 COG4391 Uncharacterized protei  23.1      33 0.00071   18.8   0.3   45   41-89     15-59  (62)
231 COG0675 Transposase and inacti  22.7      52  0.0011   24.1   1.4   14   77-90    321-334 (364)
232 PF01286 XPA_N:  XPA protein N-  22.6      37 0.00079   16.2   0.4   13   79-91      4-16  (34)
233 PF14803 Nudix_N_2:  Nudix N-te  22.6      17 0.00036   17.4  -0.8    8   51-58     23-30  (34)
234 PF13821 DUF4187:  Domain of un  22.5   1E+02  0.0022   16.4   2.1   18   51-68     28-45  (55)
235 COG3677 Transposase and inacti  22.4      48   0.001   21.2   1.0   13   21-33     52-64  (129)
236 TIGR00686 phnA alkylphosphonat  22.4      43 0.00093   20.7   0.7   12   79-90     20-31  (109)
237 COG2879 Uncharacterized small   22.3 1.2E+02  0.0027   16.7   2.4   19   32-50     22-40  (65)
238 COG4338 Uncharacterized protei  22.2      37  0.0008   17.6   0.4   17   23-39     13-29  (54)
239 PRK14714 DNA polymerase II lar  22.1      84  0.0018   28.3   2.6   52   23-88    668-719 (1337)
240 PLN03238 probable histone acet  22.0 1.1E+02  0.0024   22.6   2.8   24   20-43     46-69  (290)
241 PRK05452 anaerobic nitric oxid  21.6      63  0.0014   25.7   1.7   15   49-63    424-438 (479)
242 PF14369 zf-RING_3:  zinc-finge  21.3      45 0.00098   15.9   0.5   10   24-33     23-32  (35)
243 PF00130 C1_1:  Phorbol esters/  21.0      74  0.0016   16.3   1.4   12   49-60     10-21  (53)
244 PF06397 Desulfoferrod_N:  Desu  21.0      41 0.00088   16.3   0.3   11   21-31      5-15  (36)
245 KOG4727|consensus               20.8      54  0.0012   22.1   1.0   21   23-43     76-96  (193)
246 PF06220 zf-U1:  U1 zinc finger  20.8      92   0.002   15.1   1.6   11   22-32      3-13  (38)
247 PF12230 PRP21_like_P:  Pre-mRN  20.7      33 0.00071   24.1   0.0   28   51-79    169-196 (229)
248 PF11931 DUF3449:  Domain of un  20.6      33 0.00072   23.7   0.0   28   72-99     95-123 (196)
249 PF02591 DUF164:  Putative zinc  20.5 1.1E+02  0.0025   16.0   2.1   11   76-86     44-54  (56)
250 PRK14892 putative transcriptio  20.5      36 0.00078   20.7   0.1   13   78-90     42-54  (99)
251 PTZ00448 hypothetical protein;  20.4      69  0.0015   24.5   1.6   23   50-72    314-336 (373)
252 PRK11823 DNA repair protein Ra  20.2      62  0.0013   25.4   1.4   12   21-32      6-17  (446)
253 TIGR00244 transcriptional regu  20.1      42 0.00092   22.0   0.4   15   79-93     29-43  (147)

No 1  
>KOG2462|consensus
Probab=99.92  E-value=1.1e-25  Score=155.01  Aligned_cols=117  Identities=30%  Similarity=0.547  Sum_probs=104.4

Q ss_pred             CCCCCHHHHHHHHHhh----CCCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCC
Q psy16923          3 SRFKTKYRLKLHLDTH----GETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRP   78 (159)
Q Consensus         3 ~~f~~~~~l~~H~~~h----~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~   78 (159)
                      |.+.+.++|.+|.++|    ..+.+.|+.|++.|.+...|..|+++|.  -+++|.+||+.|.+...|+.|+|.|+|+||
T Consensus       138 k~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP  215 (279)
T KOG2462|consen  138 KSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKP  215 (279)
T ss_pred             cccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCC
Confidence            5677888999999999    4788999999999999999999999997  688999999999999999999999999999


Q ss_pred             cccccCcccccCchhHHHhHHhhCCchhhhhhhccccccccccc
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGIVHKEKKK  122 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~~~~~~~~  122 (159)
                      |.|+.|++.|.++++|+.|+++|-. .....|..|+..+....-
T Consensus       216 F~C~hC~kAFADRSNLRAHmQTHS~-~K~~qC~~C~KsFsl~Sy  258 (279)
T KOG2462|consen  216 FSCPHCGKAFADRSNLRAHMQTHSD-VKKHQCPRCGKSFALKSY  258 (279)
T ss_pred             ccCCcccchhcchHHHHHHHHhhcC-CccccCcchhhHHHHHHH
Confidence            9999999999999999999997654 447778887776664433


No 2  
>KOG2462|consensus
Probab=99.90  E-value=3e-24  Score=147.90  Aligned_cols=98  Identities=28%  Similarity=0.570  Sum_probs=92.2

Q ss_pred             CCCCCHHHHHHHHHhhCCCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccc
Q psy16923          3 SRFKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCP   82 (159)
Q Consensus         3 ~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~   82 (159)
                      |.|..-..|+.|+|+|+ .++.|.+||+.|.+..-|+.|+|+|+|++||.|..|++.|.+.++|..|+++|.+.+.|.|.
T Consensus       169 K~YvSmpALkMHirTH~-l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~  247 (279)
T KOG2462|consen  169 KVYVSMPALKMHIRTHT-LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCP  247 (279)
T ss_pred             ceeeehHHHhhHhhccC-CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCc
Confidence            45666778999999995 78999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccccCchhHHHhHHhh
Q psy16923         83 WCSRTFANGSNCRSHKRRM  101 (159)
Q Consensus        83 ~C~~~f~~~~~l~~H~~~~  101 (159)
                      .|++.|...+.|.+|.+..
T Consensus       248 ~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  248 RCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             chhhHHHHHHHHHHhhhhc
Confidence            9999999999999998743


No 3  
>KOG1074|consensus
Probab=99.74  E-value=5.2e-19  Score=137.11  Aligned_cols=56  Identities=29%  Similarity=0.619  Sum_probs=51.6

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhHHHhHHhhCCchh
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEEL  106 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  106 (159)
                      -.|..|.++..-.+.|+.|.|.|+|++||+|.+||+.|.++.+|+.|+-.|.....
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~  661 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPP  661 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCcc
Confidence            57999999999999999999999999999999999999999999999987665443


No 4  
>KOG1074|consensus
Probab=99.71  E-value=3.6e-18  Score=132.54  Aligned_cols=54  Identities=31%  Similarity=0.624  Sum_probs=50.9

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhHHHhHHhhCCc
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPE  104 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  104 (159)
                      ..|.+|++.|.+.++|+.|+++|++++||.|..|++.|.++.+|+.||.+|+-.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~  933 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWV  933 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhcccccc
Confidence            679999999999999999999999999999999999999999999999977643


No 5  
>KOG3576|consensus
Probab=99.67  E-value=1.3e-17  Score=110.60  Aligned_cols=86  Identities=36%  Similarity=0.739  Sum_probs=68.5

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhHHHhHH
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKR   99 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   99 (159)
                      ...|.|..|++.|....-|.+|++.|...+.+.|..||++|-..-+|++|+|.|+|.+||+|..|++.|+.+-.|..|.+
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            45577888888888888888888888777777888888888888888888888888888888888888888888888888


Q ss_pred             hhCCch
Q psy16923        100 RMHPEE  105 (159)
Q Consensus       100 ~~h~~~  105 (159)
                      .+|+..
T Consensus       195 kvhgv~  200 (267)
T KOG3576|consen  195 KVHGVQ  200 (267)
T ss_pred             HHcCch
Confidence            777543


No 6  
>KOG3576|consensus
Probab=99.66  E-value=3e-17  Score=108.82  Aligned_cols=106  Identities=25%  Similarity=0.426  Sum_probs=95.3

Q ss_pred             CCCCCHHHHHHHHHhh-CCCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCC------
Q psy16923          3 SRFKTKYRLKLHLDTH-GETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTG------   75 (159)
Q Consensus         3 ~~f~~~~~l~~H~~~h-~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~------   75 (159)
                      |+|+-...|.+|++.| ..+.|.|..||++|...-+|.+|+|+|+|.+||+|..|++.|...-.|..|.+.-+|      
T Consensus       125 K~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~ya  204 (267)
T KOG3576|consen  125 KKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYA  204 (267)
T ss_pred             hhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHH
Confidence            6788899999999999 579999999999999999999999999999999999999999999999999876333      


Q ss_pred             -----CCCcccccCcccccCchhHHHhHHhhCCchhhh
Q psy16923         76 -----KRPYTCPWCSRTFANGSNCRSHKRRMHPEELKL  108 (159)
Q Consensus        76 -----~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~  108 (159)
                           .+.|.|..||+.-.+...+..|+..+|+.....
T Consensus       205 ykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Spal  242 (267)
T KOG3576|consen  205 YKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSPAL  242 (267)
T ss_pred             HHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCHHH
Confidence                 356899999999999999999999999776433


No 7  
>KOG3623|consensus
Probab=99.63  E-value=3.4e-16  Score=120.31  Aligned_cols=94  Identities=30%  Similarity=0.737  Sum_probs=85.0

Q ss_pred             HHHHHHHHh-h--CCCcccCCCCcccCCCHHHHHHHHHhcCC-------------CCceeccccccccCCHHhHHhHHhh
Q psy16923          9 YRLKLHLDT-H--GETPYGCPHCPMKLNTRRTLRMHLVVHRD-------------TKAYQCVTCGKSFRRSKDLKNHHNL   72 (159)
Q Consensus         9 ~~l~~H~~~-h--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-------------~~~~~C~~C~~~f~~~~~l~~H~~~   72 (159)
                      -.|+.|+++ |  .+.-|.|..|..+|.++..|.+||..|..             .+.|+|..|++.|..+-.|+.|+|.
T Consensus       224 tslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRI  303 (1007)
T KOG3623|consen  224 TSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRI  303 (1007)
T ss_pred             HHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhhee
Confidence            458999988 6  57889999999999999999999998853             3569999999999999999999999


Q ss_pred             cCCCCCcccccCcccccCchhHHHhHHhhC
Q psy16923         73 HTGKRPYTCPWCSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        73 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  102 (159)
                      |.|++||.|+.|+++|........|+....
T Consensus       304 HSGEKPfeCpnCkKRFSHSGSySSHmSSKK  333 (1007)
T KOG3623|consen  304 HSGEKPFECPNCKKRFSHSGSYSSHMSSKK  333 (1007)
T ss_pred             ecCCCCcCCcccccccccCCcccccccccc
Confidence            999999999999999999999999987443


No 8  
>KOG3623|consensus
Probab=99.59  E-value=2.7e-16  Score=120.84  Aligned_cols=81  Identities=27%  Similarity=0.727  Sum_probs=78.3

Q ss_pred             CCCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhHHHhH
Q psy16923         19 GETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHK   98 (159)
Q Consensus        19 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~   98 (159)
                      .+..|.|+.|+++|-..+.|.+|--.|+|.+||.|..|.+.|..+-.|+.|.|.|.|++||.|+.|+++|........||
T Consensus       891 e~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  891 EDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             ccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             H
Q psy16923         99 R   99 (159)
Q Consensus        99 ~   99 (159)
                      .
T Consensus       971 N  971 (1007)
T KOG3623|consen  971 N  971 (1007)
T ss_pred             c
Confidence            7


No 9  
>KOG3608|consensus
Probab=99.56  E-value=1.1e-15  Score=109.10  Aligned_cols=97  Identities=28%  Similarity=0.597  Sum_probs=69.0

Q ss_pred             CCCCCHHHHHHHHHhh-CCCcccCCCCcccCCCHHHHHHHHHhcCC--CCce--------------------------ec
Q psy16923          3 SRFKTKYRLKLHLDTH-GETPYGCPHCPMKLNTRRTLRMHLVVHRD--TKAY--------------------------QC   53 (159)
Q Consensus         3 ~~f~~~~~l~~H~~~h-~~~~~~C~~C~~~f~~~~~l~~H~~~h~~--~~~~--------------------------~C   53 (159)
                      +.|+++.+|++|+|.| ++|...|+.|+..|.++..|..|.+..+.  ..+|                          +|
T Consensus       187 ~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykC  266 (467)
T KOG3608|consen  187 KHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKC  266 (467)
T ss_pred             hhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccc
Confidence            5688999999999999 89999999999999999999999876542  3344                          45


Q ss_pred             cccccccCCHHhHHhHHhh-cCCCCCcccccCcccccCchhHHHhHH
Q psy16923         54 VTCGKSFRRSKDLKNHHNL-HTGKRPYTCPWCSRTFANGSNCRSHKR   99 (159)
Q Consensus        54 ~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~   99 (159)
                      +.|+-+....+.|..|++. |...+||+|+.|.+.|.+.+.|.+|..
T Consensus       267 plCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~  313 (467)
T KOG3608|consen  267 PLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQ  313 (467)
T ss_pred             cccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHH
Confidence            5555555555555555554 555556666666666666666666655


No 10 
>KOG3608|consensus
Probab=99.54  E-value=4.3e-15  Score=106.02  Aligned_cols=72  Identities=33%  Similarity=0.646  Sum_probs=56.0

Q ss_pred             CCCCCCHHHHHHHHHhhCCCcccCCCCcccCCCHHHHHHHHH-hcCCCCceeccccccccCCHHhHHhHHhhcC
Q psy16923          2 FSRFKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLV-VHRDTKAYQCVTCGKSFRRSKDLKNHHNLHT   74 (159)
Q Consensus         2 ~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   74 (159)
                      ||+|.+..-|+.|++.| -.-|+|+.|+++....+.|.+|++ .|...+||+|+.|+..+.+.++|+.|...|.
T Consensus       244 ~KrFaTeklL~~Hv~rH-vn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  244 FKRFATEKLLKSHVVRH-VNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             HHHHhHHHHHHHHHHHh-hhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            67788888888888777 445778888888888888888877 4777788888888888888888888877664


No 11 
>PHA00733 hypothetical protein
Probab=99.36  E-value=9e-13  Score=83.73  Aligned_cols=84  Identities=20%  Similarity=0.326  Sum_probs=71.9

Q ss_pred             CCCcccCCCCcccCCCHHHHHHH--HH---hcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchh
Q psy16923         19 GETPYGCPHCPMKLNTRRTLRMH--LV---VHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSN   93 (159)
Q Consensus        19 ~~~~~~C~~C~~~f~~~~~l~~H--~~---~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~   93 (159)
                      .++++.|.+|...|.....|..+  ++   .+.+.++|.|..|++.|.+...|..|++.|  ..++.|..|++.|.....
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHH
Confidence            47889999999999888777776  22   234578999999999999999999999976  356999999999999999


Q ss_pred             HHHhHHhhCCc
Q psy16923         94 CRSHKRRMHPE  104 (159)
Q Consensus        94 l~~H~~~~h~~  104 (159)
                      |..|+...|+.
T Consensus       115 L~~H~~~~h~~  125 (128)
T PHA00733        115 TLDHVCKKHNI  125 (128)
T ss_pred             HHHHHHHhcCc
Confidence            99999988864


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.20  E-value=6.3e-11  Score=91.18  Aligned_cols=91  Identities=21%  Similarity=0.497  Sum_probs=56.6

Q ss_pred             HHHHHHHHHhhCCCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccC----------CHHhHHhHHhhcCCCC
Q psy16923          8 KYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFR----------RSKDLKNHHNLHTGKR   77 (159)
Q Consensus         8 ~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~l~~H~~~h~~~~   77 (159)
                      ...|..|++.| .+++.|+ |++.+ .+..|..|++.|.+.+++.|..|+..+.          ....|+.|.... +.+
T Consensus       465 ~s~LekH~~~~-Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~r  540 (567)
T PLN03086        465 QGEMEKHMKVF-HEPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSR  540 (567)
T ss_pred             hHHHHHHHHhc-CCCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCc
Confidence            45566777665 3667776 76544 4566777766666667777777776663          123566666653 666


Q ss_pred             CcccccCcccccCchhHHHhHHhhCC
Q psy16923         78 PYTCPWCSRTFANGSNCRSHKRRMHP  103 (159)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~~h~  103 (159)
                      ++.|..||+.+..+ .+..|+..+|.
T Consensus       541 t~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        541 TAPCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             ceEccccCCeeeeh-hHHHHHHHhhc
Confidence            67777777666544 45666666553


No 13 
>PHA00733 hypothetical protein
Probab=99.16  E-value=8.5e-11  Score=74.70  Aligned_cols=64  Identities=27%  Similarity=0.535  Sum_probs=55.2

Q ss_pred             HHHHHHHhhCCCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCC
Q psy16923         10 RLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTG   75 (159)
Q Consensus        10 ~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~   75 (159)
                      .|.+|+..+++++|.|+.|++.|.+...|..|++.+  ..++.|..|++.|.....|..|+...++
T Consensus        61 ~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         61 YLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            355565556899999999999999999999999976  3568999999999999999999987554


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.07  E-value=6.6e-11  Score=62.96  Aligned_cols=42  Identities=21%  Similarity=0.485  Sum_probs=24.0

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhH
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNC   94 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l   94 (159)
                      |.|+.||+.|.+.+.|..|++.|+  ++++|..|++.|.+.+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            456666666666666666666655  455666666655544443


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.06  E-value=8.2e-11  Score=62.60  Aligned_cols=44  Identities=23%  Similarity=0.440  Sum_probs=39.4

Q ss_pred             cccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHH
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLK   67 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~   67 (159)
                      -|.|+.||+.|.+.++|..|+++|.  +++.|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4899999999999999999999998  6889999999998776553


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.91  E-value=2.8e-09  Score=82.30  Aligned_cols=89  Identities=18%  Similarity=0.350  Sum_probs=71.1

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccC---------
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFAN---------   90 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~---------   90 (159)
                      ++.+.|+.|++.|. ...|..|++.++  +++.|. |+..+ ....|..|+..|.+.+++.|..|++.|..         
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d  525 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRD  525 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhh
Confidence            35678999999996 678999999985  789999 99755 66899999999999999999999999852         


Q ss_pred             -chhHHHhHHhhCCchhhhhhhcccc
Q psy16923         91 -GSNCRSHKRRMHPEELKLYESSLGI  115 (159)
Q Consensus        91 -~~~l~~H~~~~h~~~~~~~~~~~~~  115 (159)
                       ...|..|....  ......|..|+.
T Consensus       526 ~~s~Lt~HE~~C--G~rt~~C~~Cgk  549 (567)
T PLN03086        526 RLRGMSEHESIC--GSRTAPCDSCGR  549 (567)
T ss_pred             hhhhHHHHHHhc--CCcceEccccCC
Confidence             34788998864  333455555543


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.87  E-value=9.3e-10  Score=50.26  Aligned_cols=23  Identities=48%  Similarity=1.078  Sum_probs=12.5

Q ss_pred             HHHHHHhh-CCCcccCCCCcccCC
Q psy16923         11 LKLHLDTH-GETPYGCPHCPMKLN   33 (159)
Q Consensus        11 l~~H~~~h-~~~~~~C~~C~~~f~   33 (159)
                      |.+|+++| +++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            45555555 455555555555553


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.80  E-value=3e-09  Score=48.57  Aligned_cols=24  Identities=46%  Similarity=1.284  Sum_probs=12.9

Q ss_pred             HHhHHhhcCCCCCcccccCccccc
Q psy16923         66 LKNHHNLHTGKRPYTCPWCSRTFA   89 (159)
Q Consensus        66 l~~H~~~h~~~~~~~C~~C~~~f~   89 (159)
                      |..|++.|++++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            445555555555555555555553


No 19 
>PHA00616 hypothetical protein
Probab=98.71  E-value=6.3e-09  Score=52.79  Aligned_cols=34  Identities=15%  Similarity=0.282  Sum_probs=24.5

Q ss_pred             cccCCCCcccCCCHHHHHHHHHhcCCCCceeccc
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVT   55 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~   55 (159)
                      ||.|+.||+.|.++++|..|++.|++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            4677777777777777777777777777766654


No 20 
>KOG3993|consensus
Probab=98.62  E-value=4.8e-09  Score=77.09  Aligned_cols=83  Identities=23%  Similarity=0.450  Sum_probs=60.4

Q ss_pred             ccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCC---------------------------
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTG---------------------------   75 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~---------------------------   75 (159)
                      |.|..|...|.+.-.|.+|.-......-|+|+.|++.|.-..+|..|.|.|..                           
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            67777777777777777775432222346777777777777777777776621                           


Q ss_pred             ------CCCcccccCcccccCchhHHHhHHhhCCch
Q psy16923         76 ------KRPYTCPWCSRTFANGSNCRSHKRRMHPEE  105 (159)
Q Consensus        76 ------~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  105 (159)
                            +..|.|..|++.|.+...|+.|+-.|+...
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence                  123899999999999999999998888544


No 21 
>KOG3993|consensus
Probab=98.60  E-value=3.3e-08  Score=72.79  Aligned_cols=102  Identities=29%  Similarity=0.622  Sum_probs=77.4

Q ss_pred             CCCHHHHHHHHHhh-CCCcccCCCCcccCCCHHHHHHHHHhcCC---------------------------------CCc
Q psy16923          5 FKTKYRLKLHLDTH-GETPYGCPHCPMKLNTRRTLRMHLVVHRD---------------------------------TKA   50 (159)
Q Consensus         5 f~~~~~l~~H~~~h-~~~~~~C~~C~~~f~~~~~l~~H~~~h~~---------------------------------~~~   50 (159)
                      |-+.-.|.+|.-.- -..-|.|++|+++|....+|..|+|.|..                                 ..-
T Consensus       277 YeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi  356 (500)
T KOG3993|consen  277 YEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGI  356 (500)
T ss_pred             hhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCce
Confidence            44445566665221 12349999999999999999999988831                                 112


Q ss_pred             eeccccccccCCHHhHHhHHhhcCCC------------------------------------------------------
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGK------------------------------------------------------   76 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~------------------------------------------------------   76 (159)
                      |.|..|++.|.+...|..|+..|...                                                      
T Consensus       357 ~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~  436 (500)
T KOG3993|consen  357 FSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYD  436 (500)
T ss_pred             eecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCCCCC
Confidence            88999999999999999997765311                                                      


Q ss_pred             --------------------CCcccccCcccccCchhHHHhHHhhCCchh
Q psy16923         77 --------------------RPYTCPWCSRTFANGSNCRSHKRRMHPEEL  106 (159)
Q Consensus        77 --------------------~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  106 (159)
                                          ..|.|.+|.-.|.+..+|.+|....|..+.
T Consensus       437 ~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hpse~  486 (500)
T KOG3993|consen  437 GSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHPSEL  486 (500)
T ss_pred             CCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcChHHh
Confidence                                007899999999999999999998887664


No 22 
>PHA00732 hypothetical protein
Probab=98.52  E-value=1.2e-07  Score=55.02  Aligned_cols=48  Identities=29%  Similarity=0.528  Sum_probs=38.2

Q ss_pred             cccCCCCcccCCCHHHHHHHHHh-cCCCCceeccccccccCCHHhHHhHHhhcCC
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVV-HRDTKAYQCVTCGKSFRRSKDLKNHHNLHTG   75 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~   75 (159)
                      ||.|..|++.|.+..+|..|++. |.+   +.|+.|++.|.   .+..|++.+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---ChhhhhcccCC
Confidence            58899999999999999999885 543   47999999987   47778765543


No 23 
>PHA00616 hypothetical protein
Probab=98.49  E-value=5.4e-08  Score=49.39  Aligned_cols=34  Identities=29%  Similarity=0.594  Sum_probs=28.6

Q ss_pred             ceeccccccccCCHHhHHhHHhhcCCCCCccccc
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPW   83 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~   83 (159)
                      ||+|..||+.|.....|..|++.|++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            5788888888888888888888888888887765


No 24 
>PHA00732 hypothetical protein
Probab=98.41  E-value=2.3e-07  Score=53.91  Aligned_cols=47  Identities=26%  Similarity=0.491  Sum_probs=39.2

Q ss_pred             ceeccccccccCCHHhHHhHHhh-cCCCCCcccccCcccccCchhHHHhHHhhC
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNL-HTGKRPYTCPWCSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  102 (159)
                      ||.|..|++.|.+...|..|++. |.+   +.|+.|++.|.   .|..|.++..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---ChhhhhcccC
Confidence            57899999999999999999985 553   68999999997   4788886443


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.26  E-value=1.8e-06  Score=46.54  Aligned_cols=49  Identities=29%  Similarity=0.536  Sum_probs=23.9

Q ss_pred             eeccccccccCCHHhHHhHHhh-cCC-CCCcccccCcccccCchhHHHhHHhhC
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNL-HTG-KRPYTCPWCSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~-h~~-~~~~~C~~C~~~f~~~~~l~~H~~~~h  102 (159)
                      |.|+.|++ ..+...|..|... |.. .+.+.|++|...+.  .+|..|+...|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            45555555 3344555555443 332 23455666555433  25556655544


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.17  E-value=9.2e-07  Score=38.96  Aligned_cols=22  Identities=27%  Similarity=0.748  Sum_probs=14.1

Q ss_pred             ccCCCCcccCCCHHHHHHHHHh
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVV   44 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~   44 (159)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.08  E-value=8.5e-06  Score=43.91  Aligned_cols=50  Identities=26%  Similarity=0.472  Sum_probs=38.8

Q ss_pred             cccCCCCcccCCCHHHHHHHHHh-cCC-CCceeccccccccCCHHhHHhHHhhcC
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVV-HRD-TKAYQCVTCGKSFRRSKDLKNHHNLHT   74 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~-h~~-~~~~~C~~C~~~f~~~~~l~~H~~~h~   74 (159)
                      .|.|+.|++ ..+...|..|... |.. .+.+.|+.|...+.  ..|..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            489999999 5567789999875 544 35689999998644  48999988754


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.05  E-value=2.7e-06  Score=37.44  Aligned_cols=22  Identities=45%  Similarity=1.062  Sum_probs=13.9

Q ss_pred             cccccCcccccCchhHHHhHHh
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRR  100 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~  100 (159)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 29 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.04  E-value=2.8e-06  Score=51.58  Aligned_cols=74  Identities=22%  Similarity=0.407  Sum_probs=22.0

Q ss_pred             cCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhHHHhHHhhC
Q psy16923         24 GCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        24 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  102 (159)
                      .|..|+..|.+...|..|+...++...   . ....+.....+..+.+... ...+.|..|++.|.+...|..|++.++
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~---~-~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI---P-DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             Ccccccccccccccccccccccccccc---c-ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            489999999999999999986554221   1 1112223334444443322 236999999999999999999999654


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.99  E-value=4.6e-06  Score=36.87  Aligned_cols=24  Identities=38%  Similarity=0.902  Sum_probs=14.2

Q ss_pred             cccccCcccccCchhHHHhHHhhC
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h  102 (159)
                      |.|++|++.|.+...|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666554


No 31 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.91  E-value=3.6e-06  Score=60.26  Aligned_cols=51  Identities=29%  Similarity=0.754  Sum_probs=34.3

Q ss_pred             Cceeccc--cccccCCHHhHHhHHhh-c------------------CCCCCcccccCcccccCchhHHHhHH
Q psy16923         49 KAYQCVT--CGKSFRRSKDLKNHHNL-H------------------TGKRPYTCPWCSRTFANGSNCRSHKR   99 (159)
Q Consensus        49 ~~~~C~~--C~~~f~~~~~l~~H~~~-h------------------~~~~~~~C~~C~~~f~~~~~l~~H~~   99 (159)
                      +||+|++  |++.+.+...|+.|+.. |                  ...+||+|.+|+++++.-..|+-|+.
T Consensus       348 KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         348 KPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             ceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            5555554  55555555555555443 2                  23478999999999999989888875


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.91  E-value=7.9e-06  Score=36.05  Aligned_cols=23  Identities=30%  Similarity=0.816  Sum_probs=13.6

Q ss_pred             ccCCCCcccCCCHHHHHHHHHhc
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVVH   45 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~h   45 (159)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666654


No 33 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.89  E-value=6.2e-06  Score=42.85  Aligned_cols=39  Identities=28%  Similarity=0.498  Sum_probs=22.1

Q ss_pred             HHHHHhh--CCCcccCCCCcccCCCHHHHHHHHHhcCCCCc
Q psy16923         12 KLHLDTH--GETPYGCPHCPMKLNTRRTLRMHLVVHRDTKA   50 (159)
Q Consensus        12 ~~H~~~h--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~   50 (159)
                      ..+.+.+  ++.|..|++|+..+.+..+|.+|+..+++.+|
T Consensus        12 ~~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   12 TKKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             ----CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            5555555  57788888888888888888888877666554


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.86  E-value=7.2e-06  Score=37.53  Aligned_cols=24  Identities=29%  Similarity=0.665  Sum_probs=13.8

Q ss_pred             cccCCCCcccCCCHHHHHHHHHhc
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVVH   45 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~h   45 (159)
                      +|.|..|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            355566666666666666665554


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.81  E-value=5.9e-06  Score=59.17  Aligned_cols=53  Identities=32%  Similarity=0.775  Sum_probs=45.6

Q ss_pred             CCCcccCCC--CcccCCCHHHHHHHHHh-c------------------CCCCceeccccccccCCHHhHHhHHh
Q psy16923         19 GETPYGCPH--CPMKLNTRRTLRMHLVV-H------------------RDTKAYQCVTCGKSFRRSKDLKNHHN   71 (159)
Q Consensus        19 ~~~~~~C~~--C~~~f~~~~~l~~H~~~-h------------------~~~~~~~C~~C~~~f~~~~~l~~H~~   71 (159)
                      .+|||+|++  |++.++....|..|+.- |                  ...+||.|.+|++.+.+...|+.|..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            469999987  99999999999999753 3                  12488999999999999999999975


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.79  E-value=1.3e-05  Score=36.67  Aligned_cols=24  Identities=38%  Similarity=0.689  Sum_probs=14.1

Q ss_pred             cccccCcccccCchhHHHhHHhhC
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h  102 (159)
                      |.|..|++.|.+..+|..|++.++
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            556666666666666666665443


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.40  E-value=0.00021  Score=31.81  Aligned_cols=24  Identities=29%  Similarity=0.801  Sum_probs=17.1

Q ss_pred             ccCCCCcccCCCHHHHHHHHHhcC
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVVHR   46 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~h~   46 (159)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            467777777777777777777553


No 38 
>KOG1146|consensus
Probab=97.16  E-value=0.00049  Score=57.96  Aligned_cols=100  Identities=24%  Similarity=0.363  Sum_probs=74.2

Q ss_pred             CCCcccCCCCcccCCCHHHHHHHHHh-cC------------------------CCCceeccccccccCCHHhHHhHHhh-
Q psy16923         19 GETPYGCPHCPMKLNTRRTLRMHLVV-HR------------------------DTKAYQCVTCGKSFRRSKDLKNHHNL-   72 (159)
Q Consensus        19 ~~~~~~C~~C~~~f~~~~~l~~H~~~-h~------------------------~~~~~~C~~C~~~f~~~~~l~~H~~~-   72 (159)
                      ..+.|.|+.|+..|+....|..|||. |.                        +.++|.|..|...+..+..|..|+.. 
T Consensus       462 ~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS~  541 (1406)
T KOG1146|consen  462 FFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQSD  541 (1406)
T ss_pred             ccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHHH
Confidence            35889999999999999999999997 21                        13568999999999999999999773 


Q ss_pred             -cC----------C-------------------------------CCCcccccCcccccCchhHHHhHHhhCCchhhhhh
Q psy16923         73 -HT----------G-------------------------------KRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYE  110 (159)
Q Consensus        73 -h~----------~-------------------------------~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~  110 (159)
                       |.          +                               .-.|.|..|++...-..+|+.|+..-+.-......
T Consensus       542 ~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarnlrihmtss~~s~~p~~~  621 (1406)
T KOG1146|consen  542 LHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARNLRIHMTASPSSSPPSLV  621 (1406)
T ss_pred             hhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhccccccccCCCCCChHHH
Confidence             20          0                               01289999999988899999998765544443333


Q ss_pred             hccccccc
Q psy16923        111 SSLGIVHK  118 (159)
Q Consensus       111 ~~~~~~~~  118 (159)
                      ....+...
T Consensus       622 Lq~~it~~  629 (1406)
T KOG1146|consen  622 LQQNITSS  629 (1406)
T ss_pred             hhhcchhh
Confidence            33333333


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.16  E-value=0.00022  Score=31.53  Aligned_cols=24  Identities=46%  Similarity=0.944  Sum_probs=15.1

Q ss_pred             cccccCcccccCchhHHHhHHhhCC
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMHP  103 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h~  103 (159)
                      |+|..|++... ...|..|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            56777777766 6677777776653


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.08  E-value=0.0004  Score=30.83  Aligned_cols=22  Identities=36%  Similarity=0.845  Sum_probs=17.1

Q ss_pred             cccccCcccccCchhHHHhHHh
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRR  100 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~  100 (159)
                      |.|..|++.|.....|..|++.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHH
Confidence            4677888888888888888774


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.04  E-value=0.00029  Score=31.40  Aligned_cols=20  Identities=30%  Similarity=0.604  Sum_probs=10.1

Q ss_pred             cCCCCcccCCCHHHHHHHHH
Q psy16923         24 GCPHCPMKLNTRRTLRMHLV   43 (159)
Q Consensus        24 ~C~~C~~~f~~~~~l~~H~~   43 (159)
                      .|..|++.|.+...|..|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            44555555555555555544


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.99  E-value=0.00086  Score=34.98  Aligned_cols=30  Identities=30%  Similarity=0.571  Sum_probs=17.3

Q ss_pred             CCCCcccccCcccccCchhHHHhHHhhCCc
Q psy16923         75 GKRPYTCPWCSRTFANGSNCRSHKRRMHPE  104 (159)
Q Consensus        75 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  104 (159)
                      .+.|..|++|+..+....+|++|++..|..
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            455667777777777777777777766654


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=96.94  E-value=0.0006  Score=45.08  Aligned_cols=39  Identities=23%  Similarity=0.625  Sum_probs=32.2

Q ss_pred             CceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCc
Q psy16923         49 KAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANG   91 (159)
Q Consensus        49 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~   91 (159)
                      -+|.|. |+.   ....+.+|.+.|.++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            368998 987   566788999999999999999999887654


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.93  E-value=0.00066  Score=30.17  Aligned_cols=21  Identities=33%  Similarity=0.771  Sum_probs=11.2

Q ss_pred             eeccccccccCCHHhHHhHHh
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHN   71 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~   71 (159)
                      |.|..|+..|.+...+..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            345555555555555555554


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.88  E-value=0.00057  Score=30.14  Aligned_cols=22  Identities=41%  Similarity=0.961  Sum_probs=12.9

Q ss_pred             ccCCCCcccCCCHHHHHHHHHhc
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVVH   45 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~h   45 (159)
                      |.|+.|+.... ...|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            45666776666 66677676654


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.77  E-value=0.00072  Score=44.69  Aligned_cols=37  Identities=35%  Similarity=0.756  Sum_probs=27.3

Q ss_pred             cccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCC
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRR   62 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~   62 (159)
                      +|.|. |+.   ....+..|.++|.++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            47787 776   55667778888888888888888776654


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.52  E-value=0.00068  Score=30.84  Aligned_cols=21  Identities=19%  Similarity=0.577  Sum_probs=10.7

Q ss_pred             ccCCCCcccCCCHHHHHHHHH
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLV   43 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~   43 (159)
                      |.|..|++.|.+...+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            445555555555555555543


No 48 
>KOG4173|consensus
Probab=96.48  E-value=0.0012  Score=44.69  Aligned_cols=80  Identities=23%  Similarity=0.499  Sum_probs=65.5

Q ss_pred             CcccCCC--CcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhh-c---------CCCCCccccc--Ccc
Q psy16923         21 TPYGCPH--CPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNL-H---------TGKRPYTCPW--CSR   86 (159)
Q Consensus        21 ~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-h---------~~~~~~~C~~--C~~   86 (159)
                      ..+.|+.  |.+.|........|..+-++.   .|.+|.+.|.+...|..|+.. |         .|.--|.|-+  |+.
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~  154 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE  154 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence            4577987  889999999999998775554   699999999999999999774 3         2334588844  999


Q ss_pred             cccCchhHHHhHHhhCC
Q psy16923         87 TFANGSNCRSHKRRMHP  103 (159)
Q Consensus        87 ~f~~~~~l~~H~~~~h~  103 (159)
                      .|.+..+.+.|+-..|.
T Consensus       155 KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  155 KFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhhhHHHHhcc
Confidence            99999999999988883


No 49 
>KOG1146|consensus
Probab=96.42  E-value=0.0028  Score=53.71  Aligned_cols=76  Identities=24%  Similarity=0.427  Sum_probs=60.4

Q ss_pred             CCCCcccCCCHHHHHHHHHh-cCCCCceeccccccccCCHHhHHhHHhh-c------------------------CCCCC
Q psy16923         25 CPHCPMKLNTRRTLRMHLVV-HRDTKAYQCVTCGKSFRRSKDLKNHHNL-H------------------------TGKRP   78 (159)
Q Consensus        25 C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~-h------------------------~~~~~   78 (159)
                      |..|+..+.++..+..|+.. +...+-+.|+.|+..|.....|-.|+|. |                        .+.++
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p  518 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP  518 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc
Confidence            44566666677767777653 5566889999999999999999999997 2                        12256


Q ss_pred             cccccCcccccCchhHHHhHHh
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRR  100 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~  100 (159)
                      |.|..|...+....+|..|++.
T Consensus       519 ~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  519 YPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccceeeeeeeecchHHHHHHHH
Confidence            8999999999999999999873


No 50 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.41  E-value=0.0013  Score=29.90  Aligned_cols=21  Identities=19%  Similarity=0.662  Sum_probs=13.1

Q ss_pred             cccccCcccccCchhHHHhHH
Q psy16923         79 YTCPWCSRTFANGSNCRSHKR   99 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~   99 (159)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666666654


No 51 
>KOG2482|consensus
Probab=96.20  E-value=0.015  Score=42.67  Aligned_cols=28  Identities=21%  Similarity=0.433  Sum_probs=23.7

Q ss_pred             cccccCcccccCchhHHHhHHhhCCchh
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMHPEEL  106 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~  106 (159)
                      .+|-.|.....+...|..||..+|.-..
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl  307 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDL  307 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhH
Confidence            4899999988889999999999995443


No 52 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.01  E-value=0.0062  Score=36.59  Aligned_cols=65  Identities=23%  Similarity=0.320  Sum_probs=21.6

Q ss_pred             CCCCHHHHHHHHHh-hCCCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhc
Q psy16923          4 RFKTKYRLKLHLDT-HGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLH   73 (159)
Q Consensus         4 ~f~~~~~l~~H~~~-h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h   73 (159)
                      .|.+...|..|+.. |+-..-    ....+.....+..+.+... ...+.|..|++.|.+...|..|++.+
T Consensus         8 ~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    8 SFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ----------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccc----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            46778889999955 632111    1111223334444444322 23689999999999999999999974


No 53 
>KOG2893|consensus
Probab=95.88  E-value=0.0027  Score=44.14  Aligned_cols=49  Identities=24%  Similarity=0.559  Sum_probs=31.4

Q ss_pred             eccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhHHHhHHhhCCc
Q psy16923         52 QCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPE  104 (159)
Q Consensus        52 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  104 (159)
                      .|=.|++.|.....|.+|++.    +.|+|.+|-+..-+...|..|--.+|.+
T Consensus        12 wcwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvhke   60 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVHKE   60 (341)
T ss_pred             eeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhhhh
Confidence            356677777777777777663    2377777777666666666665545533


No 54 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.56  E-value=0.014  Score=25.95  Aligned_cols=20  Identities=30%  Similarity=0.521  Sum_probs=14.2

Q ss_pred             ccCCCCcccCCCHHHHHHHHH
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLV   43 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~   43 (159)
                      ..|+.|++.| ..+.|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4688888888 5556777765


No 55 
>KOG2482|consensus
Probab=95.23  E-value=0.022  Score=41.75  Aligned_cols=78  Identities=21%  Similarity=0.388  Sum_probs=60.9

Q ss_pred             ccCCCCcccCCCHHHHHHHHHh--cCCCCc--------------------------------------------------
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVV--HRDTKA--------------------------------------------------   50 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~--h~~~~~--------------------------------------------------   50 (159)
                      +.|-.|.+.|+.+..|..||+.  |..-.|                                                  
T Consensus       196 ~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a  275 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDA  275 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCC
Confidence            7899999999999999999986  422111                                                  


Q ss_pred             ----eeccccccccCCHHhHHhHHhh-cCCC--------------------------CCcccccCcccccCchhHHHhHH
Q psy16923         51 ----YQCVTCGKSFRRSKDLKNHHNL-HTGK--------------------------RPYTCPWCSRTFANGSNCRSHKR   99 (159)
Q Consensus        51 ----~~C~~C~~~f~~~~~l~~H~~~-h~~~--------------------------~~~~C~~C~~~f~~~~~l~~H~~   99 (159)
                          ..|-.|.....+...|..||+. |.-.                          +.-.|-.|.-.|.....|..|+.
T Consensus       276 ~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~  355 (423)
T KOG2482|consen  276 EALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMV  355 (423)
T ss_pred             CccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcc
Confidence                3799999988889999999985 4110                          11357789999999999999986


Q ss_pred             h
Q psy16923        100 R  100 (159)
Q Consensus       100 ~  100 (159)
                      .
T Consensus       356 e  356 (423)
T KOG2482|consen  356 E  356 (423)
T ss_pred             c
Confidence            3


No 56 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.10  E-value=0.022  Score=27.32  Aligned_cols=23  Identities=17%  Similarity=0.426  Sum_probs=16.6

Q ss_pred             cccCCCCcccCCCHHHHHHHHHh
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVV   44 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~   44 (159)
                      +|.|..|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46677777777777777777653


No 57 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.32  E-value=0.012  Score=44.48  Aligned_cols=63  Identities=32%  Similarity=0.549  Sum_probs=50.6

Q ss_pred             CcccCCCCcccCCCHHHHHHHHH--hcCCC--Cceecc--ccccccCCHHhHHhHHhhcCCCCCccccc
Q psy16923         21 TPYGCPHCPMKLNTRRTLRMHLV--VHRDT--KAYQCV--TCGKSFRRSKDLKNHHNLHTGKRPYTCPW   83 (159)
Q Consensus        21 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~   83 (159)
                      .++.|..|...|.....|..|.+  .|.++  +++.|.  .|++.|.+...+..|...|.+..++.+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  356 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKL  356 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccccc
Confidence            46788888888888888888888  68888  888888  68888888888888888888777666644


No 58 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.15  E-value=0.048  Score=26.06  Aligned_cols=22  Identities=18%  Similarity=0.558  Sum_probs=13.6

Q ss_pred             ceeccccccccCCHHhHHhHHh
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHN   71 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~   71 (159)
                      +|.|..|+..|.+...+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            3556666666666666666654


No 59 
>KOG2231|consensus
Probab=94.14  E-value=0.13  Score=41.54  Aligned_cols=21  Identities=24%  Similarity=0.539  Sum_probs=9.8

Q ss_pred             eccccccccCCHHhHHhHHhh
Q psy16923         52 QCVTCGKSFRRSKDLKNHHNL   72 (159)
Q Consensus        52 ~C~~C~~~f~~~~~l~~H~~~   72 (159)
                      .|..|...|.....|..|++.
T Consensus       184 ~C~~C~~~fld~~el~rH~~~  204 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRF  204 (669)
T ss_pred             cchhhhhhhccHHHHHHhhcc
Confidence            344444444444444444443


No 60 
>KOG2231|consensus
Probab=94.06  E-value=0.098  Score=42.12  Aligned_cols=86  Identities=21%  Similarity=0.392  Sum_probs=55.4

Q ss_pred             CCHHHHHHHHHhh--CCCc----ccCCCCcccCCCHHHHHHHHHhcCCCCceecccc------ccccCCHHhHHhHHhhc
Q psy16923          6 KTKYRLKLHLDTH--GETP----YGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTC------GKSFRRSKDLKNHHNLH   73 (159)
Q Consensus         6 ~~~~~l~~H~~~h--~~~~----~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~~h   73 (159)
                      =++..|.+|++.-  .++-    -.|..|...|....+|..|++.++    |.|..|      +.-|..-+.|..|.+.+
T Consensus       160 Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~  235 (669)
T KOG2231|consen  160 YTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKG  235 (669)
T ss_pred             ehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhc
Confidence            3456677777664  1211    358889999999999999988654    456666      34566668999999876


Q ss_pred             CCCCCcccc--cCc-ccccCchhHHHhHH
Q psy16923         74 TGKRPYTCP--WCS-RTFANGSNCRSHKR   99 (159)
Q Consensus        74 ~~~~~~~C~--~C~-~~f~~~~~l~~H~~   99 (159)
                      +    |.|.  .|. +.|.....+..+++
T Consensus       236 H----flCE~~~C~~~~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  236 H----FLCEEEFCRTKKFYVAFELEIELK  260 (669)
T ss_pred             C----ccccccccccceeeehhHHHHHHH
Confidence            5    5665  353 34444434444444


No 61 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.05  E-value=0.032  Score=26.57  Aligned_cols=10  Identities=40%  Similarity=1.295  Sum_probs=5.3

Q ss_pred             CCcccccCcc
Q psy16923         77 RPYTCPWCSR   86 (159)
Q Consensus        77 ~~~~C~~C~~   86 (159)
                      .++.|+.|+.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4455666553


No 62 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.71  E-value=0.16  Score=31.30  Aligned_cols=83  Identities=20%  Similarity=0.307  Sum_probs=46.5

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHh-cCCCCceeccccccccCCHHhHHh---HHhh-cCC---------CCCccc----
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVV-HRDTKAYQCVTCGKSFRRSKDLKN---HHNL-HTG---------KRPYTC----   81 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~---H~~~-h~~---------~~~~~C----   81 (159)
                      -+...|..|+.+... .++..|++. |+......-..-...+.....|..   .+.. ...         ...|.|    
T Consensus         9 ~~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~   87 (109)
T PF12013_consen    9 YRVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDP   87 (109)
T ss_pred             CCEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCC
Confidence            355679999988776 779999985 432211100000000000000000   0000 000         123899    


Q ss_pred             ccCcccccCchhHHHhHHhhCC
Q psy16923         82 PWCSRTFANGSNCRSHKRRMHP  103 (159)
Q Consensus        82 ~~C~~~f~~~~~l~~H~~~~h~  103 (159)
                      ..|++.+.+...+..|.+.+|+
T Consensus        88 ~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   88 PHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCCcEeccHHHHHHHHHHhcC
Confidence            9999999999999999998884


No 63 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.19  E-value=0.038  Score=29.39  Aligned_cols=26  Identities=31%  Similarity=0.600  Sum_probs=18.7

Q ss_pred             CCCcccCCCCcccCCCHHHHHHHHHh
Q psy16923         19 GETPYGCPHCPMKLNTRRTLRMHLVV   44 (159)
Q Consensus        19 ~~~~~~C~~C~~~f~~~~~l~~H~~~   44 (159)
                      +|..+.|+.|+..|....++.+|...
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhH
Confidence            56667777777777777777777654


No 64 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.07  E-value=0.19  Score=30.99  Aligned_cols=22  Identities=14%  Similarity=0.409  Sum_probs=12.2

Q ss_pred             ceeccccccccCCHHhHHhHHhh
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNL   72 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~   72 (159)
                      ...|..|..+..- +.+..|++.
T Consensus        11 vlIC~~C~~av~~-~~v~~HL~~   32 (109)
T PF12013_consen   11 VLICRQCQYAVQP-SEVESHLRK   32 (109)
T ss_pred             EEEeCCCCcccCc-hHHHHHHHH
Confidence            3456666655433 566666663


No 65 
>KOG2186|consensus
Probab=92.38  E-value=0.086  Score=37.16  Aligned_cols=47  Identities=28%  Similarity=0.687  Sum_probs=32.9

Q ss_pred             cccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHh
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHN   71 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   71 (159)
                      -|.|..||...+-.. +..|+..-++ ..|.|..|+..|.+ .....|..
T Consensus         3 ~FtCnvCgEsvKKp~-vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKKPQ-VEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhccccc-hHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            367888887776554 7778776655 56788888888877 55566644


No 66 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=92.24  E-value=0.11  Score=38.36  Aligned_cols=47  Identities=26%  Similarity=0.539  Sum_probs=36.3

Q ss_pred             eccccccccCCHHhHHhHHhhcCCCCCcccccCcc-------cccCchhHHHhHHhhC
Q psy16923         52 QCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSR-------TFANGSNCRSHKRRMH  102 (159)
Q Consensus        52 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~-------~f~~~~~l~~H~~~~h  102 (159)
                      .|..|..-|.+-+.|..|+|..+    -.|-+|++       .|.+..+|..|.+..|
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H----E~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h  275 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH----EACHICDMVGPIRYQYFKSYEDLEAHFRNAH  275 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh----hhhhhhhccCccchhhhhCHHHHHHHhhcCc
Confidence            69999999999999999998744    24445543       4788888999988666


No 67 
>KOG2893|consensus
Probab=92.13  E-value=0.048  Score=38.13  Aligned_cols=44  Identities=23%  Similarity=0.411  Sum_probs=37.1

Q ss_pred             cCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHh
Q psy16923         24 GCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHN   71 (159)
Q Consensus        24 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   71 (159)
                      .|-.|++.|....-|.+|++.    +.|+|-.|-+.+.+--.|..|..
T Consensus        12 wcwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcm   55 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCM   55 (341)
T ss_pred             eeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehh
Confidence            488999999999999999885    55899999998888777777744


No 68 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=90.88  E-value=0.84  Score=33.96  Aligned_cols=92  Identities=23%  Similarity=0.410  Sum_probs=61.1

Q ss_pred             HHHHHHHHhh-CC----CcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccc----cccCCHHhHHhHHhhcCCCCCc
Q psy16923          9 YRLKLHLDTH-GE----TPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCG----KSFRRSKDLKNHHNLHTGKRPY   79 (159)
Q Consensus         9 ~~l~~H~~~h-~~----~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~----~~f~~~~~l~~H~~~h~~~~~~   79 (159)
                      ..|+.|...- .+    .--.|..|+..|=....|..|+|..+. +-+.|+.-+    .-|.+-..|..|.+.-+    |
T Consensus       202 ~~Lr~H~~~G~~e~GFKGHP~C~FC~~~FYdDDEL~~HcR~~HE-~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y  276 (493)
T COG5236         202 STLRDHKNGGLEEEGFKGHPLCIFCKIYFYDDDELRRHCRLRHE-ACHICDMVGPIRYQYFKSYEDLEAHFRNAH----Y  276 (493)
T ss_pred             ccccccccCCccccCcCCCchhhhccceecChHHHHHHHHhhhh-hhhhhhccCccchhhhhCHHHHHHHhhcCc----e
Confidence            4566666443 22    234599999999999999999997543 333443322    24666778888887533    5


Q ss_pred             cccc--Cc----ccccCchhHHHhHHhhCCch
Q psy16923         80 TCPW--CS----RTFANGSNCRSHKRRMHPEE  105 (159)
Q Consensus        80 ~C~~--C~----~~f~~~~~l~~H~~~~h~~~  105 (159)
                      .|..  |.    ..|.....|..|+-.-|+..
T Consensus       277 ~ct~qtc~~~k~~vf~~~~el~~h~~~~h~~~  308 (493)
T COG5236         277 CCTFQTCRVGKCYVFPYHTELLEHLTRFHKVN  308 (493)
T ss_pred             EEEEEEEecCcEEEeccHHHHHHHHHHHhhcc
Confidence            5543  32    46889999999998777543


No 69 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.71  E-value=0.11  Score=27.73  Aligned_cols=29  Identities=24%  Similarity=0.550  Sum_probs=18.1

Q ss_pred             CCCCcccccCcccccCchhHHHhHHhhCC
Q psy16923         75 GKRPYTCPWCSRTFANGSNCRSHKRRMHP  103 (159)
Q Consensus        75 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  103 (159)
                      |+.-+.|+.|+..|....+..+|....|+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            44456666666666666666666665553


No 70 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=90.64  E-value=0.29  Score=32.40  Aligned_cols=18  Identities=11%  Similarity=0.393  Sum_probs=9.1

Q ss_pred             CcccCCCCcccCCCHHHH
Q psy16923         21 TPYGCPHCPMKLNTRRTL   38 (159)
Q Consensus        21 ~~~~C~~C~~~f~~~~~l   38 (159)
                      .-|.|+.|+..|....++
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             CeEECCCCCcEeeHHHHH
Confidence            345555555555555444


No 71 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=90.39  E-value=0.065  Score=37.34  Aligned_cols=13  Identities=23%  Similarity=0.733  Sum_probs=10.2

Q ss_pred             cccccCcccccCc
Q psy16923         79 YTCPWCSRTFANG   91 (159)
Q Consensus        79 ~~C~~C~~~f~~~   91 (159)
                      +.|+.||.++...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            5899999987654


No 72 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.20  E-value=0.08  Score=40.07  Aligned_cols=57  Identities=26%  Similarity=0.574  Sum_probs=51.1

Q ss_pred             CceeccccccccCCHHhHHhHHh--hcCCC--CCcccc--cCcccccCchhHHHhHHhhCCch
Q psy16923         49 KAYQCVTCGKSFRRSKDLKNHHN--LHTGK--RPYTCP--WCSRTFANGSNCRSHKRRMHPEE  105 (159)
Q Consensus        49 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~  105 (159)
                      .++.|..|...|.....+..|.+  .|.++  +++.|+  .|++.|.+...+..|...+....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  350 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSIS  350 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCC
Confidence            36789999999999999999999  79999  999999  79999999999999998766443


No 73 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.95  E-value=0.14  Score=31.65  Aligned_cols=30  Identities=33%  Similarity=0.811  Sum_probs=23.6

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCc
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANG   91 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~   91 (159)
                      ..|+.||+.|...           +..|..|++||..|...
T Consensus        10 R~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            4799999988773           23678899999988766


No 74 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.75  E-value=0.2  Score=24.02  Aligned_cols=10  Identities=30%  Similarity=0.879  Sum_probs=5.8

Q ss_pred             eecccccccc
Q psy16923         51 YQCVTCGKSF   60 (159)
Q Consensus        51 ~~C~~C~~~f   60 (159)
                      |.|..||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            5666666543


No 75 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.15  E-value=0.28  Score=23.96  Aligned_cols=13  Identities=23%  Similarity=0.864  Sum_probs=6.3

Q ss_pred             cCCCCcccCCCHH
Q psy16923         24 GCPHCPMKLNTRR   36 (159)
Q Consensus        24 ~C~~C~~~f~~~~   36 (159)
                      .|+.|+..|.-..
T Consensus         4 ~CP~C~~~f~v~~   16 (37)
T PF13719_consen    4 TCPNCQTRFRVPD   16 (37)
T ss_pred             ECCCCCceEEcCH
Confidence            4555555554333


No 76 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=88.68  E-value=0.31  Score=32.49  Aligned_cols=24  Identities=38%  Similarity=1.061  Sum_probs=18.4

Q ss_pred             ceeccccccccCCHHhHHhHHhhcCCCCCcccccCcc
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSR   86 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   86 (159)
                      .|.|.+||..             +.++.|.+|++||-
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            5899999754             44577889999983


No 77 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=88.55  E-value=0.65  Score=28.79  Aligned_cols=81  Identities=21%  Similarity=0.326  Sum_probs=51.0

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhcCCCCc------------eeccccccccCCHHhHHhHHhhcCCCCCcccccCccc
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVHRDTKA------------YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRT   87 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~------------~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   87 (159)
                      +-|-.|+.|+...-....|.+...---.-++            -.|..|...|........-  .-.....|.|+.|...
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~--~~~~~~~y~C~~C~~~   90 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFD--ELKDSHRYVCAVCKNV   90 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCccccccc--ccccccceeCCCCCCc
Confidence            5688999999988888888764221111111            2488899888764311100  0122345899999999


Q ss_pred             ccCchhHHHhHHhhC
Q psy16923         88 FANGSNCRSHKRRMH  102 (159)
Q Consensus        88 f~~~~~l~~H~~~~h  102 (159)
                      |=..-+.-.|...|.
T Consensus        91 FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        91 FCVDCDVFVHESLHC  105 (112)
T ss_pred             cccccchhhhhhccC
Confidence            887777777766543


No 78 
>KOG2785|consensus
Probab=88.26  E-value=0.7  Score=34.72  Aligned_cols=28  Identities=18%  Similarity=0.288  Sum_probs=23.7

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhcCC
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVHRD   47 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~   47 (159)
                      ..|-.|-.|+..+++...-..||..+++
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~Hg  191 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHG  191 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccC
Confidence            3457799999999999999999988776


No 79 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=88.16  E-value=0.48  Score=32.06  Aligned_cols=16  Identities=19%  Similarity=0.484  Sum_probs=7.8

Q ss_pred             ceeccccccccCCHHh
Q psy16923         50 AYQCVTCGKSFRRSKD   65 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~   65 (159)
                      -|.|+.|+..|.....
T Consensus       117 ~Y~Cp~C~~rytf~eA  132 (178)
T PRK06266        117 FFFCPNCHIRFTFDEA  132 (178)
T ss_pred             EEECCCCCcEEeHHHH
Confidence            3555555555444443


No 80 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=87.99  E-value=0.44  Score=23.12  Aligned_cols=13  Identities=31%  Similarity=0.838  Sum_probs=6.5

Q ss_pred             cCCCCcccCCCHH
Q psy16923         24 GCPHCPMKLNTRR   36 (159)
Q Consensus        24 ~C~~C~~~f~~~~   36 (159)
                      .|+.|+..|.-.+
T Consensus         4 ~Cp~C~~~y~i~d   16 (36)
T PF13717_consen    4 TCPNCQAKYEIDD   16 (36)
T ss_pred             ECCCCCCEEeCCH
Confidence            4555555554443


No 81 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=87.26  E-value=0.78  Score=32.45  Aligned_cols=25  Identities=20%  Similarity=0.542  Sum_probs=17.9

Q ss_pred             CCHHHHHHHHHhh-C-----CCcccCCCCcc
Q psy16923          6 KTKYRLKLHLDTH-G-----ETPYGCPHCPM   30 (159)
Q Consensus         6 ~~~~~l~~H~~~h-~-----~~~~~C~~C~~   30 (159)
                      .+..+|+...+++ .     .+.|.|..|+.
T Consensus        90 LTe~Nlrm~d~a~~~~ip~~drqFaC~~Cd~  120 (278)
T PF15135_consen   90 LTEENLRMFDDAQENLIPSVDRQFACSSCDH  120 (278)
T ss_pred             chHHHHHHhhhhhhccccccceeeeccccch
Confidence            3556777777776 2     47899999964


No 82 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=86.74  E-value=0.47  Score=23.13  Aligned_cols=10  Identities=30%  Similarity=1.065  Sum_probs=4.5

Q ss_pred             cCCCCcccCC
Q psy16923         24 GCPHCPMKLN   33 (159)
Q Consensus        24 ~C~~C~~~f~   33 (159)
                      .|+.|+..|.
T Consensus         4 ~CP~C~~~~~   13 (38)
T TIGR02098         4 QCPNCKTSFR   13 (38)
T ss_pred             ECCCCCCEEE
Confidence            4444444443


No 83 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=86.44  E-value=0.095  Score=36.52  Aligned_cols=44  Identities=18%  Similarity=0.476  Sum_probs=29.0

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhc----------CCCCc-----eeccccccccCCH
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVH----------RDTKA-----YQCVTCGKSFRRS   63 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h----------~~~~~-----~~C~~C~~~f~~~   63 (159)
                      ++...|+.|+..|.++.-.....+.-          .+..|     +.|+.||..+...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            46789999999998876444443321          11122     6899999877654


No 84 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=86.30  E-value=1.1  Score=29.25  Aligned_cols=16  Identities=31%  Similarity=0.710  Sum_probs=8.6

Q ss_pred             CcccCCCCcccCCCHH
Q psy16923         21 TPYGCPHCPMKLNTRR   36 (159)
Q Consensus        21 ~~~~C~~C~~~f~~~~   36 (159)
                      .-|.|+.|+..|....
T Consensus        98 ~~Y~Cp~C~~~y~~~e  113 (147)
T smart00531       98 AYYKCPNCQSKYTFLE  113 (147)
T ss_pred             cEEECcCCCCEeeHHH
Confidence            3455666665555433


No 85 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=85.83  E-value=0.58  Score=23.66  Aligned_cols=26  Identities=23%  Similarity=0.623  Sum_probs=14.0

Q ss_pred             CCcccccCcccccC----chhHHHhHHhhC
Q psy16923         77 RPYTCPWCSRTFAN----GSNCRSHKRRMH  102 (159)
Q Consensus        77 ~~~~C~~C~~~f~~----~~~l~~H~~~~h  102 (159)
                      ....|..|++.+..    .+.|..|++..|
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            34577777766544    367777775443


No 86 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=85.53  E-value=1.3  Score=29.39  Aligned_cols=35  Identities=17%  Similarity=0.488  Sum_probs=27.4

Q ss_pred             CCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCccccc
Q psy16923         46 RDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFA   89 (159)
Q Consensus        46 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   89 (159)
                      ....-|.|+.|+..|....++.         ..|.|+.||....
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLD  139 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEee
Confidence            3456699999999998888874         2599999997643


No 87 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=84.29  E-value=0.71  Score=23.54  Aligned_cols=11  Identities=36%  Similarity=0.978  Sum_probs=6.0

Q ss_pred             eeccccccccC
Q psy16923         51 YQCVTCGKSFR   61 (159)
Q Consensus        51 ~~C~~C~~~f~   61 (159)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            45666665543


No 88 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=83.68  E-value=0.91  Score=23.68  Aligned_cols=24  Identities=38%  Similarity=0.809  Sum_probs=15.4

Q ss_pred             cccccCcccccCc-----hhHHHhHHhhC
Q psy16923         79 YTCPWCSRTFANG-----SNCRSHKRRMH  102 (159)
Q Consensus        79 ~~C~~C~~~f~~~-----~~l~~H~~~~h  102 (159)
                      -.|..|++.+...     +.|.+|++..|
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            4677777666443     57777777444


No 89 
>KOG2186|consensus
Probab=83.11  E-value=1  Score=32.02  Aligned_cols=50  Identities=20%  Similarity=0.589  Sum_probs=39.0

Q ss_pred             ceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhHHHhHHhhC
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  102 (159)
                      -|.|..||....- ..+..|+...++ .-|.|--|++.|.. .....|.....
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcc
Confidence            3789999987655 456679887766 55999999999988 56688887554


No 90 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.06  E-value=0.6  Score=29.52  Aligned_cols=34  Identities=21%  Similarity=0.468  Sum_probs=24.6

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhHH
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCR   95 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~   95 (159)
                      ..|+.||+.|...           +..|..|++||..|.....++
T Consensus        10 r~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~~~~~   43 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPEEALK   43 (129)
T ss_pred             ccCCCcCcccccc-----------CCCCccCCCcCCccCcchhhc
Confidence            4799999888763           236789999998876664443


No 91 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=82.83  E-value=0.83  Score=26.85  Aligned_cols=11  Identities=36%  Similarity=1.186  Sum_probs=5.3

Q ss_pred             ceecccccccc
Q psy16923         50 AYQCVTCGKSF   60 (159)
Q Consensus        50 ~~~C~~C~~~f   60 (159)
                      -|.|..|+..|
T Consensus        53 IW~C~kCg~~f   63 (89)
T COG1997          53 IWKCRKCGAKF   63 (89)
T ss_pred             eEEcCCCCCee
Confidence            34555555444


No 92 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=82.33  E-value=0.79  Score=31.93  Aligned_cols=32  Identities=28%  Similarity=0.669  Sum_probs=24.1

Q ss_pred             CCCcccccCcccccCchhHHHhHHhhCCchhh
Q psy16923         76 KRPYTCPWCSRTFANGSNCRSHKRRMHPEELK  107 (159)
Q Consensus        76 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  107 (159)
                      +..|.|+.|+|.|.-..-..+|+...|.+...
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~ve  106 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPEKVE  106 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HHHHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHHHHH
Confidence            34589999999999999999999999977653


No 93 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=81.80  E-value=1.3  Score=24.00  Aligned_cols=50  Identities=22%  Similarity=0.523  Sum_probs=27.7

Q ss_pred             cccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcc
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSR   86 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   86 (159)
                      +-.|..|+....-          -.+...|.|+.||........     +--....+|.|+.||.
T Consensus         9 ~~~CtSCg~~i~p----------~e~~v~F~CPnCGe~~I~Rc~-----~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888           9 PPVCTSCGREIAP----------GETAVKFPCPNCGEVEIYRCA-----KCRKLGNPYRCPKCGF   58 (61)
T ss_pred             CceeccCCCEecc----------CCceeEeeCCCCCceeeehhh-----hHHHcCCceECCCcCc
Confidence            4467777755311          112245789999855433222     1112246799999885


No 94 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=81.50  E-value=1.9  Score=29.14  Aligned_cols=33  Identities=18%  Similarity=0.722  Sum_probs=26.1

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccC
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFR   61 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   61 (159)
                      ..-|.|+.|+..|....++.         ..|.|+.||....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            46799999999998888764         3689999997544


No 95 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=79.42  E-value=2.4  Score=18.87  Aligned_cols=19  Identities=26%  Similarity=0.586  Sum_probs=11.5

Q ss_pred             cCCCCcccCCCHHHHHHHHH
Q psy16923         24 GCPHCPMKLNTRRTLRMHLV   43 (159)
Q Consensus        24 ~C~~C~~~f~~~~~l~~H~~   43 (159)
                      .|++|++.+ ....+..|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777776 4455556654


No 96 
>PF12907 zf-met2:  Zinc-binding
Probab=78.44  E-value=1.4  Score=21.93  Aligned_cols=27  Identities=30%  Similarity=0.701  Sum_probs=18.1

Q ss_pred             cccccCcccc---cCchhHHHhHHhhCCch
Q psy16923         79 YTCPWCSRTF---ANGSNCRSHKRRMHPEE  105 (159)
Q Consensus        79 ~~C~~C~~~f---~~~~~l~~H~~~~h~~~  105 (159)
                      +.|.+|...|   .+...|..|....|++.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            5677777444   45567888887777664


No 97 
>KOG4377|consensus
Probab=78.13  E-value=2.2  Score=32.50  Aligned_cols=98  Identities=23%  Similarity=0.415  Sum_probs=56.0

Q ss_pred             CCCCCCHHHHHHHHHhh--CC-----------CcccC--CCCcccCCCHHHHHHHHHhcCCC-------Cceeccccccc
Q psy16923          2 FSRFKTKYRLKLHLDTH--GE-----------TPYGC--PHCPMKLNTRRTLRMHLVVHRDT-------KAYQCVTCGKS   59 (159)
Q Consensus         2 ~~~f~~~~~l~~H~~~h--~~-----------~~~~C--~~C~~~f~~~~~l~~H~~~h~~~-------~~~~C~~C~~~   59 (159)
                      |.++.++....+|...|  .+           ..|.|  ..|++   +-++...|..-|+..       ..|.|..|+-+
T Consensus       280 ~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~GfrrthfhC~r~gCT  356 (480)
T KOG4377|consen  280 FYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTHFHCQRIGCT  356 (480)
T ss_pred             cccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceecceeEEeccCCc
Confidence            34555588899999888  11           22556  35877   334555565555421       34678887743


Q ss_pred             cCCH--HhHHhHHhhcCCCC------------------------Cccccc--CcccccCchhHHHhHHhhC
Q psy16923         60 FRRS--KDLKNHHNLHTGKR------------------------PYTCPW--CSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        60 f~~~--~~l~~H~~~h~~~~------------------------~~~C~~--C~~~f~~~~~l~~H~~~~h  102 (159)
                      +..+  ..-..|.+.+.++.                        .+.|..  |+..+.+.+++..|.+.|-
T Consensus       357 dtfK~~khk~yh~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~shkrkhe  427 (480)
T KOG4377|consen  357 DTFKDSKHKPYHYKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQMASHKRKHE  427 (480)
T ss_pred             cccccccccccccCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhhhhhhhhhhh
Confidence            3333  22223333222211                        134544  8888889999999988653


No 98 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=77.81  E-value=2.2  Score=22.85  Aligned_cols=40  Identities=28%  Similarity=0.719  Sum_probs=20.1

Q ss_pred             Cceeccc--cccccCCHHhHHhHHhhcCCCCCccccc----Cccccc
Q psy16923         49 KAYQCVT--CGKSFRRSKDLKNHHNLHTGKRPYTCPW----CSRTFA   89 (159)
Q Consensus        49 ~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~   89 (159)
                      .+..|+.  |...+. ...|..|....-..++..|..    |+..+.
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            3456666  444333 356777777555556667777    666554


No 99 
>KOG4173|consensus
Probab=77.72  E-value=1.2  Score=30.58  Aligned_cols=50  Identities=28%  Similarity=0.648  Sum_probs=40.7

Q ss_pred             ceeccc--cccccCCHHhHHhHHhhcCCCCCcccccCcccccCchhHHHhHHhhC
Q psy16923         50 AYQCVT--CGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        50 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  102 (159)
                      .+.|++  |...|.+.+.+..|...-++   -.|..|.+.|.+..-|..|+-..|
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~H  130 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWH  130 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHH
Confidence            367887  88889988888888765333   489999999999999999987666


No 100
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=77.54  E-value=1.4  Score=22.97  Aligned_cols=11  Identities=36%  Similarity=1.265  Sum_probs=6.7

Q ss_pred             ceecccccccc
Q psy16923         50 AYQCVTCGKSF   60 (159)
Q Consensus        50 ~~~C~~C~~~f   60 (159)
                      .|.|..|++.+
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            45666666655


No 101
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=77.27  E-value=0.69  Score=24.25  Aligned_cols=11  Identities=45%  Similarity=1.431  Sum_probs=5.6

Q ss_pred             eeccccccccC
Q psy16923         51 YQCVTCGKSFR   61 (159)
Q Consensus        51 ~~C~~C~~~f~   61 (159)
                      |.|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            45555555444


No 102
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=76.12  E-value=1.7  Score=22.20  Aligned_cols=10  Identities=40%  Similarity=1.391  Sum_probs=5.2

Q ss_pred             eecccccccc
Q psy16923         51 YQCVTCGKSF   60 (159)
Q Consensus        51 ~~C~~C~~~f   60 (159)
                      |.|..||..+
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            4555555544


No 103
>KOG2785|consensus
Probab=75.80  E-value=3.6  Score=31.08  Aligned_cols=49  Identities=24%  Similarity=0.523  Sum_probs=41.2

Q ss_pred             eccccccccCCHHhHHhHHhhcCCC-----------------------CCcccccCc---ccccCchhHHHhHHh
Q psy16923         52 QCVTCGKSFRRSKDLKNHHNLHTGK-----------------------RPYTCPWCS---RTFANGSNCRSHKRR  100 (159)
Q Consensus        52 ~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~  100 (159)
                      .|..|++.+.+...-..||..++|-                       ..+.|-.|+   +.|.+-.+.+.||..
T Consensus       168 ~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  168 DCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             ceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            5899999999999999999887653                       126788898   899999999999974


No 104
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=75.28  E-value=1.2  Score=22.39  Aligned_cols=12  Identities=42%  Similarity=1.196  Sum_probs=6.7

Q ss_pred             eeccccccccCC
Q psy16923         51 YQCVTCGKSFRR   62 (159)
Q Consensus        51 ~~C~~C~~~f~~   62 (159)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            556666655544


No 105
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=75.23  E-value=0.66  Score=30.61  Aligned_cols=14  Identities=36%  Similarity=0.949  Sum_probs=9.5

Q ss_pred             eeccccccccCCHH
Q psy16923         51 YQCVTCGKSFRRSK   64 (159)
Q Consensus        51 ~~C~~C~~~f~~~~   64 (159)
                      +.|+.||+.|.+..
T Consensus        29 ~~c~~c~~~f~~~e   42 (154)
T PRK00464         29 RECLACGKRFTTFE   42 (154)
T ss_pred             eeccccCCcceEeE
Confidence            57777777776643


No 106
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=74.76  E-value=0.84  Score=22.46  Aligned_cols=11  Identities=45%  Similarity=1.407  Sum_probs=5.5

Q ss_pred             eeccccccccC
Q psy16923         51 YQCVTCGKSFR   61 (159)
Q Consensus        51 ~~C~~C~~~f~   61 (159)
                      |.|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            44555555443


No 107
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=72.53  E-value=1.6  Score=31.21  Aligned_cols=83  Identities=17%  Similarity=0.368  Sum_probs=49.2

Q ss_pred             HhhCCCcccCCCCcccCCCHHHHHHHHHh--cCCCCceeccccccccCCHHh-------HHhHHhh----cCCCCCcccc
Q psy16923         16 DTHGETPYGCPHCPMKLNTRRTLRMHLVV--HRDTKAYQCVTCGKSFRRSKD-------LKNHHNL----HTGKRPYTCP   82 (159)
Q Consensus        16 ~~h~~~~~~C~~C~~~f~~~~~l~~H~~~--h~~~~~~~C~~C~~~f~~~~~-------l~~H~~~----h~~~~~~~C~   82 (159)
                      +.|+-+.|.|..|+.-.--..++. |+.+  ......|+|.-|++.-.. +-       -..|.+.    -...+++.|+
T Consensus       136 w~hGGrif~CsfC~~flCEDDQFE-HQAsCQvLe~E~~KC~SCNrlGq~-sCLRCK~cfCddHvrrKg~ky~k~k~~PCP  213 (314)
T PF06524_consen  136 WDHGGRIFKCSFCDNFLCEDDQFE-HQASCQVLESETFKCQSCNRLGQY-SCLRCKICFCDDHVRRKGFKYEKGKPIPCP  213 (314)
T ss_pred             ccCCCeEEEeecCCCeeeccchhh-hhhhhhhhhcccccccccccccch-hhhheeeeehhhhhhhcccccccCCCCCCC
Confidence            446778899999986555544443 5443  223345677777653211 11       1234442    2335789999


Q ss_pred             cCcccccCchhHHHhHHh
Q psy16923         83 WCSRTFANGSNCRSHKRR  100 (159)
Q Consensus        83 ~C~~~f~~~~~l~~H~~~  100 (159)
                      .|++.......|..-.+.
T Consensus       214 KCg~et~eTkdLSmStR~  231 (314)
T PF06524_consen  214 KCGYETQETKDLSMSTRS  231 (314)
T ss_pred             CCCCcccccccceeeeec
Confidence            999988777777555443


No 108
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=72.30  E-value=3  Score=26.74  Aligned_cols=31  Identities=23%  Similarity=0.437  Sum_probs=17.7

Q ss_pred             cccccCcccccCchhHHHhHHhhCCchhhhhhhc
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMHPEELKLYESS  112 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~  112 (159)
                      ..|-+||+.|..   |++|++.||+-....+...
T Consensus        73 i~clecGk~~k~---LkrHL~~~~gltp~eYR~k  103 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHGLTPEEYRAK  103 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-S-HHHHHHH
T ss_pred             eEEccCCcccch---HHHHHHHccCCCHHHHHHH
Confidence            678889998754   4889998876554444333


No 109
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=72.06  E-value=4.8  Score=20.08  Aligned_cols=25  Identities=24%  Similarity=0.529  Sum_probs=17.9

Q ss_pred             cccCCCCcccCC--CHHHHHHHHHhcC
Q psy16923         22 PYGCPHCPMKLN--TRRTLRMHLVVHR   46 (159)
Q Consensus        22 ~~~C~~C~~~f~--~~~~l~~H~~~h~   46 (159)
                      .-.|+.|++.|.  ...+-..|.+-|.
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            358999998875  4567777776653


No 110
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=71.69  E-value=3.4  Score=21.03  Aligned_cols=22  Identities=32%  Similarity=0.688  Sum_probs=18.4

Q ss_pred             ccCCCCcccCCCHHHHHHHHHh
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVV   44 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~   44 (159)
                      |.|-.|..+...++.|-+||+-
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            6788898888888999988863


No 111
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=71.34  E-value=1  Score=31.59  Aligned_cols=9  Identities=33%  Similarity=0.910  Sum_probs=6.2

Q ss_pred             cccccCccc
Q psy16923         79 YTCPWCSRT   87 (159)
Q Consensus        79 ~~C~~C~~~   87 (159)
                      +.|+.|..+
T Consensus        63 vvCP~C~yA   71 (267)
T COG1655          63 VVCPICYYA   71 (267)
T ss_pred             EEcchhhHH
Confidence            478888763


No 112
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=70.31  E-value=3  Score=22.67  Aligned_cols=53  Identities=25%  Similarity=0.632  Sum_probs=28.8

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCccc
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRT   87 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   87 (159)
                      ..+..|..|+....-.          .....|.|+.||......-.   .-|.  ...+|.|+.||..
T Consensus         5 ~~~~~CtSCg~~i~~~----------~~~~~F~CPnCG~~~I~RC~---~CRk--~~~~Y~CP~CGF~   57 (59)
T PRK14890          5 MEPPKCTSCGIEIAPR----------EKAVKFLCPNCGEVIIYRCE---KCRK--QSNPYTCPKCGFE   57 (59)
T ss_pred             ccCccccCCCCcccCC----------CccCEeeCCCCCCeeEeech---hHHh--cCCceECCCCCCc
Confidence            3455788887543211          11245889999876222211   1111  2467999999863


No 113
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=70.31  E-value=3.3  Score=20.07  Aligned_cols=10  Identities=20%  Similarity=0.534  Sum_probs=5.2

Q ss_pred             cccccCcccc
Q psy16923         79 YTCPWCSRTF   88 (159)
Q Consensus        79 ~~C~~C~~~f   88 (159)
                      -.|+.||-.+
T Consensus        22 ~~Cd~cg~~L   31 (36)
T PF05191_consen   22 GVCDNCGGEL   31 (36)
T ss_dssp             TBCTTTTEBE
T ss_pred             CccCCCCCee
Confidence            4555555443


No 114
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=69.11  E-value=4.7  Score=18.98  Aligned_cols=10  Identities=40%  Similarity=1.125  Sum_probs=5.8

Q ss_pred             CcccccCccc
Q psy16923         78 PYTCPWCSRT   87 (159)
Q Consensus        78 ~~~C~~C~~~   87 (159)
                      +.+|+.||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            4577777654


No 115
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=66.25  E-value=2.9  Score=18.67  Aligned_cols=10  Identities=40%  Similarity=1.105  Sum_probs=5.9

Q ss_pred             ccccCccccc
Q psy16923         80 TCPWCSRTFA   89 (159)
Q Consensus        80 ~C~~C~~~f~   89 (159)
                      .|+.||+.|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5666666553


No 116
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=65.95  E-value=2.7  Score=24.98  Aligned_cols=11  Identities=27%  Similarity=0.869  Sum_probs=5.1

Q ss_pred             ceecccccccc
Q psy16923         50 AYQCVTCGKSF   60 (159)
Q Consensus        50 ~~~C~~C~~~f   60 (159)
                      .|.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PTZ00255         54 IWRCKGCKKTV   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            34455554443


No 117
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=64.45  E-value=2.6  Score=34.95  Aligned_cols=13  Identities=31%  Similarity=0.769  Sum_probs=9.7

Q ss_pred             CCCCcccccCccc
Q psy16923         75 GKRPYTCPWCSRT   87 (159)
Q Consensus        75 ~~~~~~C~~C~~~   87 (159)
                      ...|..|+.||..
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            4567889999864


No 118
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=64.28  E-value=1.8  Score=25.74  Aligned_cols=11  Identities=36%  Similarity=1.081  Sum_probs=7.3

Q ss_pred             cccccCccccc
Q psy16923         79 YTCPWCSRTFA   89 (159)
Q Consensus        79 ~~C~~C~~~f~   89 (159)
                      |.|..|++.|.
T Consensus        54 W~C~~C~~~~A   64 (90)
T PF01780_consen   54 WKCKKCGKKFA   64 (90)
T ss_dssp             EEETTTTEEEE
T ss_pred             eecCCCCCEEe
Confidence            67777776653


No 119
>KOG3408|consensus
Probab=64.04  E-value=4.9  Score=25.26  Aligned_cols=23  Identities=30%  Similarity=0.755  Sum_probs=13.8

Q ss_pred             CceeccccccccCCHHhHHhHHh
Q psy16923         49 KAYQCVTCGKSFRRSKDLKNHHN   71 (159)
Q Consensus        49 ~~~~C~~C~~~f~~~~~l~~H~~   71 (159)
                      ..|-|..|.+-|.+...|+.|.+
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHh
Confidence            34566666666666666666655


No 120
>KOG4167|consensus
Probab=63.99  E-value=1.2  Score=36.48  Aligned_cols=27  Identities=19%  Similarity=0.415  Sum_probs=23.2

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhcC
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVHR   46 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h~   46 (159)
                      ...|.|.+|++.|.....+..||++|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            345889999999998888999999886


No 121
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=63.61  E-value=3.1  Score=24.77  Aligned_cols=10  Identities=40%  Similarity=1.069  Sum_probs=4.9

Q ss_pred             cccccCcccc
Q psy16923         79 YTCPWCSRTF   88 (159)
Q Consensus        79 ~~C~~C~~~f   88 (159)
                      |.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (91)
T TIGR00280        54 WTCRKCGAKF   63 (91)
T ss_pred             EEcCCCCCEE
Confidence            4555554444


No 122
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=62.39  E-value=1.5  Score=23.09  Aligned_cols=20  Identities=25%  Similarity=0.652  Sum_probs=6.7

Q ss_pred             cccCCCCcccCCCHHHHHHH
Q psy16923         22 PYGCPHCPMKLNTRRTLRMH   41 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H   41 (159)
                      .|.|+.|+..|-..-++-.|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTT
T ss_pred             eEECCCCCCccccCcChhhh
Confidence            34455555444444444333


No 123
>KOG2593|consensus
Probab=61.46  E-value=13  Score=28.80  Aligned_cols=36  Identities=28%  Similarity=0.764  Sum_probs=20.8

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccc
Q psy16923         21 TPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKS   59 (159)
Q Consensus        21 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   59 (159)
                      .-|.|+.|++.|.....+..-   -.....|.|..|+..
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~L~---~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQLL---DNETGEFHCENCGGE  162 (436)
T ss_pred             ccccCCccccchhhhHHHHhh---cccCceEEEecCCCc
Confidence            447777777777665544421   112345777777643


No 124
>KOG2593|consensus
Probab=61.28  E-value=11  Score=29.22  Aligned_cols=39  Identities=18%  Similarity=0.498  Sum_probs=26.5

Q ss_pred             CCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCccc
Q psy16923         46 RDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRT   87 (159)
Q Consensus        46 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   87 (159)
                      .....|.|+.|.+.|.....++.=   -...-.|.|..|+-.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L~---~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQLL---DNETGEFHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHHHhh---cccCceEEEecCCCc
Confidence            345679999999999887765422   222234899888644


No 125
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=61.19  E-value=4.1  Score=20.19  Aligned_cols=18  Identities=22%  Similarity=0.543  Sum_probs=10.2

Q ss_pred             ceeccccccccCCHHhHH
Q psy16923         50 AYQCVTCGKSFRRSKDLK   67 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~   67 (159)
                      ...|..|+..+.....|.
T Consensus        19 id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEECCCCCeEEccHHHHH
Confidence            345666666666555543


No 126
>PF14353 CpXC:  CpXC protein
Probab=60.66  E-value=11  Score=23.77  Aligned_cols=9  Identities=44%  Similarity=1.324  Sum_probs=5.7

Q ss_pred             cCCCCcccC
Q psy16923         24 GCPHCPMKL   32 (159)
Q Consensus        24 ~C~~C~~~f   32 (159)
                      .|+.|+..|
T Consensus         3 tCP~C~~~~   11 (128)
T PF14353_consen    3 TCPHCGHEF   11 (128)
T ss_pred             CCCCCCCee
Confidence            566666655


No 127
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=60.24  E-value=4.8  Score=29.66  Aligned_cols=47  Identities=21%  Similarity=0.441  Sum_probs=29.5

Q ss_pred             ccccccccCCHHhHHhHHh-hcCCCCCcccccCcccccCchhHHHhHHhhC
Q psy16923         53 CVTCGKSFRRSKDLKNHHN-LHTGKRPYTCPWCSRTFANGSNCRSHKRRMH  102 (159)
Q Consensus        53 C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  102 (159)
                      |..|...|+....   |-. .-+....|.|+.|...|-..-+.-.|-..|.
T Consensus       365 Cf~CQ~~fp~~~~---~~~~~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         365 CFVCQGPFPKPPV---SPFDESTSSGRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             ceeccCCCCCCCC---CcccccccccceechhhhhhhhhhhHHHHHHHHhh
Confidence            7777777765422   111 1122334899999998888777777766543


No 128
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=60.07  E-value=4.6  Score=17.68  Aligned_cols=10  Identities=40%  Similarity=1.427  Sum_probs=7.5

Q ss_pred             CcccCCCCcc
Q psy16923         21 TPYGCPHCPM   30 (159)
Q Consensus        21 ~~~~C~~C~~   30 (159)
                      -.|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4688888874


No 129
>KOG2807|consensus
Probab=59.92  E-value=13  Score=27.71  Aligned_cols=70  Identities=20%  Similarity=0.411  Sum_probs=39.8

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhcCCCCce------------eccccccccCCHHhHHhHHhhcCCCCCcccccCccc
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAY------------QCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRT   87 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~------------~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   87 (159)
                      .-|-.|+.|+...-...+|.+-.+---.-++|            .|..|+..             -.+...|.|..|...
T Consensus       288 sLP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~-------------~~~~~~y~C~~Ck~~  354 (378)
T KOG2807|consen  288 SLPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGE-------------LLSSGRYRCESCKNV  354 (378)
T ss_pred             cCCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccc-------------cCCCCcEEchhccce
Confidence            45677888887777777776543321111111            14555211             112234888888888


Q ss_pred             ccCchhHHHhHHhhC
Q psy16923         88 FANGSNCRSHKRRMH  102 (159)
Q Consensus        88 f~~~~~l~~H~~~~h  102 (159)
                      |=..-+.-.|-..|.
T Consensus       355 FCldCDv~iHesLh~  369 (378)
T KOG2807|consen  355 FCLDCDVFIHESLHN  369 (378)
T ss_pred             eeccchHHHHhhhhc
Confidence            877767667766543


No 130
>KOG3408|consensus
Probab=59.89  E-value=4.9  Score=25.24  Aligned_cols=26  Identities=23%  Similarity=0.566  Sum_probs=22.3

Q ss_pred             CCCCcccccCcccccCchhHHHhHHh
Q psy16923         75 GKRPYTCPWCSRTFANGSNCRSHKRR  100 (159)
Q Consensus        75 ~~~~~~C~~C~~~f~~~~~l~~H~~~  100 (159)
                      |...|.|-.|.+.|.+...|..|.+.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            34458999999999999999999874


No 131
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=59.76  E-value=4.4  Score=18.80  Aligned_cols=7  Identities=43%  Similarity=1.246  Sum_probs=3.2

Q ss_pred             eeccccc
Q psy16923         51 YQCVTCG   57 (159)
Q Consensus        51 ~~C~~C~   57 (159)
                      +.|+.|+
T Consensus        20 ~vCp~C~   26 (30)
T PF08274_consen   20 LVCPECG   26 (30)
T ss_dssp             EEETTTT
T ss_pred             EeCCccc
Confidence            4444444


No 132
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=58.37  E-value=4.4  Score=26.08  Aligned_cols=14  Identities=21%  Similarity=0.762  Sum_probs=10.1

Q ss_pred             ceeccccccccCCH
Q psy16923         50 AYQCVTCGKSFRRS   63 (159)
Q Consensus        50 ~~~C~~C~~~f~~~   63 (159)
                      .+.|..||..|...
T Consensus        70 ~~~C~~CG~~~~~~   83 (135)
T PRK03824         70 VLKCRNCGNEWSLK   83 (135)
T ss_pred             EEECCCCCCEEecc
Confidence            47888888776553


No 133
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=58.14  E-value=6.5  Score=30.81  Aligned_cols=30  Identities=37%  Similarity=0.840  Sum_probs=21.5

Q ss_pred             CCCcccccCcccccCchhHHHhHHhhCCch
Q psy16923         76 KRPYTCPWCSRTFANGSNCRSHKRRMHPEE  105 (159)
Q Consensus        76 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  105 (159)
                      -+-|.|+.|.+.|.....+..|+...|...
T Consensus        55 WrFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   55 WRFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            344677778888888888888877777554


No 134
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=58.13  E-value=4.1  Score=24.25  Aligned_cols=10  Identities=30%  Similarity=0.983  Sum_probs=4.9

Q ss_pred             cccccCcccc
Q psy16923         79 YTCPWCSRTF   88 (159)
Q Consensus        79 ~~C~~C~~~f   88 (159)
                      |.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PRK03976         55 WECRKCGAKF   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            4555554444


No 135
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=57.05  E-value=5.8  Score=27.72  Aligned_cols=26  Identities=27%  Similarity=0.599  Sum_probs=14.2

Q ss_pred             CCCceeccccccccCCHHhHHhHHhh
Q psy16923         47 DTKAYQCVTCGKSFRRSKDLKNHHNL   72 (159)
Q Consensus        47 ~~~~~~C~~C~~~f~~~~~l~~H~~~   72 (159)
                      .+..|.|..|++.|........|+..
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhh
Confidence            34446666666666666666666655


No 136
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=56.55  E-value=2.9  Score=23.77  Aligned_cols=16  Identities=38%  Similarity=0.555  Sum_probs=10.3

Q ss_pred             CCCcccc--cCcccccCc
Q psy16923         76 KRPYTCP--WCSRTFANG   91 (159)
Q Consensus        76 ~~~~~C~--~C~~~f~~~   91 (159)
                      +.-+.|.  .||..|...
T Consensus        25 ~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         25 ERYHQCQNVNCSATFITY   42 (72)
T ss_pred             eeeeecCCCCCCCEEEEE
Confidence            3445776  677777665


No 137
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=55.93  E-value=33  Score=22.82  Aligned_cols=53  Identities=21%  Similarity=0.376  Sum_probs=34.7

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCccccc--CcccccCchhHHHhHHhhCCch
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPW--CSRTFANGSNCRSHKRRMHPEE  105 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~  105 (159)
                      ..|+.|........... -.|.+...|+-.|..  |.+. .+...|.+|.+..|+..
T Consensus        81 L~CPLCRG~V~GWtvve-~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~  135 (162)
T PF07800_consen   81 LACPLCRGEVKGWTVVE-PARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSA  135 (162)
T ss_pred             ccCccccCceeceEEch-HHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCC
Confidence            57999986555443332 245555666677765  5442 36789999999988654


No 138
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.77  E-value=4.3  Score=24.99  Aligned_cols=28  Identities=18%  Similarity=0.436  Sum_probs=19.8

Q ss_pred             eccccccccCCHHhHHhHHhhcCCCCCcccccCcccccC
Q psy16923         52 QCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFAN   90 (159)
Q Consensus        52 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~   90 (159)
                      .|+.|++.|...           ...|..|++||++|+.
T Consensus        11 idPetg~KFYDL-----------NrdPiVsPytG~s~P~   38 (129)
T COG4530          11 IDPETGKKFYDL-----------NRDPIVSPYTGKSYPR   38 (129)
T ss_pred             cCccccchhhcc-----------CCCccccCcccccchH
Confidence            577788777652           2357888899988843


No 139
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=55.16  E-value=8.2  Score=23.47  Aligned_cols=12  Identities=42%  Similarity=1.013  Sum_probs=6.5

Q ss_pred             eeccccccccCC
Q psy16923         51 YQCVTCGKSFRR   62 (159)
Q Consensus        51 ~~C~~C~~~f~~   62 (159)
                      +.|..||..|.+
T Consensus         3 H~CtrCG~vf~~   14 (112)
T COG3364           3 HQCTRCGEVFDD   14 (112)
T ss_pred             ceeccccccccc
Confidence            455555555554


No 140
>KOG4167|consensus
Probab=54.74  E-value=2.8  Score=34.47  Aligned_cols=28  Identities=18%  Similarity=0.430  Sum_probs=23.7

Q ss_pred             cccccCcccccCchhHHHhHHhhCCchh
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMHPEEL  106 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~  106 (159)
                      |.|.+|++.|.--..+..||++|...+.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~q~~  820 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQQEE  820 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHHHHH
Confidence            8999999999988889999998765543


No 141
>PLN02294 cytochrome c oxidase subunit Vb
Probab=53.94  E-value=3.5  Score=27.55  Aligned_cols=15  Identities=20%  Similarity=0.698  Sum_probs=8.7

Q ss_pred             CCCcccCCCCcccCC
Q psy16923         19 GETPYGCPHCPMKLN   33 (159)
Q Consensus        19 ~~~~~~C~~C~~~f~   33 (159)
                      ..+++.|++||..|+
T Consensus       138 kGkp~RCpeCG~~fk  152 (174)
T PLN02294        138 KGKSFECPVCTQYFE  152 (174)
T ss_pred             CCCceeCCCCCCEEE
Confidence            345666666666553


No 142
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=53.01  E-value=3.6  Score=18.73  Aligned_cols=9  Identities=44%  Similarity=1.383  Sum_probs=4.5

Q ss_pred             ecccccccc
Q psy16923         52 QCVTCGKSF   60 (159)
Q Consensus        52 ~C~~C~~~f   60 (159)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            345555555


No 143
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=52.96  E-value=3.4  Score=25.01  Aligned_cols=38  Identities=21%  Similarity=0.400  Sum_probs=20.4

Q ss_pred             CceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccC
Q psy16923         49 KAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFAN   90 (159)
Q Consensus        49 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~   90 (159)
                      +.|.|+.||..-.+.-.    .+.........|..||..|..
T Consensus        21 k~FtCp~Cghe~vs~ct----vkk~~~~g~~~Cg~CGls~e~   58 (104)
T COG4888          21 KTFTCPRCGHEKVSSCT----VKKTVNIGTAVCGNCGLSFEC   58 (104)
T ss_pred             ceEecCccCCeeeeEEE----EEecCceeEEEcccCcceEEE
Confidence            45788888764333221    122222233578888877653


No 144
>PHA00626 hypothetical protein
Probab=52.30  E-value=8  Score=20.76  Aligned_cols=16  Identities=19%  Similarity=0.401  Sum_probs=11.6

Q ss_pred             CcccCCCCcccCCCHH
Q psy16923         21 TPYGCPHCPMKLNTRR   36 (159)
Q Consensus        21 ~~~~C~~C~~~f~~~~   36 (159)
                      ..|.|+.|+..|....
T Consensus        22 nrYkCkdCGY~ft~~~   37 (59)
T PHA00626         22 DDYVCCDCGYNDSKDA   37 (59)
T ss_pred             cceEcCCCCCeechhh
Confidence            4688888888876543


No 145
>KOG2907|consensus
Probab=51.28  E-value=8.2  Score=23.94  Aligned_cols=38  Identities=26%  Similarity=0.496  Sum_probs=20.0

Q ss_pred             eeccccccccCCHHhHHhHHhhc-CC-CCCcccccCcccccC
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLH-TG-KRPYTCPWCSRTFAN   90 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h-~~-~~~~~C~~C~~~f~~   90 (159)
                      ..|+.||-.--.  .-+..+|+- .| ..-|.|..|++.|..
T Consensus        75 ~kCpkCghe~m~--Y~T~QlRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMS--YHTLQLRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhh--hhhhhcccccCCceEEEEcCccceeeec
Confidence            468888753211  111222321 12 224789999888764


No 146
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=50.71  E-value=21  Score=24.20  Aligned_cols=17  Identities=29%  Similarity=0.727  Sum_probs=8.2

Q ss_pred             CCcccCCCCcccCCCHH
Q psy16923         20 ETPYGCPHCPMKLNTRR   36 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~   36 (159)
                      ..-|.|+.|...|+...
T Consensus       111 ~~~y~C~~~~~r~sfde  127 (176)
T COG1675         111 NNYYVCPNCHVKYSFDE  127 (176)
T ss_pred             CCceeCCCCCCcccHHH
Confidence            34455555555444443


No 147
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=50.42  E-value=3.8  Score=24.78  Aligned_cols=15  Identities=27%  Similarity=0.709  Sum_probs=10.4

Q ss_pred             CCCcccCCCCcccCC
Q psy16923         19 GETPYGCPHCPMKLN   33 (159)
Q Consensus        19 ~~~~~~C~~C~~~f~   33 (159)
                      ..+++.|+.||..|+
T Consensus        76 ~g~~~rC~eCG~~fk   90 (97)
T cd00924          76 KGKPKRCPECGHVFK   90 (97)
T ss_pred             CCCceeCCCCCcEEE
Confidence            346777888877764


No 148
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=50.33  E-value=9.5  Score=24.51  Aligned_cols=23  Identities=39%  Similarity=0.677  Sum_probs=11.6

Q ss_pred             eccccccccCCHHhHHhHHhhcCCCC
Q psy16923         52 QCVTCGKSFRRSKDLKNHHNLHTGKR   77 (159)
Q Consensus        52 ~C~~C~~~f~~~~~l~~H~~~h~~~~   77 (159)
                      .|-++|+.|.+   |++|+..|.+..
T Consensus        78 icLEDGkkfKS---LKRHL~t~~gmT  100 (148)
T COG4957          78 ICLEDGKKFKS---LKRHLTTHYGLT  100 (148)
T ss_pred             EEeccCcchHH---HHHHHhcccCCC
Confidence            45555555432   555555555443


No 149
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=49.96  E-value=6.1  Score=22.64  Aligned_cols=10  Identities=30%  Similarity=1.046  Sum_probs=4.7

Q ss_pred             ccCCCCcccC
Q psy16923         23 YGCPHCPMKL   32 (159)
Q Consensus        23 ~~C~~C~~~f   32 (159)
                      |.|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            4455555443


No 150
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=49.89  E-value=2  Score=21.29  Aligned_cols=10  Identities=30%  Similarity=1.059  Sum_probs=5.9

Q ss_pred             cccccCcccc
Q psy16923         79 YTCPWCSRTF   88 (159)
Q Consensus        79 ~~C~~C~~~f   88 (159)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            5666666544


No 151
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=49.74  E-value=15  Score=20.32  Aligned_cols=12  Identities=42%  Similarity=1.005  Sum_probs=6.4

Q ss_pred             CCcccccCcccc
Q psy16923         77 RPYTCPWCSRTF   88 (159)
Q Consensus        77 ~~~~C~~C~~~f   88 (159)
                      +.|.|+.||...
T Consensus        45 r~~~C~~Cg~~~   56 (69)
T PF07282_consen   45 RVFTCPNCGFEM   56 (69)
T ss_pred             ceEEcCCCCCEE
Confidence            345666665543


No 152
>KOG1842|consensus
Probab=48.62  E-value=9.5  Score=29.62  Aligned_cols=23  Identities=17%  Similarity=0.476  Sum_probs=12.6

Q ss_pred             ceeccccccccCCHHhHHhHHhh
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNL   72 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~   72 (159)
                      .|.|+.|...|.+...|..|...
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhh
Confidence            34555555555555555555544


No 153
>KOG0978|consensus
Probab=48.43  E-value=6.3  Score=32.44  Aligned_cols=20  Identities=30%  Similarity=0.660  Sum_probs=14.5

Q ss_pred             CcccccCcccccCchhHHHh
Q psy16923         78 PYTCPWCSRTFANGSNCRSH   97 (159)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H   97 (159)
                      .-+||.|+..|....-+..|
T Consensus       678 qRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  678 QRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             cCCCCCCCCCCCcccccccC
Confidence            35899999998877655544


No 154
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=48.26  E-value=9.6  Score=18.74  Aligned_cols=13  Identities=23%  Similarity=0.608  Sum_probs=9.3

Q ss_pred             cccCCCCcccCCC
Q psy16923         22 PYGCPHCPMKLNT   34 (159)
Q Consensus        22 ~~~C~~C~~~f~~   34 (159)
                      ++.|..|++.|-.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            6777777777754


No 155
>KOG2071|consensus
Probab=48.23  E-value=13  Score=30.00  Aligned_cols=28  Identities=18%  Similarity=0.591  Sum_probs=23.4

Q ss_pred             CCCcccCCCCcccCCCHHHHHHHHHhcC
Q psy16923         19 GETPYGCPHCPMKLNTRRTLRMHLVVHR   46 (159)
Q Consensus        19 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~   46 (159)
                      ..++..|..||..|.+......||-.|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            5788999999999999888877776653


No 156
>PRK14873 primosome assembly protein PriA; Provisional
Probab=47.63  E-value=14  Score=30.52  Aligned_cols=11  Identities=27%  Similarity=0.954  Sum_probs=8.2

Q ss_pred             CCcccccCccc
Q psy16923         77 RPYTCPWCSRT   87 (159)
Q Consensus        77 ~~~~C~~C~~~   87 (159)
                      .++.|+.|+..
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            36789999864


No 157
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=47.23  E-value=11  Score=18.94  Aligned_cols=14  Identities=36%  Similarity=0.869  Sum_probs=7.4

Q ss_pred             ccccCcccccCchh
Q psy16923         80 TCPWCSRTFANGSN   93 (159)
Q Consensus        80 ~C~~C~~~f~~~~~   93 (159)
                      .|..|++.|+.+..
T Consensus        10 ~C~~C~rpf~WRKK   23 (42)
T PF10013_consen   10 ICPVCGRPFTWRKK   23 (42)
T ss_pred             cCcccCCcchHHHH
Confidence            45555555555433


No 158
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=47.22  E-value=3.8  Score=23.17  Aligned_cols=59  Identities=24%  Similarity=0.369  Sum_probs=27.0

Q ss_pred             cccCCCCcccCCCHH---HHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccc
Q psy16923         22 PYGCPHCPMKLNTRR---TLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTF   88 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~---~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   88 (159)
                      .+.|+-|++.|+-..   ++..|...........|..|+....-...       ..+ ..+.|+.|+..|
T Consensus        10 ~~~~~cC~~~y~C~~CHde~~~H~~~~~~~~~v~Cg~C~~~~~~~~~-------~c~-~~~~C~~C~~~~   71 (71)
T PF05495_consen   10 AIRFPCCGKYYPCRFCHDELEDHPFDRWPVKRVICGKCRTEQPIDEY-------SCG-ADYFCPICGLYF   71 (71)
T ss_dssp             EEEETTTTEEESSHHHHHHCSSS---TTT--EEEETTT--EEES-SB-------TT---SEEETTTTEEE
T ss_pred             EEECCcccCeecHHHHHHHhccCccccccccCeECCCCCCccChhhh-------hcC-CCccCcCcCCCC
Confidence            455666777766552   22233332223335678888776554433       111 347788777543


No 159
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=46.98  E-value=18  Score=18.32  Aligned_cols=8  Identities=38%  Similarity=1.053  Sum_probs=3.9

Q ss_pred             CcccccCc
Q psy16923         78 PYTCPWCS   85 (159)
Q Consensus        78 ~~~C~~C~   85 (159)
                      .|+|..|+
T Consensus        37 ~~~C~~C~   44 (46)
T PF12760_consen   37 RYRCKACR   44 (46)
T ss_pred             eEECCCCC
Confidence            35555554


No 160
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=46.36  E-value=10  Score=24.92  Aligned_cols=35  Identities=29%  Similarity=0.770  Sum_probs=21.6

Q ss_pred             CCceeccccccccCCHHhHHhHHhhcCCCCCcccccCccc
Q psy16923         48 TKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRT   87 (159)
Q Consensus        48 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   87 (159)
                      .-+|.|. |+..+.+...   |-..-.|+ .|.|..|+-.
T Consensus       115 ~~~Y~C~-C~q~~l~~RR---hn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRIRR---HNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchhhh---cccccccc-eEEeccCCce
Confidence            4568888 8877665432   32333344 6888888754


No 161
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=46.31  E-value=11  Score=29.07  Aligned_cols=29  Identities=21%  Similarity=0.675  Sum_probs=19.8

Q ss_pred             eccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCc
Q psy16923         52 QCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANG   91 (159)
Q Consensus        52 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~   91 (159)
                      .|+.||....+.           |.+.|+|+.|+..+...
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCcc
Confidence            688888753332           33378999999877665


No 162
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=46.22  E-value=14  Score=19.33  Aligned_cols=11  Identities=36%  Similarity=0.990  Sum_probs=5.1

Q ss_pred             eeccccccccC
Q psy16923         51 YQCVTCGKSFR   61 (159)
Q Consensus        51 ~~C~~C~~~f~   61 (159)
                      +.|..||..|.
T Consensus         5 l~C~dCg~~Fv   15 (49)
T PF13451_consen    5 LTCKDCGAEFV   15 (49)
T ss_pred             EEcccCCCeEE
Confidence            44444544443


No 163
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=45.43  E-value=16  Score=28.75  Aligned_cols=24  Identities=21%  Similarity=0.527  Sum_probs=18.1

Q ss_pred             CceeccccccccCCHHhHHhHHhh
Q psy16923         49 KAYQCVTCGKSFRRSKDLKNHHNL   72 (159)
Q Consensus        49 ~~~~C~~C~~~f~~~~~l~~H~~~   72 (159)
                      +-|.|+.|.+.|.....+..|+..
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHH
Confidence            446788888888888888888764


No 164
>KOG1280|consensus
Probab=44.46  E-value=21  Score=26.90  Aligned_cols=36  Identities=19%  Similarity=0.498  Sum_probs=24.3

Q ss_pred             ceeccccccccCCHHhHHhHHhhcCCCCC--cccccCc
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNLHTGKRP--YTCPWCS   85 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~--~~C~~C~   85 (159)
                      .|.|+.|+..-.+...|..|...-+.+..  ..|++|+
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            47888998888888888888775333322  2455554


No 165
>KOG0717|consensus
Probab=43.47  E-value=14  Score=28.99  Aligned_cols=22  Identities=18%  Similarity=0.378  Sum_probs=20.0

Q ss_pred             ccCCCCcccCCCHHHHHHHHHh
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVV   44 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~   44 (159)
                      +-|..|++.|++..+|.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999754


No 166
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=43.40  E-value=11  Score=23.46  Aligned_cols=24  Identities=29%  Similarity=0.793  Sum_probs=15.5

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCcccccCcc
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSR   86 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   86 (159)
                      ..|..|+..|.....            .+.|+.||.
T Consensus        71 ~~C~~Cg~~~~~~~~------------~~~CP~Cgs   94 (115)
T TIGR00100        71 CECEDCSEEVSPEID------------LYRCPKCHG   94 (115)
T ss_pred             EEcccCCCEEecCCc------------CccCcCCcC
Confidence            678888876655321            367888875


No 167
>KOG0782|consensus
Probab=41.15  E-value=3.5  Score=33.08  Aligned_cols=52  Identities=27%  Similarity=0.569  Sum_probs=30.8

Q ss_pred             HHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccCch
Q psy16923         36 RTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGS   92 (159)
Q Consensus        36 ~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~   92 (159)
                      ..+.+|--+|....--+|..|+++|..+-.+  |-+.   .....|.+|...|-.+.
T Consensus       239 ~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F--hsKE---ivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  239 SGFVRHHWVHRRRQEGKCNTCGKGFQQKFFF--HSKE---IVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchHHhHhhHhhhccccchhhhhhhhheee--cccc---EEEEEehHHHHHhhcch
Confidence            3566666555544444788888888765433  2111   22367888887776554


No 168
>KOG2636|consensus
Probab=40.01  E-value=21  Score=27.82  Aligned_cols=29  Identities=21%  Similarity=0.416  Sum_probs=23.1

Q ss_pred             hhcCCCCCcccccCc-ccccCchhHHHhHH
Q psy16923         71 NLHTGKRPYTCPWCS-RTFANGSNCRSHKR   99 (159)
Q Consensus        71 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~   99 (159)
                      +.|.....|.|.+|| +.+.-+.++.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            456666779999999 78888888888864


No 169
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=39.61  E-value=27  Score=27.83  Aligned_cols=10  Identities=50%  Similarity=1.122  Sum_probs=6.8

Q ss_pred             CCcccccCcc
Q psy16923         77 RPYTCPWCSR   86 (159)
Q Consensus        77 ~~~~C~~C~~   86 (159)
                      .|..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            4567888865


No 170
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=39.28  E-value=15  Score=22.80  Aligned_cols=24  Identities=21%  Similarity=0.585  Sum_probs=14.9

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCcccccCcc
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSR   86 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   86 (159)
                      ..|..|+..|....            ..+.|+.||.
T Consensus        71 ~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         71 AWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             EEcccCCCEEecCC------------cCccCcCCCC
Confidence            67888886654421            2356888874


No 171
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=39.17  E-value=21  Score=19.65  Aligned_cols=10  Identities=30%  Similarity=0.730  Sum_probs=3.2

Q ss_pred             cCCCCcccCC
Q psy16923         24 GCPHCPMKLN   33 (159)
Q Consensus        24 ~C~~C~~~f~   33 (159)
                      .|..|++.|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            4555666553


No 172
>KOG0402|consensus
Probab=37.83  E-value=28  Score=20.37  Aligned_cols=9  Identities=33%  Similarity=0.977  Sum_probs=4.2

Q ss_pred             cccCCCCcc
Q psy16923         22 PYGCPHCPM   30 (159)
Q Consensus        22 ~~~C~~C~~   30 (159)
                      .|.|+.||+
T Consensus        36 ky~CsfCGK   44 (92)
T KOG0402|consen   36 KYTCSFCGK   44 (92)
T ss_pred             hhhhhhcch
Confidence            344554443


No 173
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=37.53  E-value=57  Score=19.94  Aligned_cols=38  Identities=13%  Similarity=0.268  Sum_probs=25.2

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccc
Q psy16923         21 TPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKS   59 (159)
Q Consensus        21 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   59 (159)
                      ..|.|+.=|..|.+...+...+.... .+.|.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~-~~vwtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYN-QRVWTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHh-CCeeEEecCCCC
Confidence            45667777777777777776655543 356777777664


No 174
>COG1773 Rubredoxin [Energy production and conversion]
Probab=37.50  E-value=16  Score=19.59  Aligned_cols=14  Identities=14%  Similarity=0.608  Sum_probs=10.4

Q ss_pred             CcccccCcccccCc
Q psy16923         78 PYTCPWCSRTFANG   91 (159)
Q Consensus        78 ~~~C~~C~~~f~~~   91 (159)
                      .|+|..||+.|.-.
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            47888888877654


No 175
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=37.38  E-value=9.4  Score=18.81  Aligned_cols=13  Identities=23%  Similarity=0.968  Sum_probs=6.2

Q ss_pred             CCCCcccccCccc
Q psy16923         75 GKRPYTCPWCSRT   87 (159)
Q Consensus        75 ~~~~~~C~~C~~~   87 (159)
                      +.+.|.|..|+..
T Consensus        21 ~~~~w~C~~C~~~   33 (40)
T PF04810_consen   21 GGKTWICNFCGTK   33 (40)
T ss_dssp             TTTEEEETTT--E
T ss_pred             CCCEEECcCCCCc
Confidence            4445666666653


No 176
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=37.11  E-value=10  Score=24.72  Aligned_cols=33  Identities=27%  Similarity=0.900  Sum_probs=20.1

Q ss_pred             CceeccccccccCCHHhHHhHHhhcCCCCCcccccCccccc
Q psy16923         49 KAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFA   89 (159)
Q Consensus        49 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   89 (159)
                      -.|.|..|+..+..      |.+.  ....|.|..|+..+.
T Consensus       122 ~~~~C~~C~~~~~r------~~~~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  122 YVYRCPSCGREYKR------HRRS--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             eEEEcCCCCCEeee------eccc--chhhEECCCCCCEEE
Confidence            35788888876533      3333  222378888886553


No 177
>PRK04023 DNA polymerase II large subunit; Validated
Probab=36.92  E-value=29  Score=30.13  Aligned_cols=12  Identities=25%  Similarity=0.584  Sum_probs=9.0

Q ss_pred             CCcccCCCCccc
Q psy16923         20 ETPYGCPHCPMK   31 (159)
Q Consensus        20 ~~~~~C~~C~~~   31 (159)
                      .....|+.||..
T Consensus       624 Vg~RfCpsCG~~  635 (1121)
T PRK04023        624 IGRRKCPSCGKE  635 (1121)
T ss_pred             ccCccCCCCCCc
Confidence            455679999977


No 178
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=36.49  E-value=17  Score=19.01  Aligned_cols=8  Identities=25%  Similarity=0.846  Sum_probs=4.1

Q ss_pred             cccccCcc
Q psy16923         79 YTCPWCSR   86 (159)
Q Consensus        79 ~~C~~C~~   86 (159)
                      +.|..|+.
T Consensus        38 ~~C~~Cgy   45 (50)
T PRK00432         38 WHCGKCGY   45 (50)
T ss_pred             EECCCcCC
Confidence            45555554


No 179
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=36.09  E-value=29  Score=18.63  Aligned_cols=13  Identities=23%  Similarity=0.616  Sum_probs=7.9

Q ss_pred             CCCcccccCcccc
Q psy16923         76 KRPYTCPWCSRTF   88 (159)
Q Consensus        76 ~~~~~C~~C~~~f   88 (159)
                      ...|.|+.||..+
T Consensus        12 ~v~~~Cp~cGipt   24 (55)
T PF13824_consen   12 HVNFECPDCGIPT   24 (55)
T ss_pred             ccCCcCCCCCCcC
Confidence            3447777777643


No 180
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=35.80  E-value=10  Score=18.95  Aligned_cols=13  Identities=31%  Similarity=0.922  Sum_probs=6.4

Q ss_pred             CcccCCCCcccCC
Q psy16923         21 TPYGCPHCPMKLN   33 (159)
Q Consensus        21 ~~~~C~~C~~~f~   33 (159)
                      .++.|..|+..|-
T Consensus        12 ~~~~C~~C~~~FC   24 (43)
T PF01428_consen   12 LPFKCKHCGKSFC   24 (43)
T ss_dssp             SHEE-TTTS-EE-
T ss_pred             CCeECCCCCcccC
Confidence            4566776766664


No 181
>PTZ00448 hypothetical protein; Provisional
Probab=35.60  E-value=32  Score=26.19  Aligned_cols=23  Identities=17%  Similarity=0.421  Sum_probs=18.2

Q ss_pred             cccCCCCcccCCCHHHHHHHHHh
Q psy16923         22 PYGCPHCPMKLNTRRTLRMHLVV   44 (159)
Q Consensus        22 ~~~C~~C~~~f~~~~~l~~H~~~   44 (159)
                      .|.|..|+..|.+......|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57788888888877777778775


No 182
>KOG0717|consensus
Probab=34.56  E-value=21  Score=28.03  Aligned_cols=21  Identities=19%  Similarity=0.618  Sum_probs=18.9

Q ss_pred             cccccCcccccCchhHHHhHH
Q psy16923         79 YTCPWCSRTFANGSNCRSHKR   99 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~   99 (159)
                      +.|..|.+.|.+..+|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999999999865


No 183
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=34.31  E-value=23  Score=22.70  Aligned_cols=12  Identities=42%  Similarity=1.082  Sum_probs=6.7

Q ss_pred             eeccccccccCC
Q psy16923         51 YQCVTCGKSFRR   62 (159)
Q Consensus        51 ~~C~~C~~~f~~   62 (159)
                      ++|-.||+.|..
T Consensus         2 H~Ct~Cg~~f~d   13 (131)
T PF09845_consen    2 HQCTKCGRVFED   13 (131)
T ss_pred             cccCcCCCCcCC
Confidence            455556665554


No 184
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=34.17  E-value=29  Score=17.75  Aligned_cols=11  Identities=18%  Similarity=0.528  Sum_probs=6.1

Q ss_pred             CcccccCcccc
Q psy16923         78 PYTCPWCSRTF   88 (159)
Q Consensus        78 ~~~C~~C~~~f   88 (159)
                      .+.|+.||+.+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            35666666543


No 185
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=33.99  E-value=19  Score=21.47  Aligned_cols=15  Identities=33%  Similarity=0.729  Sum_probs=12.3

Q ss_pred             CCCcccccCcccccC
Q psy16923         76 KRPYTCPWCSRTFAN   90 (159)
Q Consensus        76 ~~~~~C~~C~~~f~~   90 (159)
                      .+|-.|..||+.|.+
T Consensus        56 v~Pa~CkkCGfef~~   70 (97)
T COG3357          56 VRPARCKKCGFEFRD   70 (97)
T ss_pred             ecChhhcccCccccc
Confidence            457789999999876


No 186
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=33.91  E-value=24  Score=22.68  Aligned_cols=57  Identities=32%  Similarity=0.606  Sum_probs=30.9

Q ss_pred             CCCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCH--HhHHhHHhhcCCCCCcccccCcccccCch
Q psy16923         19 GETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRS--KDLKNHHNLHTGKRPYTCPWCSRTFANGS   92 (159)
Q Consensus        19 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~--~~l~~H~~~h~~~~~~~C~~C~~~f~~~~   92 (159)
                      ..+.|+|.+|..+.....-|          +|-.|  ||......  ..|-.|-..|     -+|+.|.-+|++..
T Consensus        77 d~~lYeCnIC~etS~ee~FL----------KPneC--CgY~iCn~Cya~LWK~~~~y-----pvCPvCkTSFKss~  135 (140)
T PF05290_consen   77 DPKLYECNICKETSAEERFL----------KPNEC--CGYSICNACYANLWKFCNLY-----PVCPVCKTSFKSSS  135 (140)
T ss_pred             CCCceeccCcccccchhhcC----------Ccccc--cchHHHHHHHHHHHHHcccC-----CCCCcccccccccc
Confidence            46889999998775433211          22222  22221111  3344444333     47888888887654


No 187
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=33.90  E-value=34  Score=18.00  Aligned_cols=11  Identities=27%  Similarity=1.229  Sum_probs=5.2

Q ss_pred             eeccccccccC
Q psy16923         51 YQCVTCGKSFR   61 (159)
Q Consensus        51 ~~C~~C~~~f~   61 (159)
                      |.|..|+..|.
T Consensus        29 W~C~~Cgh~w~   39 (55)
T PF14311_consen   29 WKCPKCGHEWK   39 (55)
T ss_pred             EECCCCCCeeE
Confidence            45555544433


No 188
>PRK12496 hypothetical protein; Provisional
Probab=33.70  E-value=33  Score=22.92  Aligned_cols=27  Identities=19%  Similarity=0.471  Sum_probs=17.0

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCcccccCccccc
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFA   89 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   89 (159)
                      +.|..|++.|....            ..-.|+.||....
T Consensus       128 ~~C~gC~~~~~~~~------------~~~~C~~CG~~~~  154 (164)
T PRK12496        128 KVCKGCKKKYPEDY------------PDDVCEICGSPVK  154 (164)
T ss_pred             EECCCCCccccCCC------------CCCcCCCCCChhh
Confidence            67888988775410            1136888886543


No 189
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=33.38  E-value=17  Score=19.11  Aligned_cols=12  Identities=25%  Similarity=0.819  Sum_probs=6.1

Q ss_pred             eccccccccCCH
Q psy16923         52 QCVTCGKSFRRS   63 (159)
Q Consensus        52 ~C~~C~~~f~~~   63 (159)
                      .|++|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            889998887654


No 190
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=33.07  E-value=38  Score=22.66  Aligned_cols=43  Identities=23%  Similarity=0.589  Sum_probs=23.5

Q ss_pred             eeccccccccCCH--HhHH-----hHHhhcCCCCCcccccCcccccCchhHH
Q psy16923         51 YQCVTCGKSFRRS--KDLK-----NHHNLHTGKRPYTCPWCSRTFANGSNCR   95 (159)
Q Consensus        51 ~~C~~C~~~f~~~--~~l~-----~H~~~h~~~~~~~C~~C~~~f~~~~~l~   95 (159)
                      -.|+.|+......  ....     .+.+.+  ..-+.|+.||+.|--.+.+.
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~--~~f~~C~~CgkiYW~GsHw~  147 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNY--EEFYRCPKCGKIYWKGSHWR  147 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcc--cceeECCCCcccccCchHHH
Confidence            4688888654332  1211     122222  23467999999886665544


No 191
>KOG4124|consensus
Probab=32.48  E-value=9.4  Score=28.69  Aligned_cols=24  Identities=29%  Similarity=0.784  Sum_probs=18.2

Q ss_pred             CCCcccccCcccccCchhHHHhHH
Q psy16923         76 KRPYTCPWCSRTFANGSNCRSHKR   99 (159)
Q Consensus        76 ~~~~~C~~C~~~f~~~~~l~~H~~   99 (159)
                      .|+|+|++|.+.++....|.-|+-
T Consensus       396 nk~~r~~i~~~~~k~~~~l~~~~~  419 (442)
T KOG4124|consen  396 NKPYRCEVCSKRYKNLNGLKYHRT  419 (442)
T ss_pred             cCcccChhhhhhhccCCCCCceee
Confidence            467999999988887766665544


No 192
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=31.81  E-value=22  Score=22.26  Aligned_cols=12  Identities=25%  Similarity=0.883  Sum_probs=7.8

Q ss_pred             eeccccccccCC
Q psy16923         51 YQCVTCGKSFRR   62 (159)
Q Consensus        51 ~~C~~C~~~f~~   62 (159)
                      +.|..|+..|..
T Consensus        72 ~~C~~Cg~~~~~   83 (117)
T PRK00564         72 LECKDCSHVFKP   83 (117)
T ss_pred             EEhhhCCCcccc
Confidence            567777765544


No 193
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=31.71  E-value=18  Score=17.95  Aligned_cols=12  Identities=33%  Similarity=1.256  Sum_probs=8.8

Q ss_pred             CCcccccCcccc
Q psy16923         77 RPYTCPWCSRTF   88 (159)
Q Consensus        77 ~~~~C~~C~~~f   88 (159)
                      .+..|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            356888888766


No 194
>PRK04351 hypothetical protein; Provisional
Probab=31.58  E-value=22  Score=23.40  Aligned_cols=33  Identities=24%  Similarity=0.693  Sum_probs=22.2

Q ss_pred             ceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccccC
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFAN   90 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~   90 (159)
                      .|.|..|+..+.+.       +.+. ...|.|..|+-.+..
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~n-~~~yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRIN-TKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee-------eecC-CCcEEeCCCCcEeee
Confidence            48999999766442       3333 345999999876543


No 195
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=31.31  E-value=39  Score=17.62  Aligned_cols=11  Identities=18%  Similarity=0.522  Sum_probs=6.1

Q ss_pred             cCCCCcccCCC
Q psy16923         24 GCPHCPMKLNT   34 (159)
Q Consensus        24 ~C~~C~~~f~~   34 (159)
                      .|..|++.|..
T Consensus         4 ~C~~C~~~F~~   14 (57)
T cd00065           4 SCMGCGKPFTL   14 (57)
T ss_pred             cCcccCccccC
Confidence            45566665543


No 196
>KOG2071|consensus
Probab=31.20  E-value=34  Score=27.67  Aligned_cols=30  Identities=17%  Similarity=0.314  Sum_probs=23.9

Q ss_pred             CCCcccccCcccccCchhHHHhHHhhCCch
Q psy16923         76 KRPYTCPWCSRTFANGSNCRSHKRRMHPEE  105 (159)
Q Consensus        76 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  105 (159)
                      ..+..|..||.+|........||..|-.+.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~dwh  445 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDDWH  445 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhhhh
Confidence            345789999999999999888888665443


No 197
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=30.61  E-value=23  Score=18.56  Aligned_cols=13  Identities=23%  Similarity=0.779  Sum_probs=9.9

Q ss_pred             cccccCcccccCc
Q psy16923         79 YTCPWCSRTFANG   91 (159)
Q Consensus        79 ~~C~~C~~~f~~~   91 (159)
                      |+|..||+.+.-.
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            6888898887644


No 198
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=30.54  E-value=45  Score=24.79  Aligned_cols=35  Identities=14%  Similarity=0.277  Sum_probs=17.0

Q ss_pred             ccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccc
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKS   59 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   59 (159)
                      -.|+.||..= ..+ +........|.+-..|..|+..
T Consensus       185 ~~CPvCGs~P-~~s-~~~~~~~~~G~RyL~CslC~te  219 (305)
T TIGR01562       185 TLCPACGSPP-VAS-MVRQGGKETGLRYLSCSLCATE  219 (305)
T ss_pred             CcCCCCCChh-hhh-hhcccCCCCCceEEEcCCCCCc
Confidence            4799998542 111 1100011345566677777643


No 199
>PLN02748 tRNA dimethylallyltransferase
Probab=30.23  E-value=43  Score=26.53  Aligned_cols=23  Identities=26%  Similarity=0.395  Sum_probs=13.1

Q ss_pred             CcccCCCCcc-cCCCHHHHHHHHH
Q psy16923         21 TPYGCPHCPM-KLNTRRTLRMHLV   43 (159)
Q Consensus        21 ~~~~C~~C~~-~f~~~~~l~~H~~   43 (159)
                      +.|.|..|+. ++....++..|++
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhc
Confidence            3455666665 5555666666654


No 200
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=29.75  E-value=15  Score=25.93  Aligned_cols=17  Identities=18%  Similarity=0.350  Sum_probs=12.1

Q ss_pred             hCCCcccCCCCcccCCC
Q psy16923         18 HGETPYGCPHCPMKLNT   34 (159)
Q Consensus        18 h~~~~~~C~~C~~~f~~   34 (159)
                      +..++..|++||..|+-
T Consensus       177 rEGkpqRCpECGqVFKL  193 (268)
T PTZ00043        177 REGFLYRCGECDQIFML  193 (268)
T ss_pred             cCCCCccCCCCCcEEEE
Confidence            34567888888887753


No 201
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=29.66  E-value=30  Score=22.40  Aligned_cols=32  Identities=22%  Similarity=0.692  Sum_probs=17.1

Q ss_pred             ceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccc
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTF   88 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   88 (159)
                      .|.|..|+..+.      .+.+ +.....|.|..|+..+
T Consensus       112 ~y~C~~C~~~~~------~~rr-~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYL------RVRR-SNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCc------eEcc-ccCcceEEcCCCCCEE
Confidence            467777776543      2222 2222447777777554


No 202
>PHA02998 RNA polymerase subunit; Provisional
Probab=29.64  E-value=9  Score=25.88  Aligned_cols=39  Identities=13%  Similarity=0.240  Sum_probs=19.9

Q ss_pred             eeccccccccCCHHhHHhHHhhcC--CCCCcccccCcccccCc
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHT--GKRPYTCPWCSRTFANG   91 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~   91 (159)
                      -.|+.|+..-.  ..++...|+-.  ...-|.|..||..|.-.
T Consensus       144 v~CPkCg~~~A--~f~qlQTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKNT--TPMMIQTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCce--EEEEEeeccCCCCceEEEEcCCCCCccCCc
Confidence            46888875322  22222223211  12237888888877544


No 203
>KOG1994|consensus
Probab=29.56  E-value=33  Score=24.25  Aligned_cols=24  Identities=29%  Similarity=0.746  Sum_probs=20.6

Q ss_pred             CCceeccccccccCCHHhHHhHHh
Q psy16923         48 TKAYQCVTCGKSFRRSKDLKNHHN   71 (159)
Q Consensus        48 ~~~~~C~~C~~~f~~~~~l~~H~~   71 (159)
                      ...|-|.+||..|.+..+|..|..
T Consensus       237 ~eh~YC~fCG~~y~~~edl~ehCP  260 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEHCP  260 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHhCC
Confidence            356899999999999999998854


No 204
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=29.50  E-value=23  Score=21.95  Aligned_cols=25  Identities=28%  Similarity=0.888  Sum_probs=14.4

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCcccccCccc
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRT   87 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   87 (159)
                      ..|..|+..|.-...            .+.|+.|+..
T Consensus        71 ~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEF------------DFSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECHHC------------CHH-SSSSSS
T ss_pred             EECCCCCCEEecCCC------------CCCCcCCcCC
Confidence            578888877765322            1458888753


No 205
>KOG1280|consensus
Probab=29.44  E-value=39  Score=25.53  Aligned_cols=30  Identities=27%  Similarity=0.556  Sum_probs=24.9

Q ss_pred             CCcccccCcccccCchhHHHhHHhhCCchh
Q psy16923         77 RPYTCPWCSRTFANGSNCRSHKRRMHPEEL  106 (159)
Q Consensus        77 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  106 (159)
                      .-|.|++|+..=.+...+..|....|.+-.
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~  107 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEAS  107 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccC
Confidence            358999999987788899999998887654


No 206
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=29.41  E-value=30  Score=21.27  Aligned_cols=22  Identities=27%  Similarity=0.631  Sum_probs=13.5

Q ss_pred             ceeccccccccCCHHhHHhHHh
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHN   71 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~   71 (159)
                      .+-|..|.+-|.+...|..|.+
T Consensus        55 qhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhc
Confidence            3556666666666666666654


No 207
>KOG1842|consensus
Probab=29.40  E-value=33  Score=26.85  Aligned_cols=27  Identities=33%  Similarity=0.587  Sum_probs=23.0

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHh-cCC
Q psy16923         21 TPYGCPHCPMKLNTRRTLRMHLVV-HRD   47 (159)
Q Consensus        21 ~~~~C~~C~~~f~~~~~l~~H~~~-h~~   47 (159)
                      +-|.|++|..-|...+.|..|... |.+
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhccc
Confidence            458999999999999999999875 543


No 208
>PRK12860 transcriptional activator FlhC; Provisional
Probab=29.16  E-value=42  Score=23.06  Aligned_cols=48  Identities=21%  Similarity=0.426  Sum_probs=29.1

Q ss_pred             cccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCc
Q psy16923         29 PMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCS   85 (159)
Q Consensus        29 ~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~   85 (159)
                      --.|.+...|.+.+... --....|..|+..|...        .|.....|.|+.|.
T Consensus       114 ~Ls~tRAw~LvRf~~s~-~L~l~~C~~Cgg~fv~~--------~~e~~~~f~CplC~  161 (189)
T PRK12860        114 VLDLTRAWTLVRFFDAG-MLQLARCCRCGGKFVTH--------AHDLRHNFVCGLCQ  161 (189)
T ss_pred             eecHHHHHHHHHHhcCC-CeeeccCCCCCCCeecc--------ccccCCCCcCCCCC
Confidence            34555666666665543 22345788898877642        12334468899886


No 209
>KOG2636|consensus
Probab=28.73  E-value=39  Score=26.44  Aligned_cols=29  Identities=28%  Similarity=0.615  Sum_probs=19.0

Q ss_pred             HhcCCCCceeccccc-cccCCHHhHHhHHh
Q psy16923         43 VVHRDTKAYQCVTCG-KSFRRSKDLKNHHN   71 (159)
Q Consensus        43 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~   71 (159)
                      +.|.-...|.|..|| .++.....+.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            445555667777777 66666677777765


No 210
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=27.99  E-value=21  Score=22.24  Aligned_cols=12  Identities=25%  Similarity=0.465  Sum_probs=7.9

Q ss_pred             eeccccccccCC
Q psy16923         51 YQCVTCGKSFRR   62 (159)
Q Consensus        51 ~~C~~C~~~f~~   62 (159)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (114)
T PRK03681         71 CWCETCQQYVTL   82 (114)
T ss_pred             EEcccCCCeeec
Confidence            678888865443


No 211
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.93  E-value=44  Score=24.48  Aligned_cols=25  Identities=20%  Similarity=0.575  Sum_probs=15.9

Q ss_pred             ceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccc
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTF   88 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   88 (159)
                      .|.|+.|...|..              .|-.|+.|+-.|
T Consensus       255 GyvCs~Clsi~C~--------------~p~~C~~Cgt~f  279 (279)
T TIGR00627       255 GFVCSVCLSVLCQ--------------YTPICKTCKTAF  279 (279)
T ss_pred             eEECCCccCCcCC--------------CCCCCCCCCCCC
Confidence            3777777766654              124777777654


No 212
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=27.15  E-value=26  Score=18.06  Aligned_cols=14  Identities=29%  Similarity=0.895  Sum_probs=10.1

Q ss_pred             cccccCcccccCch
Q psy16923         79 YTCPWCSRTFANGS   92 (159)
Q Consensus        79 ~~C~~C~~~f~~~~   92 (159)
                      |.|..|++.+....
T Consensus         2 y~C~~CgyvYd~~~   15 (47)
T PF00301_consen    2 YQCPVCGYVYDPEK   15 (47)
T ss_dssp             EEETTTSBEEETTT
T ss_pred             cCCCCCCEEEcCCc
Confidence            67888888776543


No 213
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=27.08  E-value=26  Score=21.45  Aligned_cols=11  Identities=36%  Similarity=0.763  Sum_probs=7.0

Q ss_pred             CcccCCCCccc
Q psy16923         21 TPYGCPHCPMK   31 (159)
Q Consensus        21 ~~~~C~~C~~~   31 (159)
                      +|-.|+.|+..
T Consensus         1 ~p~~CpYCg~~   11 (102)
T PF11672_consen    1 KPIICPYCGGP   11 (102)
T ss_pred             CCcccCCCCCe
Confidence            45667777754


No 214
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=26.86  E-value=41  Score=25.05  Aligned_cols=36  Identities=14%  Similarity=0.304  Sum_probs=19.6

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccc
Q psy16923         21 TPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKS   59 (159)
Q Consensus        21 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   59 (159)
                      ..-.|+.||..=. .+ +. +.....|.+-..|..|+..
T Consensus       186 ~~~~CPvCGs~P~-~s-~v-~~~~~~G~RyL~CslC~te  221 (309)
T PRK03564        186 QRQFCPVCGSMPV-SS-VV-QIGTTQGLRYLHCNLCESE  221 (309)
T ss_pred             CCCCCCCCCCcch-hh-ee-eccCCCCceEEEcCCCCCc
Confidence            4567999985421 11 11 1223455666777777653


No 215
>KOG4118|consensus
Probab=26.84  E-value=36  Score=18.92  Aligned_cols=27  Identities=22%  Similarity=0.502  Sum_probs=20.8

Q ss_pred             cccccCcccccCchhHHHhHHhhCCch
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMHPEE  105 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h~~~  105 (159)
                      |+|.+|--.-.....+..|....|+.+
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~   65 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKE   65 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCC
Confidence            678888777777777888888777654


No 216
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=26.48  E-value=19  Score=17.43  Aligned_cols=18  Identities=28%  Similarity=0.658  Sum_probs=8.4

Q ss_pred             HhHHhhcCCCCCcccccC
Q psy16923         67 KNHHNLHTGKRPYTCPWC   84 (159)
Q Consensus        67 ~~H~~~h~~~~~~~C~~C   84 (159)
                      ..|-+...|..-|.|..|
T Consensus        18 ~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   18 KKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCCEeEecCcC
Confidence            334444444444555554


No 218
>KOG3214|consensus
Probab=26.41  E-value=20  Score=21.79  Aligned_cols=13  Identities=23%  Similarity=0.715  Sum_probs=8.9

Q ss_pred             cccccCcccccCc
Q psy16923         79 YTCPWCSRTFANG   91 (159)
Q Consensus        79 ~~C~~C~~~f~~~   91 (159)
                      ..|.+|+..|.+.
T Consensus        48 ~sC~iC~esFqt~   60 (109)
T KOG3214|consen   48 ASCRICEESFQTT   60 (109)
T ss_pred             eeeeehhhhhccc
Confidence            5677777777654


No 219
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.00  E-value=37  Score=18.59  Aligned_cols=12  Identities=42%  Similarity=1.021  Sum_probs=6.4

Q ss_pred             CCCcccccCccc
Q psy16923         76 KRPYTCPWCSRT   87 (159)
Q Consensus        76 ~~~~~C~~C~~~   87 (159)
                      .+.|.|+.|..+
T Consensus        29 IrtymC~eC~~R   40 (68)
T COG4896          29 IRTYMCPECEHR   40 (68)
T ss_pred             ceeEechhhHhh
Confidence            334666666543


No 220
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=24.68  E-value=9.8  Score=24.58  Aligned_cols=12  Identities=33%  Similarity=0.935  Sum_probs=6.6

Q ss_pred             CcccCCCCcccC
Q psy16923         21 TPYGCPHCPMKL   32 (159)
Q Consensus        21 ~~~~C~~C~~~f   32 (159)
                      ++..|+.||..|
T Consensus       111 ~~~RCpeCG~~f  122 (136)
T PF01215_consen  111 KPQRCPECGQVF  122 (136)
T ss_dssp             SEEEETTTEEEE
T ss_pred             CccCCCCCCeEE
Confidence            455555555554


No 221
>PRK12722 transcriptional activator FlhC; Provisional
Probab=24.63  E-value=49  Score=22.69  Aligned_cols=47  Identities=21%  Similarity=0.384  Sum_probs=23.0

Q ss_pred             cCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcc
Q psy16923         31 KLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSR   86 (159)
Q Consensus        31 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   86 (159)
                      .|.+...|.+.+.... -....|..|+..|....        +.....|.|+.|..
T Consensus       116 s~tRAw~LvRf~~s~~-L~l~~C~~Cgg~fv~~~--------~e~~~~f~CplC~~  162 (187)
T PRK12722        116 SLTRAWTLVRFVDSGM-LQLSSCNCCGGHFVTHA--------HDPVGSFVCGLCQP  162 (187)
T ss_pred             cHHHHHHHHHHHhcCc-EeeccCCCCCCCeeccc--------cccCCCCcCCCCCC
Confidence            3444444444443321 12245777777665422        12234577777764


No 222
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=24.61  E-value=71  Score=22.07  Aligned_cols=10  Identities=20%  Similarity=0.567  Sum_probs=4.9

Q ss_pred             cccccCcccc
Q psy16923         79 YTCPWCSRTF   88 (159)
Q Consensus        79 ~~C~~C~~~f   88 (159)
                      +.|..||..+
T Consensus        31 vrC~eCG~V~   40 (201)
T COG1326          31 VRCEECGTVH   40 (201)
T ss_pred             EEccCCCcEe
Confidence            4555555443


No 223
>KOG1729|consensus
Probab=24.55  E-value=23  Score=26.10  Aligned_cols=57  Identities=18%  Similarity=0.232  Sum_probs=28.7

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhH-HhhcCCCCCcccccCcccc
Q psy16923         21 TPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNH-HNLHTGKRPYTCPWCSRTF   88 (159)
Q Consensus        21 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H-~~~h~~~~~~~C~~C~~~f   88 (159)
                      ..-.|..|+...-+..     .|.|+      |..||..|...-.-+.- +..........|+.|-..+
T Consensus       167 ea~~C~~C~~~~Ftl~-----~RRHH------CR~CG~ivC~~Cs~n~~~l~~~~~k~~rvC~~CF~el  224 (288)
T KOG1729|consen  167 EATECMVCGCTEFTLS-----ERRHH------CRNCGDIVCAPCSRNRFLLPNLSTKPIRVCDICFEEL  224 (288)
T ss_pred             cceecccCCCccccHH-----HHHHH------HHhcchHhhhhhhcCcccccccCCCCceecHHHHHHH
Confidence            4456888888422222     24443      77777777663222211 1122222234788885544


No 224
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=24.24  E-value=16  Score=22.74  Aligned_cols=16  Identities=13%  Similarity=0.310  Sum_probs=11.6

Q ss_pred             CCcccCCCCcccCCCH
Q psy16923         20 ETPYGCPHCPMKLNTR   35 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~   35 (159)
                      ...+.|..|+..+...
T Consensus        20 ~~~l~C~kCgye~~~~   35 (113)
T COG1594          20 GGKLVCRKCGYEEEAS   35 (113)
T ss_pred             CcEEECCCCCcchhcc
Confidence            3468899999876555


No 225
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.91  E-value=36  Score=21.55  Aligned_cols=12  Identities=25%  Similarity=0.553  Sum_probs=8.1

Q ss_pred             eeccccccccCCH
Q psy16923         51 YQCVTCGKSFRRS   63 (159)
Q Consensus        51 ~~C~~C~~~f~~~   63 (159)
                      +.| .|+..|...
T Consensus        71 ~~C-~Cg~~~~~~   82 (124)
T PRK00762         71 IEC-ECGYEGVVD   82 (124)
T ss_pred             EEe-eCcCccccc
Confidence            678 888766543


No 226
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=23.90  E-value=50  Score=25.10  Aligned_cols=29  Identities=17%  Similarity=0.370  Sum_probs=21.2

Q ss_pred             hhcCCCCCcccccCc-ccccCchhHHHhHH
Q psy16923         71 NLHTGKRPYTCPWCS-RTFANGSNCRSHKR   99 (159)
Q Consensus        71 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~   99 (159)
                      +.|...+.|.|.+|| +.+.-+..+.+|..
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhhhh
Confidence            345556679999999 77777777777753


No 227
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=23.56  E-value=29  Score=18.69  Aligned_cols=10  Identities=30%  Similarity=0.880  Sum_probs=5.4

Q ss_pred             CCcccccCcc
Q psy16923         77 RPYTCPWCSR   86 (159)
Q Consensus        77 ~~~~C~~C~~   86 (159)
                      ..|.|+.|..
T Consensus        30 ~tYmC~eC~~   39 (56)
T PF09963_consen   30 HTYMCDECKE   39 (56)
T ss_pred             cceeChhHHH
Confidence            3466666643


No 228
>PRK05978 hypothetical protein; Provisional
Probab=23.49  E-value=31  Score=22.65  Aligned_cols=11  Identities=27%  Similarity=0.878  Sum_probs=6.2

Q ss_pred             ccccCcccccC
Q psy16923         80 TCPWCSRTFAN   90 (159)
Q Consensus        80 ~C~~C~~~f~~   90 (159)
                      .|+.||..|..
T Consensus        54 ~C~~CG~~~~~   64 (148)
T PRK05978         54 HCAACGEDFTH   64 (148)
T ss_pred             CccccCCcccc
Confidence            56666655543


No 229
>PRK10220 hypothetical protein; Provisional
Probab=23.10  E-value=52  Score=20.39  Aligned_cols=12  Identities=33%  Similarity=1.127  Sum_probs=6.5

Q ss_pred             cccccCcccccC
Q psy16923         79 YTCPWCSRTFAN   90 (159)
Q Consensus        79 ~~C~~C~~~f~~   90 (159)
                      |.|+.|+..+..
T Consensus        21 ~vCpeC~hEW~~   32 (111)
T PRK10220         21 YICPECAHEWND   32 (111)
T ss_pred             EECCcccCcCCc
Confidence            556666555443


No 230
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.09  E-value=33  Score=18.83  Aligned_cols=45  Identities=13%  Similarity=0.349  Sum_probs=23.6

Q ss_pred             HHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCccccc
Q psy16923         41 HLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFA   89 (159)
Q Consensus        41 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   89 (159)
                      |..++.+..++.|+.-+-.+.....+.   .. ..+.-..|++|+..|.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~L---~m-g~~gev~CPYC~t~y~   59 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVFL---DM-GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEEE---Ec-CCCCcEecCccccEEE
Confidence            444556667777776544332221110   01 1233368999988775


No 231
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.69  E-value=52  Score=24.12  Aligned_cols=14  Identities=29%  Similarity=0.802  Sum_probs=8.7

Q ss_pred             CCcccccCcccccC
Q psy16923         77 RPYTCPWCSRTFAN   90 (159)
Q Consensus        77 ~~~~C~~C~~~f~~   90 (159)
                      +.|.|+.||.....
T Consensus       321 r~~~C~~cg~~~~r  334 (364)
T COG0675         321 RLFKCPRCGFVHDR  334 (364)
T ss_pred             eeEECCCCCCeehh
Confidence            44677777765443


No 232
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=22.57  E-value=37  Score=16.23  Aligned_cols=13  Identities=23%  Similarity=0.695  Sum_probs=6.0

Q ss_pred             cccccCcccccCc
Q psy16923         79 YTCPWCSRTFANG   91 (159)
Q Consensus        79 ~~C~~C~~~f~~~   91 (159)
                      -.|..|++.|..+
T Consensus         4 ~~C~eC~~~f~dS   16 (34)
T PF01286_consen    4 PKCDECGKPFMDS   16 (34)
T ss_dssp             EE-TTT--EES-S
T ss_pred             chHhHhCCHHHHH
Confidence            3677788777654


No 233
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=22.56  E-value=17  Score=17.35  Aligned_cols=8  Identities=38%  Similarity=0.982  Sum_probs=3.4

Q ss_pred             eecccccc
Q psy16923         51 YQCVTCGK   58 (159)
Q Consensus        51 ~~C~~C~~   58 (159)
                      +.|..|+.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            34444443


No 234
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=22.51  E-value=1e+02  Score=16.43  Aligned_cols=18  Identities=28%  Similarity=0.730  Sum_probs=10.1

Q ss_pred             eeccccccccCCHHhHHh
Q psy16923         51 YQCVTCGKSFRRSKDLKN   68 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~   68 (159)
                      +-|..||..|.+...|..
T Consensus        28 ~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   28 NYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             ceeeeeCCccCCHHHHHh
Confidence            356666666666555543


No 235
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.42  E-value=48  Score=21.18  Aligned_cols=13  Identities=23%  Similarity=0.708  Sum_probs=7.7

Q ss_pred             CcccCCCCcccCC
Q psy16923         21 TPYGCPHCPMKLN   33 (159)
Q Consensus        21 ~~~~C~~C~~~f~   33 (159)
                      -.|.|+.|++.|.
T Consensus        52 qRyrC~~C~~tf~   64 (129)
T COG3677          52 QRYKCKSCGSTFT   64 (129)
T ss_pred             cccccCCcCccee
Confidence            3466666666654


No 236
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=22.38  E-value=43  Score=20.70  Aligned_cols=12  Identities=25%  Similarity=0.747  Sum_probs=7.2

Q ss_pred             cccccCcccccC
Q psy16923         79 YTCPWCSRTFAN   90 (159)
Q Consensus        79 ~~C~~C~~~f~~   90 (159)
                      |.|+.|+..+..
T Consensus        20 ~iCpeC~~EW~~   31 (109)
T TIGR00686        20 LICPSCLYEWNE   31 (109)
T ss_pred             eECccccccccc
Confidence            666666665543


No 237
>COG2879 Uncharacterized small protein [Function unknown]
Probab=22.33  E-value=1.2e+02  Score=16.73  Aligned_cols=19  Identities=11%  Similarity=0.079  Sum_probs=12.7

Q ss_pred             CCCHHHHHHHHHhcCCCCc
Q psy16923         32 LNTRRTLRMHLVVHRDTKA   50 (159)
Q Consensus        32 f~~~~~l~~H~~~h~~~~~   50 (159)
                      .++.++...||+.++..+|
T Consensus        22 vpdYdnYVehmr~~hPd~p   40 (65)
T COG2879          22 VPDYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             CCcHHHHHHHHHHhCcCCC
Confidence            4566777788887665554


No 238
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.22  E-value=37  Score=17.61  Aligned_cols=17  Identities=24%  Similarity=0.493  Sum_probs=12.1

Q ss_pred             ccCCCCcccCCCHHHHH
Q psy16923         23 YGCPHCPMKLNTRRTLR   39 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~   39 (159)
                      -.|+.|++.|.......
T Consensus        13 KICpvCqRPFsWRkKW~   29 (54)
T COG4338          13 KICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhhcCchHHHHHHH
Confidence            35899999987665443


No 239
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=22.05  E-value=84  Score=28.30  Aligned_cols=52  Identities=23%  Similarity=0.556  Sum_probs=25.0

Q ss_pred             ccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCCcccccCcccc
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTF   88 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   88 (159)
                      +.|+.||......  ...-=..+. ...+.|+.||......         -++  ...|+.|+...
T Consensus       668 rkCPkCG~~t~~~--fCP~CGs~t-e~vy~CPsCGaev~~d---------es~--a~~CP~CGtpl  719 (1337)
T PRK14714        668 RRCPSCGTETYEN--RCPDCGTHT-EPVYVCPDCGAEVPPD---------ESG--RVECPRCDVEL  719 (1337)
T ss_pred             EECCCCCCccccc--cCcccCCcC-CCceeCccCCCccCCC---------ccc--cccCCCCCCcc
Confidence            7788888642211  000000111 2356777777653321         011  34688888543


No 240
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=21.96  E-value=1.1e+02  Score=22.63  Aligned_cols=24  Identities=25%  Similarity=0.498  Sum_probs=19.3

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHH
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLV   43 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~   43 (159)
                      ...|.|+.|-+-|.....|.+|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            456888888888888888888876


No 241
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=21.56  E-value=63  Score=25.65  Aligned_cols=15  Identities=20%  Similarity=0.490  Sum_probs=10.7

Q ss_pred             CceeccccccccCCH
Q psy16923         49 KAYQCVTCGKSFRRS   63 (159)
Q Consensus        49 ~~~~C~~C~~~f~~~   63 (159)
                      ..|.|..|+..+.-.
T Consensus       424 ~~~~c~~c~~~yd~~  438 (479)
T PRK05452        424 PRMQCSVCQWIYDPA  438 (479)
T ss_pred             CeEEECCCCeEECCC
Confidence            457888888777653


No 242
>PF14369 zf-RING_3:  zinc-finger
Probab=21.31  E-value=45  Score=15.90  Aligned_cols=10  Identities=30%  Similarity=0.859  Sum_probs=8.1

Q ss_pred             cCCCCcccCC
Q psy16923         24 GCPHCPMKLN   33 (159)
Q Consensus        24 ~C~~C~~~f~   33 (159)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998874


No 243
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=21.04  E-value=74  Score=16.25  Aligned_cols=12  Identities=42%  Similarity=0.778  Sum_probs=5.9

Q ss_pred             Cceecccccccc
Q psy16923         49 KAYQCVTCGKSF   60 (159)
Q Consensus        49 ~~~~C~~C~~~f   60 (159)
                      .+-.|..|++..
T Consensus        10 ~~~~C~~C~~~i   21 (53)
T PF00130_consen   10 KPTYCDVCGKFI   21 (53)
T ss_dssp             STEB-TTSSSBE
T ss_pred             CCCCCcccCccc
Confidence            344566666543


No 244
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=20.98  E-value=41  Score=16.31  Aligned_cols=11  Identities=36%  Similarity=0.770  Sum_probs=4.8

Q ss_pred             CcccCCCCccc
Q psy16923         21 TPYGCPHCPMK   31 (159)
Q Consensus        21 ~~~~C~~C~~~   31 (159)
                      +.|+|..|+..
T Consensus         5 ~~YkC~~CGni   15 (36)
T PF06397_consen    5 EFYKCEHCGNI   15 (36)
T ss_dssp             EEEE-TTT--E
T ss_pred             cEEEccCCCCE
Confidence            35677777643


No 245
>KOG4727|consensus
Probab=20.81  E-value=54  Score=22.11  Aligned_cols=21  Identities=19%  Similarity=0.393  Sum_probs=19.0

Q ss_pred             ccCCCCcccCCCHHHHHHHHH
Q psy16923         23 YGCPHCPMKLNTRRTLRMHLV   43 (159)
Q Consensus        23 ~~C~~C~~~f~~~~~l~~H~~   43 (159)
                      |-|.+|+-+|+..-++..|+.
T Consensus        76 yyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   76 YYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             eeeeecceeehhhHHHHHHhc
Confidence            889999999999999999975


No 246
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=20.76  E-value=92  Score=15.12  Aligned_cols=11  Identities=36%  Similarity=0.694  Sum_probs=3.6

Q ss_pred             cccCCCCcccC
Q psy16923         22 PYGCPHCPMKL   32 (159)
Q Consensus        22 ~~~C~~C~~~f   32 (159)
                      .|-|+.|+..+
T Consensus         3 ryyCdyC~~~~   13 (38)
T PF06220_consen    3 RYYCDYCKKYL   13 (38)
T ss_dssp             S-B-TTT--B-
T ss_pred             Ceeccccccee
Confidence            45566666666


No 247
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=20.74  E-value=33  Score=24.13  Aligned_cols=28  Identities=11%  Similarity=0.294  Sum_probs=0.0

Q ss_pred             eeccccccccCCHHhHHhHHhhcCCCCCc
Q psy16923         51 YQCVTCGKSFRRSKDLKNHHNLHTGKRPY   79 (159)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~   79 (159)
                      ..|+.||..... +.|..|||.......|
T Consensus       169 ~~cPitGe~IP~-~e~~eHmRi~LlDP~w  196 (229)
T PF12230_consen  169 IICPITGEMIPA-DEMDEHMRIELLDPRW  196 (229)
T ss_dssp             -----------------------------
T ss_pred             cccccccccccc-cccccccccccccccc
Confidence            456666665433 5566666665544333


No 248
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=20.61  E-value=33  Score=23.69  Aligned_cols=28  Identities=21%  Similarity=0.471  Sum_probs=0.0

Q ss_pred             hcCCCCCcccccCcc-cccCchhHHHhHH
Q psy16923         72 LHTGKRPYTCPWCSR-TFANGSNCRSHKR   99 (159)
Q Consensus        72 ~h~~~~~~~C~~C~~-~f~~~~~l~~H~~   99 (159)
                      .|.....|.|.+||- .|.=+.++.+|..
T Consensus        95 LhGL~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   95 LHGLGVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -----------------------------
T ss_pred             HhCCCCeeeeEeCCCcceecHHHHHHhcC
Confidence            444455689999974 4555667777753


No 249
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=20.54  E-value=1.1e+02  Score=16.01  Aligned_cols=11  Identities=36%  Similarity=0.821  Sum_probs=5.8

Q ss_pred             CCCcccccCcc
Q psy16923         76 KRPYTCPWCSR   86 (159)
Q Consensus        76 ~~~~~C~~C~~   86 (159)
                      .....|+.||+
T Consensus        44 ~~i~~Cp~CgR   54 (56)
T PF02591_consen   44 DEIVFCPNCGR   54 (56)
T ss_pred             CCeEECcCCCc
Confidence            33455666654


No 250
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=20.48  E-value=36  Score=20.72  Aligned_cols=13  Identities=23%  Similarity=0.207  Sum_probs=8.9

Q ss_pred             CcccccCcccccC
Q psy16923         78 PYTCPWCSRTFAN   90 (159)
Q Consensus        78 ~~~C~~C~~~f~~   90 (159)
                      ...|+.||..+..
T Consensus        42 h~~C~~CG~y~~~   54 (99)
T PRK14892         42 IITCGNCGLYTEF   54 (99)
T ss_pred             eEECCCCCCccCE
Confidence            3578888876654


No 251
>PTZ00448 hypothetical protein; Provisional
Probab=20.41  E-value=69  Score=24.50  Aligned_cols=23  Identities=17%  Similarity=0.371  Sum_probs=19.9

Q ss_pred             ceeccccccccCCHHhHHhHHhh
Q psy16923         50 AYQCVTCGKSFRRSKDLKNHHNL   72 (159)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~   72 (159)
                      .+.|..|+-.|.+......|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999888888888875


No 252
>PRK11823 DNA repair protein RadA; Provisional
Probab=20.23  E-value=62  Score=25.42  Aligned_cols=12  Identities=33%  Similarity=0.758  Sum_probs=8.0

Q ss_pred             CcccCCCCcccC
Q psy16923         21 TPYGCPHCPMKL   32 (159)
Q Consensus        21 ~~~~C~~C~~~f   32 (159)
                      ..|.|..||..+
T Consensus         6 ~~y~C~~Cg~~~   17 (446)
T PRK11823          6 TAYVCQECGAES   17 (446)
T ss_pred             CeEECCcCCCCC
Confidence            357788777554


No 253
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=20.09  E-value=42  Score=22.01  Aligned_cols=15  Identities=20%  Similarity=0.399  Sum_probs=12.4

Q ss_pred             cccccCcccccCchh
Q psy16923         79 YTCPWCSRTFANGSN   93 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~   93 (159)
                      -.|..|++.|++..-
T Consensus        29 ReC~~C~~RFTTyEr   43 (147)
T TIGR00244        29 RECLECHERFTTFER   43 (147)
T ss_pred             ccCCccCCccceeee
Confidence            589999999988644


Done!