Query         psy16925
Match_columns 166
No_of_seqs    140 out of 2436
Neff          10.4
Searched_HMMs 46136
Date          Fri Aug 16 17:12:30 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16925.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16925hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 2.1E-30 4.5E-35  179.1   3.2  134   16-165   124-260 (279)
  2 KOG2462|consensus               99.9 9.7E-25 2.1E-29  151.1   3.8  107   19-140   158-264 (279)
  3 KOG3623|consensus               99.8 6.3E-22 1.4E-26  152.1   3.9   68   93-161   896-963 (1007)
  4 KOG1074|consensus               99.8 1.4E-21   3E-26  152.1   2.6   65   12-77    343-407 (958)
  5 KOG1074|consensus               99.7 2.3E-18 5.1E-23  134.4   3.4   69   22-91    605-680 (958)
  6 KOG3623|consensus               99.6 1.5E-16 3.3E-21  122.9   4.6  116   23-141   211-331 (1007)
  7 KOG3576|consensus               99.6 1.6E-16 3.4E-21  105.9   3.6  120   16-148   111-241 (267)
  8 KOG3576|consensus               99.6 9.3E-17   2E-21  107.0   1.0   95   49-155   115-219 (267)
  9 KOG3608|consensus               99.6   2E-15 4.3E-20  108.3   3.4  129   22-153   177-324 (467)
 10 KOG3608|consensus               99.5 1.2E-14 2.7E-19  104.3   3.7  126   22-163   237-367 (467)
 11 KOG3993|consensus               99.1 9.9E-12 2.2E-16   91.4   0.8   99   16-115   261-380 (500)
 12 PLN03086 PRLI-interacting fact  99.1 2.9E-10 6.3E-15   88.2   6.5  117   17-144   448-565 (567)
 13 PLN03086 PRLI-interacting fact  99.1 4.5E-11 9.8E-16   92.6   1.7  124   20-163   405-556 (567)
 14 PHA00733 hypothetical protein   99.1 1.8E-10 3.8E-15   73.7   4.1   83   48-144    37-124 (128)
 15 PHA00733 hypothetical protein   98.9 5.1E-09 1.1E-13   67.0   5.5   83   20-116    38-124 (128)
 16 PHA02768 hypothetical protein;  98.9 1.5E-09 3.3E-14   58.0   2.2   42   93-136     7-48  (55)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.8 2.5E-09 5.3E-14   49.0   1.9   26  106-131     1-26  (26)
 18 PHA02768 hypothetical protein;  98.8 3.8E-09 8.2E-14   56.5   1.6   43   22-67      5-47  (55)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.4 2.1E-07 4.4E-12   42.6   2.1   24   38-62      2-25  (26)
 20 PHA00616 hypothetical protein   98.3 3.8E-07 8.2E-12   46.5   2.0   33   51-83      1-33  (44)
 21 PHA00732 hypothetical protein   98.2   4E-07 8.6E-12   53.2   0.3   42   94-141     4-46  (79)
 22 KOG3993|consensus               98.1   5E-07 1.1E-11   67.1  -0.5   83   52-146   268-383 (500)
 23 PF05605 zf-Di19:  Drought indu  98.0 1.2E-05 2.5E-10   43.6   3.6   50   22-74      2-52  (54)
 24 PHA00732 hypothetical protein   97.9 5.2E-06 1.1E-10   48.5   1.4   43   23-71      2-44  (79)
 25 PHA00616 hypothetical protein   97.9 1.1E-05 2.4E-10   41.2   2.1   34   22-56      1-34  (44)
 26 PF00096 zf-C2H2:  Zinc finger,  97.8 5.3E-06 1.2E-10   36.6   0.7   22  120-141     1-22  (23)
 27 PF13912 zf-C2H2_6:  C2H2-type   97.8 6.7E-06 1.4E-10   37.8   0.8   26  119-144     1-26  (27)
 28 PF13894 zf-C2H2_4:  C2H2-type   97.8 7.9E-06 1.7E-10   36.2   0.9   24  120-143     1-24  (24)
 29 PF00096 zf-C2H2:  Zinc finger,  97.8 1.9E-05 4.1E-10   34.8   1.7   20   53-72      2-21  (23)
 30 PF05605 zf-Di19:  Drought indu  97.5 0.00015 3.3E-09   39.2   3.5   47   94-143     5-53  (54)
 31 COG5189 SFP1 Putative transcri  97.4 9.6E-05 2.1E-09   53.4   1.8   44   97-140   357-419 (423)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.3  0.0002 4.4E-09   43.5   2.9   74   24-115     1-74  (100)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.3 0.00015 3.4E-09   31.8   1.4   20   24-43      2-21  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.3 0.00019 4.1E-09   32.8   1.7   24   51-74      1-24  (27)
 35 COG5189 SFP1 Putative transcri  97.2 9.5E-05   2E-09   53.5   0.1   49  116-164   346-414 (423)
 36 PF12756 zf-C2H2_2:  C2H2 type   97.0 0.00036 7.8E-09   42.4   1.3   73   53-142     1-73  (100)
 37 PF09237 GAGA:  GAGA factor;  I  96.9 0.00045 9.7E-09   36.2   1.3   41   39-79     12-52  (54)
 38 smart00355 ZnF_C2H2 zinc finge  96.8 0.00059 1.3E-08   30.4   1.2   22  120-141     1-22  (26)
 39 PF09237 GAGA:  GAGA factor;  I  96.7  0.0006 1.3E-08   35.7   0.7   31  114-144    19-49  (54)
 40 PF13909 zf-H2C2_5:  C2H2-type   96.7 0.00057 1.2E-08   30.3   0.4   24  120-144     1-24  (24)
 41 smart00355 ZnF_C2H2 zinc finge  96.6  0.0019 4.1E-08   28.6   2.1   21   53-73      2-22  (26)
 42 KOG2231|consensus               96.3  0.0099 2.2E-07   47.9   5.3  105   24-144   117-237 (669)
 43 PF12874 zf-met:  Zinc-finger o  96.2  0.0021 4.5E-08   28.6   0.7   22  120-141     1-22  (25)
 44 PF12874 zf-met:  Zinc-finger o  96.0   0.003 6.5E-08   28.1   0.7   21   23-43      1-21  (25)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  96.0  0.0037   8E-08   28.5   1.0   22  120-141     2-23  (27)
 46 KOG2893|consensus               95.8  0.0044 9.6E-08   43.3   1.2   52   92-147    11-62  (341)
 47 PF13909 zf-H2C2_5:  C2H2-type   95.7  0.0064 1.4E-07   26.7   1.3   20   23-43      1-20  (24)
 48 PRK04860 hypothetical protein;  95.6  0.0093   2E-07   39.7   2.2   29  105-133   129-157 (160)
 49 PRK04860 hypothetical protein;  94.8   0.011 2.4E-07   39.4   0.6   37   50-90    118-154 (160)
 50 PF13913 zf-C2HC_2:  zinc-finge  94.3   0.028 6.1E-07   25.1   1.2   20  120-140     3-22  (25)
 51 smart00451 ZnF_U1 U1-like zinc  94.2   0.027 5.9E-07   27.1   1.2   22   22-43      3-24  (35)
 52 COG5048 FOG: Zn-finger [Genera  93.4  0.0089 1.9E-07   45.6  -2.3  130   21-151   288-449 (467)
 53 KOG1146|consensus               93.0   0.023 5.1E-07   48.8  -0.5  104   23-141   437-540 (1406)
 54 TIGR00622 ssl1 transcription f  92.8    0.28 6.1E-06   30.5   4.2   91   49-141    13-103 (112)
 55 smart00451 ZnF_U1 U1-like zinc  92.8   0.054 1.2E-06   26.0   0.9   22  119-140     3-24  (35)
 56 KOG1146|consensus               90.5   0.053 1.1E-06   46.8  -1.0   96   19-143  1257-1352(1406)
 57 COG4049 Uncharacterized protei  89.8    0.11 2.5E-06   27.7   0.3   30  114-143    12-41  (65)
 58 cd00350 rubredoxin_like Rubred  89.5    0.27 5.9E-06   23.4   1.4   11   52-62      2-12  (33)
 59 PF12907 zf-met2:  Zinc-binding  89.1     0.4 8.6E-06   24.0   1.9   29   23-51      2-33  (40)
 60 COG4049 Uncharacterized protei  88.2    0.34 7.4E-06   25.9   1.4   25   22-46     17-41  (65)
 61 PF09538 FYDLN_acid:  Protein o  88.1    0.38 8.3E-06   29.9   1.8   15  118-132    25-39  (108)
 62 KOG2893|consensus               86.5    0.23 4.9E-06   35.1   0.2   49   21-74      9-58  (341)
 63 PF10571 UPF0547:  Uncharacteri  86.4    0.64 1.4E-05   20.9   1.6   11  120-130    15-25  (26)
 64 KOG2785|consensus               85.6     2.9 6.4E-05   31.7   5.5   48   93-140   168-241 (390)
 65 PF06524 NOA36:  NOA36 protein;  84.9    0.55 1.2E-05   33.6   1.4   90   49-141   140-231 (314)
 66 COG5048 FOG: Zn-finger [Genera  84.6    0.26 5.6E-06   37.6  -0.3   49   93-141   291-345 (467)
 67 cd00729 rubredoxin_SM Rubredox  83.4    0.88 1.9E-05   21.8   1.4   10  118-127    17-26  (34)
 68 PF12013 DUF3505:  Protein of u  81.7     1.4   3E-05   27.3   2.2   24  120-143    81-108 (109)
 69 COG1592 Rubrerythrin [Energy p  81.4     1.1 2.3E-05   30.1   1.7   13  115-127   145-157 (166)
 70 PF02892 zf-BED:  BED zinc fing  81.2       1 2.3E-05   22.8   1.3   27  117-143    14-44  (45)
 71 PF13719 zinc_ribbon_5:  zinc-r  80.5     1.2 2.6E-05   21.8   1.3   13  118-130    24-36  (37)
 72 KOG2231|consensus               79.9     2.2 4.7E-05   35.0   3.2   76   62-143   125-206 (669)
 73 PF13451 zf-trcl:  Probable zin  79.8    0.57 1.2E-05   24.6   0.0   15  118-132     3-17  (49)
 74 COG2888 Predicted Zn-ribbon RN  78.7    0.39 8.5E-06   26.1  -0.8   10  117-126    48-57  (61)
 75 TIGR02300 FYDLN_acid conserved  77.9       2 4.3E-05   27.4   2.0   15  118-132    25-39  (129)
 76 smart00614 ZnF_BED BED zinc fi  77.6     1.4 3.1E-05   23.0   1.2   25  120-144    19-48  (50)
 77 COG4306 Uncharacterized protei  77.4    0.88 1.9E-05   28.8   0.3   17  146-162    66-82  (160)
 78 PF09986 DUF2225:  Uncharacteri  77.1     1.7 3.8E-05   30.5   1.8   17   50-66      4-20  (214)
 79 PF13717 zinc_ribbon_4:  zinc-r  76.5       1 2.3E-05   21.9   0.4   12   53-64      4-15  (36)
 80 KOG4173|consensus               76.3     2.9 6.3E-05   29.0   2.6   45   23-71     80-126 (253)
 81 PRK14714 DNA polymerase II lar  74.5     1.4   3E-05   38.7   0.8   21   80-100   668-688 (1337)
 82 TIGR02098 MJ0042_CXXC MJ0042 f  74.4       1 2.2E-05   22.0   0.0   13   52-64      3-15  (38)
 83 smart00659 RPOLCX RNA polymera  74.2    0.29 6.3E-06   25.1  -2.0   11  118-128    18-28  (44)
 84 PF05443 ROS_MUCR:  ROS/MUCR tr  73.4     1.5 3.2E-05   28.3   0.6   24   93-119    74-97  (132)
 85 smart00734 ZnF_Rad18 Rad18-lik  73.0     2.4 5.3E-05   18.9   1.1   20  120-140     2-21  (26)
 86 PRK00398 rpoP DNA-directed RNA  72.8    0.33 7.1E-06   25.0  -2.1   11  119-129    21-31  (46)
 87 PF15269 zf-C2H2_7:  Zinc-finge  71.7     3.1 6.7E-05   21.2   1.4   27   17-43     15-41  (54)
 88 PRK14890 putative Zn-ribbon RN  70.7    0.74 1.6E-05   25.1  -1.0   11  117-127    46-56  (59)
 89 PF09723 Zn-ribbon_8:  Zinc rib  70.6     1.5 3.3E-05   22.1   0.2   11  117-127    24-34  (42)
 90 KOG2807|consensus               70.4     8.1 0.00017   28.9   3.8   79   50-141   289-367 (378)
 91 PF14353 CpXC:  CpXC protein     70.4    0.93   2E-05   28.9  -0.8   22  119-140    38-59  (128)
 92 COG5151 SSL1 RNA polymerase II  70.2     4.4 9.6E-05   30.0   2.4   89   50-141   321-410 (421)
 93 TIGR00373 conserved hypothetic  69.9     7.1 0.00015   26.0   3.3   33   48-89    106-138 (158)
 94 TIGR02605 CxxC_CxxC_SSSS putat  69.5     1.3 2.9E-05   23.3  -0.2   12   52-63      6-17  (52)
 95 PRK04023 DNA polymerase II lar  69.5     4.1 8.9E-05   35.1   2.4    9   52-60    627-635 (1121)
 96 PF09845 DUF2072:  Zn-ribbon co  69.1     3.6 7.7E-05   26.4   1.6   15   51-65      1-15  (131)
 97 COG1198 PriA Primosomal protei  68.7     2.3 4.9E-05   35.5   0.8   44   81-127   437-483 (730)
 98 KOG2186|consensus               68.2     4.2 9.1E-05   29.2   2.0   47   23-73      4-50  (276)
 99 KOG3408|consensus               67.9     7.1 0.00015   24.7   2.7   29   15-43     50-78  (129)
100 smart00531 TFIIE Transcription  67.7     6.4 0.00014   25.8   2.7   37   49-89     97-133 (147)
101 KOG2186|consensus               66.5     3.3 7.2E-05   29.7   1.2   11  120-130    30-40  (276)
102 PF03833 PolC_DP2:  DNA polymer  66.5     1.9 4.1E-05   36.3   0.0   20   80-99    656-675 (900)
103 KOG2482|consensus               66.4      11 0.00023   28.5   3.8   20  121-140   336-355 (423)
104 COG5236 Uncharacterized conser  64.6     5.8 0.00013   29.9   2.2   23  121-143   222-244 (493)
105 KOG2593|consensus               63.9     2.7 5.9E-05   32.5   0.4   41   15-59    121-161 (436)
106 PRK06266 transcription initiat  63.8     5.2 0.00011   27.3   1.7   32   49-89    115-146 (178)
107 PF10083 DUF2321:  Uncharacteri  63.2     2.1 4.5E-05   28.3  -0.3   17  117-133    66-82  (158)
108 PF12013 DUF3505:  Protein of u  62.8     4.2   9E-05   25.1   1.0   93   21-114    10-107 (109)
109 COG5236 Uncharacterized conser  62.5      14 0.00031   27.9   3.9   48   20-72    218-272 (493)
110 PRK14559 putative protein seri  62.1     9.7 0.00021   31.5   3.2   17   82-98     18-34  (645)
111 PF04959 ARS2:  Arsenite-resist  61.7     4.1 8.8E-05   28.7   0.9   31  117-147    75-105 (214)
112 COG4957 Predicted transcriptio  60.8     4.4 9.6E-05   26.1   0.9   24   93-119    78-101 (148)
113 KOG4173|consensus               60.0     4.9 0.00011   28.0   1.0   19  121-139   108-126 (253)
114 KOG4167|consensus               59.3     4.8  0.0001   33.4   1.1   27   20-47    790-816 (907)
115 PRK00464 nrdR transcriptional   58.8     2.6 5.7E-05   28.0  -0.4   14  120-133    29-42  (154)
116 PF01363 FYVE:  FYVE zinc finge  56.7     3.4 7.3E-05   23.1  -0.1   13  120-132    26-38  (69)
117 PF05191 ADK_lid:  Adenylate ki  56.4     4.9 0.00011   19.5   0.4    8  120-127    22-29  (36)
118 KOG0782|consensus               56.0     2.1 4.5E-05   34.4  -1.4   52  105-162   239-290 (1004)
119 PF07754 DUF1610:  Domain of un  55.8     4.8  0.0001   17.7   0.3   10  118-127    15-24  (24)
120 COG0068 HypF Hydrogenase matur  53.9     1.7 3.8E-05   35.7  -2.1   17  122-138   154-170 (750)
121 PHA00626 hypothetical protein   53.9     6.3 0.00014   21.2   0.6   15  118-132    22-36  (59)
122 KOG1842|consensus               53.5     9.3  0.0002   29.9   1.7   32   19-50     12-43  (505)
123 PF12773 DZR:  Double zinc ribb  53.5      18  0.0004   18.6   2.4   10  119-128    29-38  (50)
124 PRK09678 DNA-binding transcrip  51.5     3.4 7.4E-05   23.6  -0.6   20  116-135    24-45  (72)
125 KOG4727|consensus               51.0     8.3 0.00018   26.0   1.0   26   18-43     71-96  (193)
126 PF10013 DUF2256:  Uncharacteri  50.6     3.4 7.4E-05   20.8  -0.6   12  151-162    11-22  (42)
127 smart00834 CxxC_CXXC_SSSS Puta  50.6     6.4 0.00014   19.3   0.3   29  120-156     6-34  (41)
128 PRK04023 DNA polymerase II lar  50.5      16 0.00035   31.8   2.7   23   78-100   625-647 (1121)
129 KOG3408|consensus               50.5     6.9 0.00015   24.7   0.5   25  116-140    54-78  (129)
130 PF07282 OrfB_Zn_ribbon:  Putat  50.0      15 0.00032   20.4   1.8   14  117-130    44-57  (69)
131 KOG2482|consensus               49.7      25 0.00053   26.7   3.3   22  120-141   196-217 (423)
132 KOG0696|consensus               48.9     5.1 0.00011   31.4  -0.3   50  107-157    81-130 (683)
133 COG4530 Uncharacterized protei  48.6      12 0.00026   23.2   1.3   13  118-130    25-37  (129)
134 COG1996 RPC10 DNA-directed RNA  48.5      10 0.00022   19.9   0.9   10   52-61      7-16  (49)
135 PF02176 zf-TRAF:  TRAF-type zi  47.5     7.5 0.00016   20.8   0.3   27  104-130    23-53  (60)
136 PF08790 zf-LYAR:  LYAR-type C2  47.1     6.4 0.00014   18.0   0.0   19  120-139     1-19  (28)
137 PF06524 NOA36:  NOA36 protein;  47.1     4.3 9.3E-05   29.3  -0.8   17   50-66    208-224 (314)
138 PF01286 XPA_N:  XPA protein N-  46.1     5.3 0.00011   19.2  -0.4   14  151-164     6-19  (34)
139 COG4338 Uncharacterized protei  44.9     8.6 0.00019   20.0   0.3   14  149-162    13-26  (54)
140 PF14446 Prok-RING_1:  Prokaryo  44.5     9.4  0.0002   20.5   0.4    9   81-89      7-15  (54)
141 KOG2593|consensus               44.1      30 0.00065   27.0   3.1   40   47-89    124-163 (436)
142 PLN02294 cytochrome c oxidase   43.2      13 0.00027   25.1   0.9   16  117-132   139-154 (174)
143 smart00154 ZnF_AN1 AN1-like Zi  41.1      13 0.00027   18.4   0.5   14  119-132    12-25  (39)
144 KOG2272|consensus               40.8      32 0.00068   24.9   2.6   32    8-39     85-116 (332)
145 PRK03824 hypA hydrogenase nick  40.8      11 0.00024   24.4   0.4   15   50-64     69-83  (135)
146 KOG4124|consensus               40.4     9.4  0.0002   28.9   0.0   25  116-140   395-419 (442)
147 PHA02998 RNA polymerase subuni  40.2     2.2 4.9E-05   28.8  -2.9   16  150-165   173-188 (195)
148 cd00924 Cyt_c_Oxidase_Vb Cytoc  40.1      15 0.00033   22.3   0.9   20  111-131    72-91  (97)
149 smart00064 FYVE Protein presen  40.0     6.9 0.00015   21.7  -0.6   14  118-131    25-38  (68)
150 PF06220 zf-U1:  U1 zinc finger  39.8      21 0.00046   17.5   1.2   22   21-42      2-25  (38)
151 TIGR01206 lysW lysine biosynth  39.6      19 0.00042   19.3   1.1   10  120-129    23-32  (54)
152 COG5112 UFD2 U1-like Zn-finger  39.2      22 0.00047   22.0   1.4   29   15-43     48-76  (126)
153 PF03604 DNA_RNApol_7kD:  DNA d  38.9      21 0.00045   16.8   1.1   10  119-128    17-26  (32)
154 KOG2907|consensus               38.7      16 0.00034   22.8   0.8   13  119-131   102-114 (116)
155 KOG0978|consensus               38.6     7.7 0.00017   32.2  -0.7   20  118-137   677-696 (698)
156 KOG2785|consensus               38.4      35 0.00076   26.2   2.7   53   21-73    165-242 (390)
157 KOG1842|consensus               38.3      13 0.00028   29.1   0.4   29  119-147    15-43  (505)
158 KOG0782|consensus               37.7     6.9 0.00015   31.7  -1.1   43   63-105   237-290 (1004)
159 PRK00432 30S ribosomal protein  37.5      16 0.00035   19.2   0.6   12  118-129    36-47  (50)
160 COG0068 HypF Hydrogenase matur  37.3      11 0.00023   31.4  -0.1   82   23-130   102-184 (750)
161 PF04423 Rad50_zn_hook:  Rad50   37.1      13 0.00028   19.7   0.2   12  121-132    22-33  (54)
162 PRK13130 H/ACA RNA-protein com  36.7      32  0.0007   18.6   1.7   20   81-100     7-26  (56)
163 PF15616 TerY-C:  TerY-C metal   36.5      25 0.00054   22.7   1.5   36   81-128    79-114 (131)
164 PF07503 zf-HYPF:  HypF finger;  36.3       2 4.3E-05   20.8  -2.7   11  120-130    22-32  (35)
165 PF04780 DUF629:  Protein of un  36.0      19 0.00042   28.5   1.1   25  121-145    59-83  (466)
166 smart00504 Ubox Modified RING   35.9      51  0.0011   17.5   2.6   44   81-130     3-46  (63)
167 PF01428 zf-AN1:  AN1-like Zinc  35.6      10 0.00022   19.1  -0.3   15  118-132    12-26  (43)
168 PRK14873 primosome assembly pr  35.1      27 0.00059   29.1   1.9   46   53-99    385-430 (665)
169 smart00661 RPOL9 RNA polymeras  35.0      30 0.00066   17.8   1.5   16  119-134    20-35  (52)
170 PRK12496 hypothetical protein;  34.9      25 0.00053   23.6   1.3   10   80-89    128-137 (164)
171 KOG4167|consensus               34.0      13 0.00029   31.0  -0.0   26  119-144   792-817 (907)
172 PF05290 Baculo_IE-1:  Baculovi  33.3      53  0.0012   21.3   2.5   19   48-66     77-95  (140)
173 PF13878 zf-C2H2_3:  zinc-finge  32.7      31 0.00068   17.2   1.2   21  120-140    14-36  (41)
174 PF04780 DUF629:  Protein of un  32.4      28  0.0006   27.7   1.4   27   23-49     58-84  (466)
175 PRK05580 primosome assembly pr  32.0      18  0.0004   30.2   0.5   45   81-128   383-430 (679)
176 TIGR00100 hypA hydrogenase nic  31.5      24 0.00053   22.1   0.8    8  120-127    87-94  (115)
177 KOG1280|consensus               31.4      34 0.00074   26.0   1.7   37   22-58     79-116 (381)
178 PF04959 ARS2:  Arsenite-resist  31.3      26 0.00056   24.7   1.0   30   19-48     74-103 (214)
179 COG3364 Zn-ribbon containing p  30.8      27 0.00057   21.5   0.9   15  119-133     2-16  (112)
180 COG2331 Uncharacterized protei  30.5      12 0.00026   21.6  -0.6    8  121-128    35-42  (82)
181 COG4888 Uncharacterized Zn rib  30.5      28 0.00061   21.3   0.9   10   78-87     21-30  (104)
182 PF13824 zf-Mss51:  Zinc-finger  30.5      47   0.001   17.9   1.7   16  116-131    11-26  (55)
183 PF10276 zf-CHCC:  Zinc-finger   29.7      16 0.00035   18.2  -0.1   12  118-129    28-39  (40)
184 PRK12380 hydrogenase nickel in  29.4      29 0.00063   21.7   1.0    7  120-126    87-93  (113)
185 PF14787 zf-CCHC_5:  GAG-polypr  29.3      14  0.0003   18.0  -0.4   11  151-161     5-15  (36)
186 PRK12387 formate hydrogenlyase  28.5      39 0.00086   22.9   1.5   39  118-156   113-160 (180)
187 TIGR00244 transcriptional regu  28.5      43 0.00092   22.1   1.6   12   81-92     30-41  (147)
188 KOG4118|consensus               26.9      75  0.0016   17.8   2.1   26   22-47     38-63  (74)
189 PF08274 PhnA_Zn_Ribbon:  PhnA   26.9      26 0.00056   16.3   0.3    9  119-127    19-27  (30)
190 COG1773 Rubredoxin [Energy pro  26.1      29 0.00063   18.7   0.4   16  119-134     3-18  (55)
191 COG1327 Predicted transcriptio  26.0      50  0.0011   21.9   1.6   12   81-92     30-41  (156)
192 PF07975 C1_4:  TFIIH C1-like d  26.0      21 0.00046   18.9  -0.1   23  119-141    21-43  (51)
193 COG1571 Predicted DNA-binding   26.0      50  0.0011   25.9   1.8   14  119-132   367-380 (421)
194 smart00440 ZnF_C2C2 C2C2 Zinc   26.0      11 0.00023   18.8  -1.2   10  120-129    29-38  (40)
195 KOG0320|consensus               25.9      20 0.00044   24.4  -0.2   14   50-63    130-143 (187)
196 PF15135 UPF0515:  Uncharacteri  25.9      41 0.00089   24.3   1.2   12   50-61    111-122 (278)
197 KOG2636|consensus               25.8      46   0.001   26.2   1.6   28  112-139   394-422 (497)
198 PRK05978 hypothetical protein;  25.0      53  0.0012   21.7   1.6    7   53-59     35-41  (148)
199 PF01215 COX5B:  Cytochrome c o  24.5      26 0.00056   22.8   0.1   15  117-131   110-124 (136)
200 PF04438 zf-HIT:  HIT zinc fing  24.0      30 0.00065   16.0   0.2    6   82-87      5-10  (30)
201 PRK00762 hypA hydrogenase nick  23.9      36 0.00078   21.7   0.7    8  120-127    93-100 (124)
202 PRK00564 hypA hydrogenase nick  23.9      43 0.00093   21.1   1.0    7  121-127    90-96  (117)
203 PTZ00043 cytochrome c oxidase   23.8      43 0.00093   23.8   1.0   16  116-131   178-193 (268)
204 PF08209 Sgf11:  Sgf11 (transcr  23.7      50  0.0011   15.7   1.0   20  120-140     5-24  (33)
205 COG5152 Uncharacterized conser  23.6      29 0.00063   24.1   0.2   46   77-128   194-239 (259)
206 cd00730 rubredoxin Rubredoxin;  23.1      38 0.00082   17.8   0.5   13  120-132     2-14  (50)
207 COG4391 Uncharacterized protei  23.0      21 0.00045   19.7  -0.5   18   16-33     42-59  (62)
208 PF09963 DUF2197:  Uncharacteri  22.4      23  0.0005   19.2  -0.4   13   49-61     29-41  (56)
209 PRK14892 putative transcriptio  22.1      66  0.0014   19.7   1.5   12  120-131    43-54  (99)
210 PF15227 zf-C3HC4_4:  zinc fing  21.9      42 0.00091   16.7   0.5    6  120-125    37-42  (42)
211 PF09416 UPF1_Zn_bind:  RNA hel  21.0      84  0.0018   20.9   1.9   30   77-112    12-41  (152)
212 PF00301 Rubredoxin:  Rubredoxi  20.9      36 0.00078   17.6   0.2   15  120-134     2-16  (47)
213 COG1655 Uncharacterized protei  20.7      18 0.00039   25.7  -1.2   29   49-77     17-45  (267)
214 PF08792 A2L_zn_ribbon:  A2L zi  20.7      43 0.00093   15.8   0.4   11  120-130    22-32  (33)

No 1  
>KOG2462|consensus
Probab=99.96  E-value=2.1e-30  Score=179.13  Aligned_cols=134  Identities=29%  Similarity=0.559  Sum_probs=119.2

Q ss_pred             cCCCCCccchhhhhhhcCChHHHHHHHHHhhcC---CCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCcccccc
Q psy16925         16 NASTLGKYSLALMVTRFSSRSAVTAHTKAVHLG---ERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKL   92 (166)
Q Consensus        16 ~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~---~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~   92 (166)
                      +....+.|.|..|++.+.+.+.|.+|.+ .|-.   .+.+.|..|++.|..-..|..|+++|+  .+++|..||      
T Consensus       124 ~~~~~~r~~c~eCgk~ysT~snLsrHkQ-~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCG------  194 (279)
T KOG2462|consen  124 SAAKHPRYKCPECGKSYSTSSNLSRHKQ-THRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICG------  194 (279)
T ss_pred             ccccCCceeccccccccccccccchhhc-ccccccccccccCCCCCceeeehHHHhhHhhccC--CCccccccc------
Confidence            3445678999999999999999999988 5543   566999999999999999999999996  567777655      


Q ss_pred             ccccCCCcCCCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhhhcchhHHHHHHHhhhhhhhhcccC
Q psy16925         93 SNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYGKMKN  165 (166)
Q Consensus        93 ~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~f~~~~~~~  165 (166)
                            +.|...|.|+.|+|+|+|||||.|+.|+++|+.+++|+.|+++ |.+..+|.|..|+|.|.-..++|
T Consensus       195 ------KaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQT-HS~~K~~qC~~C~KsFsl~SyLn  260 (279)
T KOG2462|consen  195 ------KAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQT-HSDVKKHQCPRCGKSFALKSYLN  260 (279)
T ss_pred             ------ccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHh-hcCCccccCcchhhHHHHHHHHH
Confidence                  5568999999999999999999999999999999999999997 77777999999999999888776


No 2  
>KOG2462|consensus
Probab=99.90  E-value=9.7e-25  Score=151.12  Aligned_cols=107  Identities=25%  Similarity=0.523  Sum_probs=98.9

Q ss_pred             CCCccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCC
Q psy16925         19 TLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCG   98 (166)
Q Consensus        19 ~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~   98 (166)
                      +...+.|++|++.+.+...|..|++ +|+  .+.+|.+||+.|...=.|+-|++.|+||+||.|+.|+            
T Consensus       158 s~ka~~C~~C~K~YvSmpALkMHir-TH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~------------  222 (279)
T KOG2462|consen  158 SKKAFSCKYCGKVYVSMPALKMHIR-THT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCG------------  222 (279)
T ss_pred             ccccccCCCCCceeeehHHHhhHhh-ccC--CCcccccccccccchHHhhcccccccCCCCccCCccc------------
Confidence            3667999999999999999999987 566  7899999999999999999999999999999998755            


Q ss_pred             CcCCCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhh
Q psy16925         99 WYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus        99 ~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~  140 (166)
                      ++|.+.++|+.|+++|.+.|+|+|..|+|+|+..+.|..|..
T Consensus       223 kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  223 KAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             chhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            556899999999999999999999999999999999999975


No 3  
>KOG3623|consensus
Probab=99.84  E-value=6.3e-22  Score=152.13  Aligned_cols=68  Identities=26%  Similarity=0.422  Sum_probs=65.1

Q ss_pred             ccccCCCcCCCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhhhcchhHHHHHHHhhhhhhhh
Q psy16925         93 SNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYG  161 (166)
Q Consensus        93 ~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~f~~~  161 (166)
                      .|+.|++.|.-.+.|.+|.--|+|.+||+|.+|.++|..+-.|..|+|. |.||.||.|..|||+|...
T Consensus       896 aCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRL-HSGEKPfQCdKClKRFSHS  963 (1007)
T KOG3623|consen  896 ACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRL-HSGEKPFQCDKCLKRFSHS  963 (1007)
T ss_pred             hHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhh-ccCCCcchhhhhhhhcccc
Confidence            7888999999999999999999999999999999999999999999996 9999999999999999764


No 4  
>KOG1074|consensus
Probab=99.83  E-value=1.4e-21  Score=152.15  Aligned_cols=65  Identities=32%  Similarity=0.552  Sum_probs=57.1

Q ss_pred             CCcccCCCCCccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCC
Q psy16925         12 AGFRNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDD   77 (166)
Q Consensus        12 ~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~   77 (166)
                      ....+.....+.+|.+|.+.|.+.+.|+.|++ .|++++||+|.+||..|.++.+|..|...|...
T Consensus       343 v~~~~~~~~~khkCr~CakvfgS~SaLqiHlR-SHTGERPfqCnvCG~~FSTkGNLKvH~~rH~e~  407 (958)
T KOG1074|consen  343 VEGPSEKPFFKHKCRFCAKVFGSDSALQIHLR-SHTGERPFQCNVCGNRFSTKGNLKVHFQRHREK  407 (958)
T ss_pred             cccCCccccccchhhhhHhhcCchhhhhhhhh-ccCCCCCeeecccccccccccceeeeeeecccc
Confidence            34455566778999999999999999999998 799999999999999999999999997766543


No 5  
>KOG1074|consensus
Probab=99.72  E-value=2.3e-18  Score=134.40  Aligned_cols=69  Identities=35%  Similarity=0.727  Sum_probs=58.7

Q ss_pred             ccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCC----CCccCC---cCCccccc
Q psy16925         22 KYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDD----APWKCD---ICSKKSLK   91 (166)
Q Consensus        22 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~----~~~~c~---~C~~~~~~   91 (166)
                      .-.|-+|-+..+..+.|+.|++ .|++|+||+|.+||+.|.++.+|..|+-.|...    ..+.|+   .|.+.|..
T Consensus       605 PNqCiiC~rVlSC~saLqmHyr-tHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn  680 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYR-THTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTN  680 (958)
T ss_pred             ccceeeeeecccchhhhhhhhh-cccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccc
Confidence            3569999999999999999998 899999999999999999999999999888654    345666   66666644


No 6  
>KOG3623|consensus
Probab=99.64  E-value=1.5e-16  Score=122.94  Aligned_cols=116  Identities=23%  Similarity=0.467  Sum_probs=98.8

Q ss_pred             cchhhhhhhcCChHHHHHHHHHhhcC-CCCeecccchhhcCChHHHHHHHhHcCCCCCc----cCCcCCccccccccccC
Q psy16925         23 YSLALMVTRFSSRSAVTAHTKAVHLG-ERPFVCHECGQSFASKGILQEHLTIHSDDAPW----KCDICSKKSLKLSNVSC   97 (166)
Q Consensus        23 ~~C~~C~~~~~~~~~l~~H~~~~h~~-~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~----~c~~C~~~~~~~~c~~c   97 (166)
                      ..|++|...+.....|..|++..|.. +..|.|..|..+|.....|.+|+..|.+-..-    .-..+.+.   ..|.+|
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRK---FKCtEC  287 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRK---FKCTEC  287 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhcc---cccccc
Confidence            67999999999999999999877654 55599999999999999999999998653332    12223333   478899


Q ss_pred             CCcCCCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhh
Q psy16925         98 GWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus        98 ~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      +++|+-+..|+.|+|+|.|||||.|+-|++.|+..+++..|+..
T Consensus       288 gKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  288 GKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             chhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            99999999999999999999999999999999999999999863


No 7  
>KOG3576|consensus
Probab=99.63  E-value=1.6e-16  Score=105.94  Aligned_cols=120  Identities=23%  Similarity=0.409  Sum_probs=100.5

Q ss_pred             cCCCCCccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccc
Q psy16925         16 NASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNV   95 (166)
Q Consensus        16 ~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~   95 (166)
                      .+.+...|.|.+|+++|.-.-.|.+|++ .|..-+.+.|..||+.|++...|.+|.++|+|-+||+|..|++.|.     
T Consensus       111 sssd~d~ftCrvCgK~F~lQRmlnrh~k-ch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaft-----  184 (267)
T KOG3576|consen  111 SSSDQDSFTCRVCGKKFGLQRMLNRHLK-CHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFT-----  184 (267)
T ss_pred             CCCCCCeeeeehhhhhhhHHHHHHHHhh-hccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHH-----
Confidence            3444566999999999999999999997 7998899999999999999999999999999999999999887774     


Q ss_pred             cCCCcCCCchhHHHHhhhhcC-----------CCCcccCcccccccCChhhhhhhhhhcchhHH
Q psy16925         96 SCGWYPDESKDLKNHHNLHTG-----------KRPYTCPWCSRTFANGSNCRSHKRRMHPEELK  148 (166)
Q Consensus        96 ~c~~~f~~~~~l~~H~~~h~~-----------~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  148 (166)
                             ..-.|..|++.-++           ++-|.|..||..-.....+..|+..+|+..-.
T Consensus       185 -------qrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Spa  241 (267)
T KOG3576|consen  185 -------QRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSPA  241 (267)
T ss_pred             -------hhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCHH
Confidence                   44446677654332           45689999999988899999999998987633


No 8  
>KOG3576|consensus
Probab=99.62  E-value=9.3e-17  Score=107.04  Aligned_cols=95  Identities=33%  Similarity=0.676  Sum_probs=82.2

Q ss_pred             CCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCcccCccccc
Q psy16925         49 ERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRT  128 (166)
Q Consensus        49 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~  128 (166)
                      ...+.|.+|++.|.-...|.+|+.-|..-+.+.|..||++|            .+.-+|+.|.|+|+|.+||+|..|+++
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgf------------ndtfdlkrh~rthtgvrpykc~~c~ka  182 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGF------------NDTFDLKRHTRTHTGVRPYKCSLCEKA  182 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcc------------cchhhhhhhhccccCccccchhhhhHH
Confidence            44599999999999999999999999888888888877766            566779999999999999999999999


Q ss_pred             ccCChhhhhhhhhhcchhH----------HHHHHHhh
Q psy16925        129 FANGSNCRSHKRRMHPEEL----------KLYESSLG  155 (166)
Q Consensus       129 f~~~~~l~~H~~~~h~~~~----------~~~c~~c~  155 (166)
                      |.+..+|..|++.+|..+.          -|.|+.||
T Consensus       183 ftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg  219 (267)
T KOG3576|consen  183 FTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCG  219 (267)
T ss_pred             HHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccC
Confidence            9999999999998885432          23377776


No 9  
>KOG3608|consensus
Probab=99.56  E-value=2e-15  Score=108.30  Aligned_cols=129  Identities=19%  Similarity=0.394  Sum_probs=105.1

Q ss_pred             ccchh--hhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcC--CCCCccCCcCCccccc------
Q psy16925         22 KYSLA--LMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHS--DDAPWKCDICSKKSLK------   91 (166)
Q Consensus        22 ~~~C~--~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~--~~~~~~c~~C~~~~~~------   91 (166)
                      .+.|.  .|.+.+.++..|..|++ .|++++...|+.||..|.+...|.+|++..+  ...+|.|..|.+.|.+      
T Consensus       177 v~~C~W~~Ct~~~~~k~~LreH~r-~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~  255 (467)
T KOG3608|consen  177 VTMCNWAMCTKHMGNKYRLREHIR-THSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKS  255 (467)
T ss_pred             eeeccchhhhhhhccHHHHHHHHH-hcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHH
Confidence            35565  89999999999999998 8999999999999999999999999976644  4578999999888865      


Q ss_pred             --------cccccCCCcCCCchhHHHHhhh-hcCCCCcccCcccccccCChhhhhhhhhhcchhHHHHHHH
Q psy16925         92 --------LSNVSCGWYPDESKDLKNHHNL-HTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESS  153 (166)
Q Consensus        92 --------~~c~~c~~~f~~~~~l~~H~~~-h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~  153 (166)
                              ..|+.|.-.....+.|..|++. |..++||+|..|++.|.+.++|..|... |. +-.|.|+.
T Consensus       256 Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~-HS-~~~y~C~h  324 (467)
T KOG3608|consen  256 HVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQV-HS-KTVYQCEH  324 (467)
T ss_pred             HHHHhhhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHh-cc-ccceecCC
Confidence                    3888888888888889888875 6678888888888888888888888763 54 32444444


No 10 
>KOG3608|consensus
Probab=99.50  E-value=1.2e-14  Score=104.28  Aligned_cols=126  Identities=25%  Similarity=0.500  Sum_probs=79.8

Q ss_pred             ccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhH-cCCCCCccCCcCCccccccccccCCCc
Q psy16925         22 KYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTI-HSDDAPWKCDICSKKSLKLSNVSCGWY  100 (166)
Q Consensus        22 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~C~~~~~~~~c~~c~~~  100 (166)
                      .|.|..|-++|.++..|..|+. .|.+  -|+|+.|+.+....++|..|++. |..++||+|+.|...+           
T Consensus       237 ~fqC~~C~KrFaTeklL~~Hv~-rHvn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c-----------  302 (467)
T KOG3608|consen  237 SFQCAQCFKRFATEKLLKSHVV-RHVN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRC-----------  302 (467)
T ss_pred             chHHHHHHHHHhHHHHHHHHHH-Hhhh--cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhh-----------
Confidence            4666666666666666666654 2332  35666777666666667666543 5666777776655544           


Q ss_pred             CCCchhHHHHhhhhcCCCCcccCc--ccccccCChhhhhhhhhhcch--hHHHHHHHhhhhhhhhcc
Q psy16925        101 PDESKDLKNHHNLHTGKRPYTCPW--CSRTFANGSNCRSHKRRMHPE--ELKLYESSLGKIFLYGKM  163 (166)
Q Consensus       101 f~~~~~l~~H~~~h~~~~p~~C~~--C~~~f~~~~~l~~H~~~~h~~--~~~~~c~~c~~~f~~~~~  163 (166)
                       .+.++|..|...|+ +..|.|..  |..+|.+..++.+|++.+|.|  +.+|.|--|.+.|...+.
T Consensus       303 -~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~  367 (467)
T KOG3608|consen  303 -VRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKS  367 (467)
T ss_pred             -ccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchh
Confidence             66667777776665 44567755  777777777777777766644  345556667776665543


No 11 
>KOG3993|consensus
Probab=99.14  E-value=9.9e-12  Score=91.35  Aligned_cols=99  Identities=19%  Similarity=0.300  Sum_probs=71.1

Q ss_pred             cCCCCCccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCCcc---------C----
Q psy16925         16 NASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWK---------C----   82 (166)
Q Consensus        16 ~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~---------c----   82 (166)
                      ..+.+|.|+|+.|...|.+...|.+|. ......-.|+|+.|++.|+...+|..|.++|.....--         -    
T Consensus       261 i~n~iGdyiCqLCK~kYeD~F~LAQHr-C~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~r  339 (500)
T KOG3993|consen  261 IPNVIGDYICQLCKEKYEDAFALAQHR-CPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETR  339 (500)
T ss_pred             CcccHHHHHHHHHHHhhhhHHHHhhcc-CCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhh
Confidence            345678899999999999999999995 35566677999999999999999999999996422100         0    


Q ss_pred             ------CcCC--ccccccccccCCCcCCCchhHHHHhhhhc
Q psy16925         83 ------DICS--KKSLKLSNVSCGWYPDESKDLKNHHNLHT  115 (166)
Q Consensus        83 ------~~C~--~~~~~~~c~~c~~~f~~~~~l~~H~~~h~  115 (166)
                            ..-|  ..-....|..|++.|.....|+.|+.+|.
T Consensus       340 ae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  340 AEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             hhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                  0000  01112367777777777777777766554


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.08  E-value=2.9e-10  Score=88.17  Aligned_cols=117  Identities=17%  Similarity=0.319  Sum_probs=73.3

Q ss_pred             CCCCCccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCcccccccccc
Q psy16925         17 ASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVS   96 (166)
Q Consensus        17 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~   96 (166)
                      .....-+.|+.|++.|. ...|..|... +.  .++.|+ |+..+ ....|..|+..|.+.+++.|..|+..+.....  
T Consensus       448 ~el~~H~~C~~Cgk~f~-~s~LekH~~~-~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~--  519 (567)
T PLN03086        448 EEAKNHVHCEKCGQAFQ-QGEMEKHMKV-FH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGS--  519 (567)
T ss_pred             cccccCccCCCCCCccc-hHHHHHHHHh-cC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCcc--
Confidence            33344467888888775 5677888763 42  677787 87644 55777778777777888888877765521000  


Q ss_pred             CCCcC-CCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhhhcc
Q psy16925         97 CGWYP-DESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHP  144 (166)
Q Consensus        97 c~~~f-~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~  144 (166)
                       ...+ ...+.|..|.... +.+++.|..||+.+..+ .+..|+..+|.
T Consensus       520 -~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        520 -AMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             -ccchhhhhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHHhhc
Confidence             0000 0234577777664 77778888888777655 35677766553


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.07  E-value=4.5e-11  Score=92.57  Aligned_cols=124  Identities=17%  Similarity=0.326  Sum_probs=92.8

Q ss_pred             CCccchhhhhhhcCChHHHHHHHHHhhcC------------------CCCeecccchhhcCChHHHHHHHhHcCCCCCcc
Q psy16925         20 LGKYSLALMVTRFSSRSAVTAHTKAVHLG------------------ERPFVCHECGQSFASKGILQEHLTIHSDDAPWK   81 (166)
Q Consensus        20 ~~~~~C~~C~~~~~~~~~l~~H~~~~h~~------------------~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~   81 (166)
                      .....|..|... .....|..|....-..                  +..+.|+.|++.|. ...|..|+..++  .++.
T Consensus       405 ~~~V~C~NC~~~-i~l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~  480 (567)
T PLN03086        405 VDTVECRNCKHY-IPSRSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQ  480 (567)
T ss_pred             CCeEECCCCCCc-cchhHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCcc
Confidence            445679999885 5556666886522111                  24467889999885 577889988764  6778


Q ss_pred             CCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCcccCcccccccC----------ChhhhhhhhhhcchhHHHHH
Q psy16925         82 CDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFAN----------GSNCRSHKRRMHPEELKLYE  151 (166)
Q Consensus        82 c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~----------~~~l~~H~~~~h~~~~~~~c  151 (166)
                      |+ |+..+             ....|..|+.+|..++|+.|+.|++.|..          .+.|..|...  -|.+++.|
T Consensus       481 Cp-Cg~~~-------------~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~--CG~rt~~C  544 (567)
T PLN03086        481 CP-CGVVL-------------EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI--CGSRTAPC  544 (567)
T ss_pred             CC-CCCCc-------------chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh--cCCcceEc
Confidence            87 76432             45789999999999999999999999852          3478899886  37789999


Q ss_pred             HHhhhhhhhhcc
Q psy16925        152 SSLGKIFLYGKM  163 (166)
Q Consensus       152 ~~c~~~f~~~~~  163 (166)
                      ..||+.|.-+-|
T Consensus       545 ~~Cgk~Vrlrdm  556 (567)
T PLN03086        545 DSCGRSVMLKEM  556 (567)
T ss_pred             cccCCeeeehhH
Confidence            999998876554


No 14 
>PHA00733 hypothetical protein
Probab=99.06  E-value=1.8e-10  Score=73.69  Aligned_cols=83  Identities=20%  Similarity=0.384  Sum_probs=62.3

Q ss_pred             CCCCeecccchhhcCChHHHHHH--HhH---cCCCCCccCCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCccc
Q psy16925         48 GERPFVCHECGQSFASKGILQEH--LTI---HSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTC  122 (166)
Q Consensus        48 ~~~~~~C~~C~~~f~~~~~l~~h--~~~---h~~~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C  122 (166)
                      ..+++.|.+|...|.....|..+  ...   +.+++||.|+.|++.            |...+.|..|++.+  +.+|.|
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~------------Fss~s~L~~H~r~h--~~~~~C  102 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMP------------FSSSVSLKQHIRYT--EHSKVC  102 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCc------------CCCHHHHHHHHhcC--CcCccC
Confidence            45678888888888877766655  222   234677888775554            47888888998865  457999


Q ss_pred             CcccccccCChhhhhhhhhhcc
Q psy16925        123 PWCSRTFANGSNCRSHKRRMHP  144 (166)
Q Consensus       123 ~~C~~~f~~~~~l~~H~~~~h~  144 (166)
                      +.|++.|.....|..|+...|.
T Consensus       103 ~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        103 PVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCHHHHHHHHHHhcC
Confidence            9999999999999999887663


No 15 
>PHA00733 hypothetical protein
Probab=98.88  E-value=5.1e-09  Score=66.99  Aligned_cols=83  Identities=16%  Similarity=0.233  Sum_probs=63.1

Q ss_pred             CCccchhhhhhhcCChHHHHHH--HH--HhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccc
Q psy16925         20 LGKYSLALMVTRFSSRSAVTAH--TK--AVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNV   95 (166)
Q Consensus        20 ~~~~~C~~C~~~~~~~~~l~~H--~~--~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~   95 (166)
                      .+.+.|.+|...+.....|..+  +.  ..+.+.+||.|..|++.|.....|..|++.+  +.++.|..|+         
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~Cg---------  106 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCG---------  106 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCC---------
Confidence            4568999999988887766665  11  1234578999999999999999999999876  3456776655         


Q ss_pred             cCCCcCCCchhHHHHhhhhcC
Q psy16925         96 SCGWYPDESKDLKNHHNLHTG  116 (166)
Q Consensus        96 ~c~~~f~~~~~l~~H~~~h~~  116 (166)
                         +.|.....|..|+...++
T Consensus       107 ---K~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        107 ---KEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             ---CccCCHHHHHHHHHHhcC
Confidence               555788889999876543


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.86  E-value=1.5e-09  Score=58.00  Aligned_cols=42  Identities=17%  Similarity=0.155  Sum_probs=29.0

Q ss_pred             ccccCCCcCCCchhHHHHhhhhcCCCCcccCcccccccCChhhh
Q psy16925         93 SNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCR  136 (166)
Q Consensus        93 ~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~  136 (166)
                      .|+.||+.|...+.|..|+++|+  +|++|..|++.|...+.|.
T Consensus         7 ~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          7 ECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             CcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            45556666677777777777776  5677777777777666653


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.82  E-value=2.5e-09  Score=49.03  Aligned_cols=26  Identities=46%  Similarity=1.262  Sum_probs=21.6

Q ss_pred             hHHHHhhhhcCCCCcccCcccccccC
Q psy16925        106 DLKNHHNLHTGKRPYTCPWCSRTFAN  131 (166)
Q Consensus       106 ~l~~H~~~h~~~~p~~C~~C~~~f~~  131 (166)
                      +|..|+++|++++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            36788888999999999999988863


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.76  E-value=3.8e-09  Score=56.49  Aligned_cols=43  Identities=14%  Similarity=0.232  Sum_probs=31.4

Q ss_pred             ccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHH
Q psy16925         22 KYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGIL   67 (166)
Q Consensus        22 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l   67 (166)
                      .|.|++|++.|+..+.|..|++ .|+  ++++|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r-~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLR-KHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHH-hcC--CcccCCcccceeccccee
Confidence            4778888888888888888876 466  577777777777766554


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.41  E-value=2.1e-07  Score=42.56  Aligned_cols=24  Identities=42%  Similarity=1.045  Sum_probs=14.9

Q ss_pred             HHHHHHHhhcCCCCeecccchhhcC
Q psy16925         38 VTAHTKAVHLGERPFVCHECGQSFA   62 (166)
Q Consensus        38 l~~H~~~~h~~~~~~~C~~C~~~f~   62 (166)
                      |..|++ .|++++||.|+.|++.|.
T Consensus         2 l~~H~~-~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMR-THTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHH-HHSSSSSEEESSSSEEES
T ss_pred             HHHHhh-hcCCCCCCCCCCCcCeeC
Confidence            556665 566666666666666654


No 20 
>PHA00616 hypothetical protein
Probab=98.32  E-value=3.8e-07  Score=46.50  Aligned_cols=33  Identities=24%  Similarity=0.422  Sum_probs=19.0

Q ss_pred             CeecccchhhcCChHHHHHHHhHcCCCCCccCC
Q psy16925         51 PFVCHECGQSFASKGILQEHLTIHSDDAPWKCD   83 (166)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~   83 (166)
                      ||.|+.||+.|.+.++|..|++.|++++++.++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            355566666666666666665555555555543


No 21 
>PHA00732 hypothetical protein
Probab=98.18  E-value=4e-07  Score=53.15  Aligned_cols=42  Identities=26%  Similarity=0.469  Sum_probs=32.1

Q ss_pred             cccCCCcCCCchhHHHHhhh-hcCCCCcccCcccccccCChhhhhhhhh
Q psy16925         94 NVSCGWYPDESKDLKNHHNL-HTGKRPYTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus        94 c~~c~~~f~~~~~l~~H~~~-h~~~~p~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      |..|++.|.....|..|++. |.   ++.|+.|++.|.   .+..|.+.
T Consensus         4 C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          4 CPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhcc
Confidence            55677777889999999874 54   368999999998   46778754


No 22 
>KOG3993|consensus
Probab=98.10  E-value=5e-07  Score=67.15  Aligned_cols=83  Identities=18%  Similarity=0.447  Sum_probs=61.7

Q ss_pred             eecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCCcCCCchhHHHHhhhhc----------------
Q psy16925         52 FVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHT----------------  115 (166)
Q Consensus        52 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~----------------  115 (166)
                      |.|+.|...|.+...|.+|.-.......|+|+.|++.|            .-..+|..|.|=|.                
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVF------------sCPANLASHRRWHKPR~eaa~a~~~P~k~~  335 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVF------------SCPANLASHRRWHKPRPEAAKAGSPPPKQA  335 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccc------------cCchhhhhhhcccCCchhhhhcCCCChhhh
Confidence            89999999999999999985444444567777766665            44555555554332                


Q ss_pred             -----------------CCCCcccCcccccccCChhhhhhhhhhcchh
Q psy16925        116 -----------------GKRPYTCPWCSRTFANGSNCRSHKRRMHPEE  146 (166)
Q Consensus       116 -----------------~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~  146 (166)
                                       .+.-|.|..|++.|.+...|+.|+..||..+
T Consensus       336 ~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  336 VETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             hhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence                             1224899999999999999999998877654


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.98  E-value=1.2e-05  Score=43.60  Aligned_cols=50  Identities=22%  Similarity=0.326  Sum_probs=38.2

Q ss_pred             ccchhhhhhhcCChHHHHHHHHHhhcCC-CCeecccchhhcCChHHHHHHHhHc
Q psy16925         22 KYSLALMVTRFSSRSAVTAHTKAVHLGE-RPFVCHECGQSFASKGILQEHLTIH   74 (166)
Q Consensus        22 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~-~~~~C~~C~~~f~~~~~l~~h~~~h   74 (166)
                      .|.|++|++ --+...|..|....|..+ +.+.|++|...+.  .+|..|+..+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            478999999 566788999988778765 4688999988654  3788887654


No 24 
>PHA00732 hypothetical protein
Probab=97.90  E-value=5.2e-06  Score=48.47  Aligned_cols=43  Identities=19%  Similarity=0.336  Sum_probs=22.3

Q ss_pred             cchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHH
Q psy16925         23 YSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHL   71 (166)
Q Consensus        23 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~   71 (166)
                      |.|..|++.|.+...|..|++..|.   ++.|+.|++.|.   .+..|+
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~   44 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHF   44 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhh
Confidence            4556666666666666665542233   234555555554   344444


No 25 
>PHA00616 hypothetical protein
Probab=97.87  E-value=1.1e-05  Score=41.16  Aligned_cols=34  Identities=12%  Similarity=0.029  Sum_probs=30.2

Q ss_pred             ccchhhhhhhcCChHHHHHHHHHhhcCCCCeeccc
Q psy16925         22 KYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHE   56 (166)
Q Consensus        22 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~   56 (166)
                      .|.|..|++.|..+.+|..|++ .|++++++.|..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r-~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLL-SVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHH-HhcCCCccceeE
Confidence            3789999999999999999997 688889988764


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.85  E-value=5.3e-06  Score=36.59  Aligned_cols=22  Identities=45%  Similarity=1.062  Sum_probs=18.5

Q ss_pred             cccCcccccccCChhhhhhhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5788888888888888888875


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.83  E-value=6.7e-06  Score=37.80  Aligned_cols=26  Identities=38%  Similarity=0.739  Sum_probs=22.3

Q ss_pred             CcccCcccccccCChhhhhhhhhhcc
Q psy16925        119 PYTCPWCSRTFANGSNCRSHKRRMHP  144 (166)
Q Consensus       119 p~~C~~C~~~f~~~~~l~~H~~~~h~  144 (166)
                      ||.|..|++.|.....|..|++.++.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            58899999999999999999887654


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.81  E-value=7.9e-06  Score=36.23  Aligned_cols=24  Identities=38%  Similarity=0.902  Sum_probs=18.2

Q ss_pred             cccCcccccccCChhhhhhhhhhc
Q psy16925        120 YTCPWCSRTFANGSNCRSHKRRMH  143 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~~h  143 (166)
                      |.|+.|++.|.....|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578888888888888888888765


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.76  E-value=1.9e-05  Score=34.77  Aligned_cols=20  Identities=45%  Similarity=0.889  Sum_probs=9.9

Q ss_pred             ecccchhhcCChHHHHHHHh
Q psy16925         53 VCHECGQSFASKGILQEHLT   72 (166)
Q Consensus        53 ~C~~C~~~f~~~~~l~~h~~   72 (166)
                      .|+.|++.|.....|..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    2 KCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCccCCHHHHHHHHh
Confidence            44455555555555555544


No 30 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.53  E-value=0.00015  Score=39.18  Aligned_cols=47  Identities=26%  Similarity=0.408  Sum_probs=32.1

Q ss_pred             cccCCCcCCCchhHHHHhhh-hcCC-CCcccCcccccccCChhhhhhhhhhc
Q psy16925         94 NVSCGWYPDESKDLKNHHNL-HTGK-RPYTCPWCSRTFANGSNCRSHKRRMH  143 (166)
Q Consensus        94 c~~c~~~f~~~~~l~~H~~~-h~~~-~p~~C~~C~~~f~~~~~l~~H~~~~h  143 (166)
                      ||.|++ -.+...|..|... |..+ +.+.||+|...+.  .+|..|+...|
T Consensus         5 CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    5 CPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            344444 2456779999765 4443 4689999988654  48889988766


No 31 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.37  E-value=9.6e-05  Score=53.44  Aligned_cols=44  Identities=23%  Similarity=0.500  Sum_probs=30.5

Q ss_pred             CCCcCCCchhHHHHhhhhc-------------------CCCCcccCcccccccCChhhhhhhh
Q psy16925         97 CGWYPDESKDLKNHHNLHT-------------------GKRPYTCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus        97 c~~~f~~~~~l~~H~~~h~-------------------~~~p~~C~~C~~~f~~~~~l~~H~~  140 (166)
                      |++.+++...|+-|+..-+                   ..|||+|++|++.|.....|..|..
T Consensus       357 C~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         357 CNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             chhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            6666666666666543211                   3578889889988888888888865


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.34  E-value=0.0002  Score=43.52  Aligned_cols=74  Identities=18%  Similarity=0.192  Sum_probs=16.1

Q ss_pred             chhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCCcCCC
Q psy16925         24 SLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDE  103 (166)
Q Consensus        24 ~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f~~  103 (166)
                      .|..|+..|.+...|..|+...|.-..+     ....+.....+....+.. ....+.|..            |++.|.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~-----~~~~l~~~~~~~~~~~~~-~~~~~~C~~------------C~~~f~s   62 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP-----DQKYLVDPNRLLNYLRKK-VKESFRCPY------------CNKTFRS   62 (100)
T ss_dssp             ------------------------------------------------------SSEEBSS------------SS-EESS
T ss_pred             Cccccccccccccccccccccccccccc-----cccccccccccccccccc-cCCCCCCCc------------cCCCCcC
Confidence            4899999999999999999877764433     111111222233222211 112455555            4444578


Q ss_pred             chhHHHHhhhhc
Q psy16925        104 SKDLKNHHNLHT  115 (166)
Q Consensus       104 ~~~l~~H~~~h~  115 (166)
                      ...|..|++.+.
T Consensus        63 ~~~l~~Hm~~~~   74 (100)
T PF12756_consen   63 REALQEHMRSKH   74 (100)
T ss_dssp             HHHHHHHHHHTT
T ss_pred             HHHHHHHHcCcc
Confidence            888888888653


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.27  E-value=0.00015  Score=31.84  Aligned_cols=20  Identities=20%  Similarity=0.350  Sum_probs=9.3

Q ss_pred             chhhhhhhcCChHHHHHHHH
Q psy16925         24 SLALMVTRFSSRSAVTAHTK   43 (166)
Q Consensus        24 ~C~~C~~~~~~~~~l~~H~~   43 (166)
                      .|++|+..|.+...|..|+.
T Consensus         2 ~C~~C~~~~~~~~~l~~H~~   21 (24)
T PF13894_consen    2 QCPICGKSFRSKSELRQHMR   21 (24)
T ss_dssp             E-SSTS-EESSHHHHHHHHH
T ss_pred             CCcCCCCcCCcHHHHHHHHH
Confidence            45555555555555555544


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.27  E-value=0.00019  Score=32.79  Aligned_cols=24  Identities=50%  Similarity=1.028  Sum_probs=13.3

Q ss_pred             CeecccchhhcCChHHHHHHHhHc
Q psy16925         51 PFVCHECGQSFASKGILQEHLTIH   74 (166)
Q Consensus        51 ~~~C~~C~~~f~~~~~l~~h~~~h   74 (166)
                      ||.|..|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            355555555555555555555443


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.18  E-value=9.5e-05  Score=53.49  Aligned_cols=49  Identities=18%  Similarity=0.343  Sum_probs=40.3

Q ss_pred             CCCCcccCc--ccccccCChhhhhhhhhhc------------------chhHHHHHHHhhhhhhhhccc
Q psy16925        116 GKRPYTCPW--CSRTFANGSNCRSHKRRMH------------------PEELKLYESSLGKIFLYGKMK  164 (166)
Q Consensus       116 ~~~p~~C~~--C~~~f~~~~~l~~H~~~~h------------------~~~~~~~c~~c~~~f~~~~~~  164 (166)
                      +++||+|++  |.+.|.....|..|+...|                  .++.||.|+.|+|+++.-+++
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGL  414 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGL  414 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccc
Confidence            369999977  9999999999999988666                  233799999999999765543


No 36 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.97  E-value=0.00036  Score=42.41  Aligned_cols=73  Identities=23%  Similarity=0.368  Sum_probs=21.6

Q ss_pred             ecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCcccCcccccccCC
Q psy16925         53 VCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANG  132 (166)
Q Consensus        53 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~  132 (166)
                      .|..|+..|.....|..|+....+-..-....                +.....+..+++. ....++.|..|++.|...
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~----------------l~~~~~~~~~~~~-~~~~~~~C~~C~~~f~s~   63 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKY----------------LVDPNRLLNYLRK-KVKESFRCPYCNKTFRSR   63 (100)
T ss_dssp             -----------------------------------------------------------------SSEEBSSSS-EESSH
T ss_pred             Cccccccccccccccccccccccccccccccc----------------ccccccccccccc-ccCCCCCCCccCCCCcCH
Confidence            48899999999999999987665432110000                0122223333322 122369999999999999


Q ss_pred             hhhhhhhhhh
Q psy16925        133 SNCRSHKRRM  142 (166)
Q Consensus       133 ~~l~~H~~~~  142 (166)
                      ..|..|++.+
T Consensus        64 ~~l~~Hm~~~   73 (100)
T PF12756_consen   64 EALQEHMRSK   73 (100)
T ss_dssp             HHHHHHHHHT
T ss_pred             HHHHHHHcCc
Confidence            9999999854


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.94  E-value=0.00045  Score=36.16  Aligned_cols=41  Identities=29%  Similarity=0.483  Sum_probs=23.3

Q ss_pred             HHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCC
Q psy16925         39 TAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAP   79 (166)
Q Consensus        39 ~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~   79 (166)
                      ..+.+.....+.|.+|++|+..+.+..+|.+|+....+.+|
T Consensus        12 ~~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   12 TKKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             ----CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            33444345567788899999999999999999877655554


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.85  E-value=0.00059  Score=30.38  Aligned_cols=22  Identities=36%  Similarity=0.845  Sum_probs=18.7

Q ss_pred             cccCcccccccCChhhhhhhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      |.|+.|++.|.....|..|++.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHH
Confidence            5788899999999999998874


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.72  E-value=0.0006  Score=35.67  Aligned_cols=31  Identities=29%  Similarity=0.537  Sum_probs=21.9

Q ss_pred             hcCCCCcccCcccccccCChhhhhhhhhhcc
Q psy16925        114 HTGKRPYTCPWCSRTFANGSNCRSHKRRMHP  144 (166)
Q Consensus       114 h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~  144 (166)
                      ...+.|-.||+|+..+....+|++|+...|.
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            3457789999999999999999999987674


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.69  E-value=0.00057  Score=30.26  Aligned_cols=24  Identities=46%  Similarity=0.944  Sum_probs=17.2

Q ss_pred             cccCcccccccCChhhhhhhhhhcc
Q psy16925        120 YTCPWCSRTFANGSNCRSHKRRMHP  144 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~~h~  144 (166)
                      |+|+.|+.... ...|..|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            57888888877 7788888887663


No 41 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.63  E-value=0.0019  Score=28.63  Aligned_cols=21  Identities=48%  Similarity=0.941  Sum_probs=10.4

Q ss_pred             ecccchhhcCChHHHHHHHhH
Q psy16925         53 VCHECGQSFASKGILQEHLTI   73 (166)
Q Consensus        53 ~C~~C~~~f~~~~~l~~h~~~   73 (166)
                      .|..|++.|.....|..|++.
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHH
Confidence            344555555555555555443


No 42 
>KOG2231|consensus
Probab=96.27  E-value=0.0099  Score=47.86  Aligned_cols=105  Identities=17%  Similarity=0.234  Sum_probs=66.2

Q ss_pred             chhhhhhhcCChHHHHHHHHHhhcCCCCeecccch---------hhcCChHHHHHHHhHcCCCCCccCCcCCccccc-cc
Q psy16925         24 SLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECG---------QSFASKGILQEHLTIHSDDAPWKCDICSKKSLK-LS   93 (166)
Q Consensus        24 ~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~---------~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~-~~   93 (166)
                      .|..| -.|.+...|..|+...|..   +.|.+|-         ...-+...|..|++.-..        +.+.+.. ..
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~~---~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~--------d~~s~rGhp~  184 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHKL---HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDP--------DDESCRGHPL  184 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhhh---hccccccccceeeeeeeehehHHHHHHHHhcCCC--------ccccccCCcc
Confidence            45555 4556888999998755542   3333333         222334566666553221        3333433 56


Q ss_pred             cccCCCcCCCchhHHHHhhhhcCCCCcccCcc------cccccCChhhhhhhhhhcc
Q psy16925         94 NVSCGWYPDESKDLKNHHNLHTGKRPYTCPWC------SRTFANGSNCRSHKRRMHP  144 (166)
Q Consensus        94 c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C------~~~f~~~~~l~~H~~~~h~  144 (166)
                      |..|...|.....+..|++.++    |.|..|      +..|.....|..|.+..|.
T Consensus       185 C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~Hf  237 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGHF  237 (669)
T ss_pred             chhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcCc
Confidence            7778888888888999988654    455555      3457788889999888774


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.16  E-value=0.0021  Score=28.62  Aligned_cols=22  Identities=27%  Similarity=0.766  Sum_probs=17.6

Q ss_pred             cccCcccccccCChhhhhhhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      |.|..|++.|.....|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4688888888888888888763


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.97  E-value=0.003  Score=28.09  Aligned_cols=21  Identities=19%  Similarity=0.376  Sum_probs=11.9

Q ss_pred             cchhhhhhhcCChHHHHHHHH
Q psy16925         23 YSLALMVTRFSSRSAVTAHTK   43 (166)
Q Consensus        23 ~~C~~C~~~~~~~~~l~~H~~   43 (166)
                      |.|.+|...|.+...+..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            345555556666655555554


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.96  E-value=0.0037  Score=28.47  Aligned_cols=22  Identities=18%  Similarity=0.629  Sum_probs=19.3

Q ss_pred             cccCcccccccCChhhhhhhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999863


No 46 
>KOG2893|consensus
Probab=95.77  E-value=0.0044  Score=43.33  Aligned_cols=52  Identities=21%  Similarity=0.382  Sum_probs=41.0

Q ss_pred             cccccCCCcCCCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhhhcchhH
Q psy16925         92 LSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEEL  147 (166)
Q Consensus        92 ~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~  147 (166)
                      ..|..|++.|.+...|++|++    .+.|+|.+|.+..-+...|..|-..+|.+.+
T Consensus        11 pwcwycnrefddekiliqhqk----akhfkchichkkl~sgpglsihcmqvhketi   62 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIHCMQVHKETI   62 (341)
T ss_pred             ceeeecccccchhhhhhhhhh----hccceeeeehhhhccCCCceeehhhhhhhhh
Confidence            356778999999999999876    3459999999887778888888766776543


No 47 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.72  E-value=0.0064  Score=26.74  Aligned_cols=20  Identities=25%  Similarity=0.245  Sum_probs=9.3

Q ss_pred             cchhhhhhhcCChHHHHHHHH
Q psy16925         23 YSLALMVTRFSSRSAVTAHTK   43 (166)
Q Consensus        23 ~~C~~C~~~~~~~~~l~~H~~   43 (166)
                      |.|+.|+.... ...|..|++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~   20 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLK   20 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHH
Confidence            34555555544 555555554


No 48 
>PRK04860 hypothetical protein; Provisional
Probab=95.61  E-value=0.0093  Score=39.72  Aligned_cols=29  Identities=21%  Similarity=0.517  Sum_probs=24.2

Q ss_pred             hhHHHHhhhhcCCCCcccCcccccccCCh
Q psy16925        105 KDLKNHHNLHTGKRPYTCPWCSRTFANGS  133 (166)
Q Consensus       105 ~~l~~H~~~h~~~~p~~C~~C~~~f~~~~  133 (166)
                      ..+..|.++++++++|.|..|+..|....
T Consensus       129 ~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        129 LTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             CHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            35788999999999999999998887554


No 49 
>PRK04860 hypothetical protein; Provisional
Probab=94.78  E-value=0.011  Score=39.41  Aligned_cols=37  Identities=19%  Similarity=0.608  Sum_probs=26.4

Q ss_pred             CCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCcccc
Q psy16925         50 RPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSL   90 (166)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~   90 (166)
                      -+|.|. |+.   ....+.+|.++|+++++|.|..|+..+.
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~  154 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLV  154 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeE
Confidence            357776 776   5566777777888878888877776653


No 50 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.26  E-value=0.028  Score=25.07  Aligned_cols=20  Identities=35%  Similarity=0.865  Sum_probs=13.2

Q ss_pred             cccCcccccccCChhhhhhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~  140 (166)
                      ..|+.||+.| ....|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4677777777 4555666654


No 51 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.21  E-value=0.027  Score=27.08  Aligned_cols=22  Identities=27%  Similarity=0.353  Sum_probs=13.6

Q ss_pred             ccchhhhhhhcCChHHHHHHHH
Q psy16925         22 KYSLALMVTRFSSRSAVTAHTK   43 (166)
Q Consensus        22 ~~~C~~C~~~~~~~~~l~~H~~   43 (166)
                      .|.|++|...|.+...+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4566666666666666666654


No 52 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.36  E-value=0.0089  Score=45.65  Aligned_cols=130  Identities=28%  Similarity=0.390  Sum_probs=89.5

Q ss_pred             CccchhhhhhhcCChHHHHHHHHH-hhcCC--CCeecc--cchhhcCChHHHHHHHhHcCCCCCccCCc--CCcccccc-
Q psy16925         21 GKYSLALMVTRFSSRSAVTAHTKA-VHLGE--RPFVCH--ECGQSFASKGILQEHLTIHSDDAPWKCDI--CSKKSLKL-   92 (166)
Q Consensus        21 ~~~~C~~C~~~~~~~~~l~~H~~~-~h~~~--~~~~C~--~C~~~f~~~~~l~~h~~~h~~~~~~~c~~--C~~~~~~~-   92 (166)
                      ..+.|..|...|+....+..|... .|..+  +++.|+  .|++.|.....+..|...|....+..+..  +...+... 
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            368899999999999999999875 68999  999999  79999999999999988888766554432  22222111 


Q ss_pred             ----------------------ccccCCCcCCCchhHHHHhhhhcCCC--CcccCcccccccCChhhhhhhhhhcchhHH
Q psy16925         93 ----------------------SNVSCGWYPDESKDLKNHHNLHTGKR--PYTCPWCSRTFANGSNCRSHKRRMHPEELK  148 (166)
Q Consensus        93 ----------------------~c~~c~~~f~~~~~l~~H~~~h~~~~--p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  148 (166)
                                            .-..|...+.....+..|...+....  .+.+..|...|.....+..|++. |....+
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~  446 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKI-HTNHAP  446 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccc-cccCCc
Confidence                                  11124444445555555555555444  35668888888888888888775 433334


Q ss_pred             HHH
Q psy16925        149 LYE  151 (166)
Q Consensus       149 ~~c  151 (166)
                      ..+
T Consensus       447 ~~~  449 (467)
T COG5048         447 LLC  449 (467)
T ss_pred             eee
Confidence            333


No 53 
>KOG1146|consensus
Probab=92.96  E-value=0.023  Score=48.81  Aligned_cols=104  Identities=15%  Similarity=0.283  Sum_probs=69.0

Q ss_pred             cchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCCcCC
Q psy16925         23 YSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPD  102 (166)
Q Consensus        23 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f~  102 (166)
                      -.|.-+.-.+.....+..|+...++..+.++|+.|++.|.....|..|++.-+.+-.-  ..|..+-             
T Consensus       437 ~e~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~~gq-------------  501 (1406)
T KOG1146|consen  437 VELTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCKAGQ-------------  501 (1406)
T ss_pred             ccccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccch--hHhHhcc-------------
Confidence            3455566677777777777776777788899999999999999999998874433211  2221100             


Q ss_pred             CchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhh
Q psy16925        103 ESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus       103 ~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      +.-.+..-...-.+.+||.|..|..++....+|..|+..
T Consensus       502 ~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  502 NHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            000000001112346789999999999999999999873


No 54 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.84  E-value=0.28  Score=30.55  Aligned_cols=91  Identities=13%  Similarity=0.114  Sum_probs=50.0

Q ss_pred             CCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCcccCccccc
Q psy16925         49 ERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRT  128 (166)
Q Consensus        49 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~  128 (166)
                      +.|..|+.|+-+.-...+|.+....--+-.+|.=....+...+..|-.|...|........  ..-.....|+|+.|...
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~   90 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNV   90 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCc
Confidence            4566788888777777777654322222233321111122222345566666654321100  00122346999999999


Q ss_pred             ccCChhhhhhhhh
Q psy16925        129 FANGSNCRSHKRR  141 (166)
Q Consensus       129 f~~~~~l~~H~~~  141 (166)
                      |-...+.-.|...
T Consensus        91 FC~dCD~fiHe~L  103 (112)
T TIGR00622        91 FCVDCDVFVHESL  103 (112)
T ss_pred             cccccchhhhhhc
Confidence            9988888888765


No 55 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.81  E-value=0.054  Score=26.00  Aligned_cols=22  Identities=23%  Similarity=0.620  Sum_probs=19.1

Q ss_pred             CcccCcccccccCChhhhhhhh
Q psy16925        119 PYTCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus       119 p~~C~~C~~~f~~~~~l~~H~~  140 (166)
                      +|.|..|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5789999999998888888876


No 56 
>KOG1146|consensus
Probab=90.49  E-value=0.053  Score=46.80  Aligned_cols=96  Identities=11%  Similarity=0.124  Sum_probs=60.9

Q ss_pred             CCCccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCC
Q psy16925         19 TLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCG   98 (166)
Q Consensus        19 ~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~   98 (166)
                      ..|.+.|..|++.+.....+. ++-    ...+|.|..|...|..+..|..|++.-        ..              
T Consensus      1257 ~sGe~~c~~~~~~~~~~~~~~-~l~----~~~~~~~~~~~~~~~~~~~l~~~~~k~--------~~-------------- 1309 (1406)
T KOG1146|consen 1257 ASGEGECGAVDELLTPSFGIS-TLD----VTHRYLCRQCKMAFDGEAPLTAHQRKF--------CF-------------- 1309 (1406)
T ss_pred             CCCcchhhhccccccCcccee-ecc----cchhHHHHHHHhhhcchhHHHHHHHHH--------Hh--------------
Confidence            357789999999888888776 543    355688999999999999998887321        00              


Q ss_pred             CcCCCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhhhc
Q psy16925         99 WYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMH  143 (166)
Q Consensus        99 ~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h  143 (166)
                       .+........+.-.+..-.+| |..|...|+....|+.|++..+
T Consensus      1310 -~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~ 1352 (1406)
T KOG1146|consen 1310 -AGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSA 1352 (1406)
T ss_pred             -ccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhh
Confidence             001111122222223334445 7777777777777777776443


No 57 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=89.79  E-value=0.11  Score=27.73  Aligned_cols=30  Identities=23%  Similarity=0.556  Sum_probs=23.2

Q ss_pred             hcCCCCcccCcccccccCChhhhhhhhhhc
Q psy16925        114 HTGKRPYTCPWCSRTFANGSNCRSHKRRMH  143 (166)
Q Consensus       114 h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h  143 (166)
                      -.||.-+.||.|+..|...-+..+|....|
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            345666889999999988888888876555


No 58 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.45  E-value=0.27  Score=23.42  Aligned_cols=11  Identities=36%  Similarity=1.102  Sum_probs=6.2

Q ss_pred             eecccchhhcC
Q psy16925         52 FVCHECGQSFA   62 (166)
Q Consensus        52 ~~C~~C~~~f~   62 (166)
                      +.|..||..+.
T Consensus         2 ~~C~~CGy~y~   12 (33)
T cd00350           2 YVCPVCGYIYD   12 (33)
T ss_pred             EECCCCCCEEC
Confidence            45666665543


No 59 
>PF12907 zf-met2:  Zinc-binding
Probab=89.10  E-value=0.4  Score=24.01  Aligned_cols=29  Identities=7%  Similarity=0.060  Sum_probs=19.7

Q ss_pred             cchhhhhh---hcCChHHHHHHHHHhhcCCCC
Q psy16925         23 YSLALMVT---RFSSRSAVTAHTKAVHLGERP   51 (166)
Q Consensus        23 ~~C~~C~~---~~~~~~~l~~H~~~~h~~~~~   51 (166)
                      +.|.+|..   ...+...|..|..+.|....+
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~   33 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTF   33 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCH
Confidence            67888884   445556788888766665433


No 60 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.18  E-value=0.34  Score=25.94  Aligned_cols=25  Identities=16%  Similarity=0.103  Sum_probs=14.6

Q ss_pred             ccchhhhhhhcCChHHHHHHHHHhh
Q psy16925         22 KYSLALMVTRFSSRSAVTAHTKAVH   46 (166)
Q Consensus        22 ~~~C~~C~~~~~~~~~l~~H~~~~h   46 (166)
                      -+.|+-|+..|....++.+|+...|
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhhHHh
Confidence            3556666666666666666655443


No 61 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.07  E-value=0.38  Score=29.87  Aligned_cols=15  Identities=33%  Similarity=0.875  Sum_probs=11.7

Q ss_pred             CCcccCcccccccCC
Q psy16925        118 RPYTCPWCSRTFANG  132 (166)
Q Consensus       118 ~p~~C~~C~~~f~~~  132 (166)
                      .|..||.||..|...
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            577888888888766


No 62 
>KOG2893|consensus
Probab=86.46  E-value=0.23  Score=35.06  Aligned_cols=49  Identities=27%  Similarity=0.387  Sum_probs=36.6

Q ss_pred             CccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHH-HhHc
Q psy16925         21 GKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEH-LTIH   74 (166)
Q Consensus        21 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h-~~~h   74 (166)
                      .+-+|=+|...|.+...|..|.++     +-|+|.+|.+...+.-.|..| ++.|
T Consensus         9 ~kpwcwycnrefddekiliqhqka-----khfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen    9 DKPWCWYCNREFDDEKILIQHQKA-----KHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             CCceeeecccccchhhhhhhhhhh-----ccceeeeehhhhccCCCceeehhhhh
Confidence            456788999999999999888663     457899998877766666666 3444


No 63 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=86.45  E-value=0.64  Score=20.88  Aligned_cols=11  Identities=36%  Similarity=0.942  Sum_probs=6.7

Q ss_pred             cccCccccccc
Q psy16925        120 YTCPWCSRTFA  130 (166)
Q Consensus       120 ~~C~~C~~~f~  130 (166)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            35666766664


No 64 
>KOG2785|consensus
Probab=85.58  E-value=2.9  Score=31.73  Aligned_cols=48  Identities=23%  Similarity=0.449  Sum_probs=36.5

Q ss_pred             ccccCCCcCCCchhHHHHhhhhcCC-CC----------------------cccCccc---ccccCChhhhhhhh
Q psy16925         93 SNVSCGWYPDESKDLKNHHNLHTGK-RP----------------------YTCPWCS---RTFANGSNCRSHKR  140 (166)
Q Consensus        93 ~c~~c~~~f~~~~~l~~H~~~h~~~-~p----------------------~~C~~C~---~~f~~~~~l~~H~~  140 (166)
                      .|.-|+..+.+-.....|+..+++- .|                      +.|-.|+   +.|......+.||.
T Consensus       168 ~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  168 DCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             ceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            5677888888888888898776642 12                      5677777   88888888888886


No 65 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=84.92  E-value=0.55  Score=33.63  Aligned_cols=90  Identities=18%  Similarity=0.334  Sum_probs=50.7

Q ss_pred             CCCeecccchhhcCChHHHHHHHhHc--CCCCCccCCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCcccCccc
Q psy16925         49 ERPFVCHECGQSFASKGILQEHLTIH--SDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCS  126 (166)
Q Consensus        49 ~~~~~C~~C~~~f~~~~~l~~h~~~h--~~~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~  126 (166)
                      .+.|.|..|..... +...-.||..-  .....|+|.-|.+ +.+.+|+.|..-|-.......-.+ -...+|+.||.|+
T Consensus       140 Grif~CsfC~~flC-EDDQFEHQAsCQvLe~E~~KC~SCNr-lGq~sCLRCK~cfCddHvrrKg~k-y~k~k~~PCPKCg  216 (314)
T PF06524_consen  140 GRIFKCSFCDNFLC-EDDQFEHQASCQVLESETFKCQSCNR-LGQYSCLRCKICFCDDHVRRKGFK-YEKGKPIPCPKCG  216 (314)
T ss_pred             CeEEEeecCCCeee-ccchhhhhhhhhhhhccccccccccc-ccchhhhheeeeehhhhhhhcccc-cccCCCCCCCCCC
Confidence            45578888774333 33333454331  2234577777765 345567666666554321111111 1234789999999


Q ss_pred             ccccCChhhhhhhhh
Q psy16925        127 RTFANGSNCRSHKRR  141 (166)
Q Consensus       127 ~~f~~~~~l~~H~~~  141 (166)
                      ........|...-+.
T Consensus       217 ~et~eTkdLSmStR~  231 (314)
T PF06524_consen  217 YETQETKDLSMSTRS  231 (314)
T ss_pred             Ccccccccceeeeec
Confidence            988777777655554


No 66 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=84.59  E-value=0.26  Score=37.61  Aligned_cols=49  Identities=24%  Similarity=0.583  Sum_probs=36.3

Q ss_pred             ccccCCCcCCCchhHHHHhh--hhcCC--CCcccC--cccccccCChhhhhhhhh
Q psy16925         93 SNVSCGWYPDESKDLKNHHN--LHTGK--RPYTCP--WCSRTFANGSNCRSHKRR  141 (166)
Q Consensus        93 ~c~~c~~~f~~~~~l~~H~~--~h~~~--~p~~C~--~C~~~f~~~~~l~~H~~~  141 (166)
                      .+..|...|.....+..|.+  .|.++  +|+.|+  .|++.|.+...+..|...
T Consensus       291 ~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~  345 (467)
T COG5048         291 KSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILL  345 (467)
T ss_pred             CCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccc
Confidence            34456677777777777877  67777  788887  688888888777777665


No 67 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=83.45  E-value=0.88  Score=21.84  Aligned_cols=10  Identities=40%  Similarity=1.099  Sum_probs=6.8

Q ss_pred             CCcccCcccc
Q psy16925        118 RPYTCPWCSR  127 (166)
Q Consensus       118 ~p~~C~~C~~  127 (166)
                      .|-.||.|+.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            4567888775


No 68 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=81.73  E-value=1.4  Score=27.30  Aligned_cols=24  Identities=33%  Similarity=0.706  Sum_probs=20.6

Q ss_pred             ccc----CcccccccCChhhhhhhhhhc
Q psy16925        120 YTC----PWCSRTFANGSNCRSHKRRMH  143 (166)
Q Consensus       120 ~~C----~~C~~~f~~~~~l~~H~~~~h  143 (166)
                      |.|    +.|++.......+..|++.+|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            788    889988888888899988766


No 69 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=81.45  E-value=1.1  Score=30.13  Aligned_cols=13  Identities=38%  Similarity=1.040  Sum_probs=9.7

Q ss_pred             cCCCCcccCcccc
Q psy16925        115 TGKRPYTCPWCSR  127 (166)
Q Consensus       115 ~~~~p~~C~~C~~  127 (166)
                      -++.|-+||+||.
T Consensus       145 ~ge~P~~CPiCga  157 (166)
T COG1592         145 EGEAPEVCPICGA  157 (166)
T ss_pred             cCCCCCcCCCCCC
Confidence            4467888999983


No 70 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=81.25  E-value=1  Score=22.82  Aligned_cols=27  Identities=26%  Similarity=0.640  Sum_probs=16.5

Q ss_pred             CCCcccCcccccccC----Chhhhhhhhhhc
Q psy16925        117 KRPYTCPWCSRTFAN----GSNCRSHKRRMH  143 (166)
Q Consensus       117 ~~p~~C~~C~~~f~~----~~~l~~H~~~~h  143 (166)
                      ..-..|..|++.+..    .+.|..|++..|
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            344678888887765    477888885545


No 71 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=80.45  E-value=1.2  Score=21.76  Aligned_cols=13  Identities=38%  Similarity=0.956  Sum_probs=8.1

Q ss_pred             CCcccCccccccc
Q psy16925        118 RPYTCPWCSRTFA  130 (166)
Q Consensus       118 ~p~~C~~C~~~f~  130 (166)
                      ...+|+.|+..|.
T Consensus        24 ~~vrC~~C~~~f~   36 (37)
T PF13719_consen   24 RKVRCPKCGHVFR   36 (37)
T ss_pred             cEEECCCCCcEee
Confidence            3467777776653


No 72 
>KOG2231|consensus
Probab=79.91  E-value=2.2  Score=35.05  Aligned_cols=76  Identities=18%  Similarity=0.266  Sum_probs=47.8

Q ss_pred             CChHHHHHHH-hHcCCCCCccCCcCCccccccccccCCCcCCCchhHHHHhhhhcC-CC----CcccCcccccccCChhh
Q psy16925         62 ASKGILQEHL-TIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTG-KR----PYTCPWCSRTFANGSNC  135 (166)
Q Consensus        62 ~~~~~l~~h~-~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~-~~----p~~C~~C~~~f~~~~~l  135 (166)
                      .....|..|+ ..|.   .+.|..|.......   ++-........|..|+..... ++    ...|..|...|.....|
T Consensus       125 ~s~~~Lk~H~~~~H~---~~~c~lC~~~~kif---~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el  198 (669)
T KOG2231|consen  125 KSVENLKNHMRDQHK---LHLCSLCLQNLKIF---INERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDEL  198 (669)
T ss_pred             hHHHHHHHHHHHhhh---hhccccccccceee---eeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHH
Confidence            3667888887 4453   34455554332111   123333456778888765332 22    24689999999999999


Q ss_pred             hhhhhhhc
Q psy16925        136 RSHKRRMH  143 (166)
Q Consensus       136 ~~H~~~~h  143 (166)
                      ..|++..|
T Consensus       199 ~rH~~~~h  206 (669)
T KOG2231|consen  199 YRHLRFDH  206 (669)
T ss_pred             HHhhccce
Confidence            99998766


No 73 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=79.83  E-value=0.57  Score=24.57  Aligned_cols=15  Identities=27%  Similarity=0.559  Sum_probs=7.5

Q ss_pred             CCcccCcccccccCC
Q psy16925        118 RPYTCPWCSRTFANG  132 (166)
Q Consensus       118 ~p~~C~~C~~~f~~~  132 (166)
                      +++.|..||..|...
T Consensus         3 k~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFT   17 (49)
T ss_pred             eeEEcccCCCeEEEe
Confidence            344555555555443


No 74 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=78.70  E-value=0.39  Score=26.11  Aligned_cols=10  Identities=50%  Similarity=1.395  Sum_probs=6.9

Q ss_pred             CCCcccCccc
Q psy16925        117 KRPYTCPWCS  126 (166)
Q Consensus       117 ~~p~~C~~C~  126 (166)
                      ..+|.|+.||
T Consensus        48 g~~Y~Cp~CG   57 (61)
T COG2888          48 GNPYRCPKCG   57 (61)
T ss_pred             CCceECCCcC
Confidence            4567777776


No 75 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=77.94  E-value=2  Score=27.41  Aligned_cols=15  Identities=27%  Similarity=0.618  Sum_probs=10.9

Q ss_pred             CCcccCcccccccCC
Q psy16925        118 RPYTCPWCSRTFANG  132 (166)
Q Consensus       118 ~p~~C~~C~~~f~~~  132 (166)
                      .|..||.||..|...
T Consensus        25 ~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        25 RPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCccCCCcCCccCcc
Confidence            467888888877655


No 76 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=77.62  E-value=1.4  Score=23.02  Aligned_cols=25  Identities=40%  Similarity=0.878  Sum_probs=16.5

Q ss_pred             cccCcccccccCC-----hhhhhhhhhhcc
Q psy16925        120 YTCPWCSRTFANG-----SNCRSHKRRMHP  144 (166)
Q Consensus       120 ~~C~~C~~~f~~~-----~~l~~H~~~~h~  144 (166)
                      -.|..|++.++..     +.|.+|+...|+
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            3677777776544     578888775454


No 77 
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=77.36  E-value=0.88  Score=28.78  Aligned_cols=17  Identities=18%  Similarity=0.258  Sum_probs=9.4

Q ss_pred             hHHHHHHHhhhhhhhhc
Q psy16925        146 ELKLYESSLGKIFLYGK  162 (166)
Q Consensus       146 ~~~~~c~~c~~~f~~~~  162 (166)
                      +.|.+|--||+.|-|.+
T Consensus        66 e~psfchncgs~fpwte   82 (160)
T COG4306          66 EPPSFCHNCGSRFPWTE   82 (160)
T ss_pred             CCcchhhcCCCCCCcHH
Confidence            44555666666665543


No 78 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=77.10  E-value=1.7  Score=30.48  Aligned_cols=17  Identities=29%  Similarity=0.876  Sum_probs=11.0

Q ss_pred             CCeecccchhhcCChHH
Q psy16925         50 RPFVCHECGQSFASKGI   66 (166)
Q Consensus        50 ~~~~C~~C~~~f~~~~~   66 (166)
                      +...|++|+..|..+.-
T Consensus         4 k~~~CPvC~~~F~~~~v   20 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKV   20 (214)
T ss_pred             CceECCCCCCeeeeeEE
Confidence            45667777777766543


No 79 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=76.50  E-value=1  Score=21.88  Aligned_cols=12  Identities=17%  Similarity=0.708  Sum_probs=5.7

Q ss_pred             ecccchhhcCCh
Q psy16925         53 VCHECGQSFASK   64 (166)
Q Consensus        53 ~C~~C~~~f~~~   64 (166)
                      .|+.|+..|.-.
T Consensus         4 ~Cp~C~~~y~i~   15 (36)
T PF13717_consen    4 TCPNCQAKYEID   15 (36)
T ss_pred             ECCCCCCEEeCC
Confidence            355555555433


No 80 
>KOG4173|consensus
Probab=76.26  E-value=2.9  Score=29.01  Aligned_cols=45  Identities=18%  Similarity=0.369  Sum_probs=23.6

Q ss_pred             cchh--hhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHH
Q psy16925         23 YSLA--LMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHL   71 (166)
Q Consensus        23 ~~C~--~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~   71 (166)
                      |.|+  -|...|....++..|....|+    -.|..|.+.|.+...|..|+
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI  126 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHI  126 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHH
Confidence            4444  345555555555555543333    24666666666655555554


No 81 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=74.49  E-value=1.4  Score=38.68  Aligned_cols=21  Identities=19%  Similarity=0.510  Sum_probs=14.5

Q ss_pred             ccCCcCCccccccccccCCCc
Q psy16925         80 WKCDICSKKSLKLSNVSCGWY  100 (166)
Q Consensus        80 ~~c~~C~~~~~~~~c~~c~~~  100 (166)
                      +.|+.||..-....|+.||..
T Consensus       668 rkCPkCG~~t~~~fCP~CGs~  688 (1337)
T PRK14714        668 RRCPSCGTETYENRCPDCGTH  688 (1337)
T ss_pred             EECCCCCCccccccCcccCCc
Confidence            578888865555677777754


No 82 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=74.38  E-value=1  Score=21.97  Aligned_cols=13  Identities=31%  Similarity=0.695  Sum_probs=7.2

Q ss_pred             eecccchhhcCCh
Q psy16925         52 FVCHECGQSFASK   64 (166)
Q Consensus        52 ~~C~~C~~~f~~~   64 (166)
                      +.|+.|+..|.-.
T Consensus         3 ~~CP~C~~~~~v~   15 (38)
T TIGR02098         3 IQCPNCKTSFRVV   15 (38)
T ss_pred             EECCCCCCEEEeC
Confidence            3566666665544


No 83 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=74.20  E-value=0.29  Score=25.08  Aligned_cols=11  Identities=18%  Similarity=0.389  Sum_probs=6.6

Q ss_pred             CCcccCccccc
Q psy16925        118 RPYTCPWCSRT  128 (166)
Q Consensus       118 ~p~~C~~C~~~  128 (166)
                      .+..|+.||..
T Consensus        18 ~~irC~~CG~r   28 (44)
T smart00659       18 DVVRCRECGYR   28 (44)
T ss_pred             CceECCCCCce
Confidence            34667777653


No 84 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=73.45  E-value=1.5  Score=28.30  Aligned_cols=24  Identities=33%  Similarity=0.497  Sum_probs=14.4

Q ss_pred             ccccCCCcCCCchhHHHHhhhhcCCCC
Q psy16925         93 SNVSCGWYPDESKDLKNHHNLHTGKRP  119 (166)
Q Consensus        93 ~c~~c~~~f~~~~~l~~H~~~h~~~~p  119 (166)
                      .|.+||+.|..   |..|++.|+|..|
T Consensus        74 ~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   74 ICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             E-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             EEccCCcccch---HHHHHHHccCCCH
Confidence            66677777775   7899999976544


No 85 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=72.97  E-value=2.4  Score=18.91  Aligned_cols=20  Identities=30%  Similarity=0.501  Sum_probs=12.7

Q ss_pred             cccCcccccccCChhhhhhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~  140 (166)
                      ..||.|++.+ ....+..|+-
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3678888777 4455566653


No 86 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=72.77  E-value=0.33  Score=25.02  Aligned_cols=11  Identities=27%  Similarity=0.945  Sum_probs=7.0

Q ss_pred             CcccCcccccc
Q psy16925        119 PYTCPWCSRTF  129 (166)
Q Consensus       119 p~~C~~C~~~f  129 (166)
                      ...|+.||..+
T Consensus        21 ~~~Cp~CG~~~   31 (46)
T PRK00398         21 GVRCPYCGYRI   31 (46)
T ss_pred             ceECCCCCCeE
Confidence            46777777544


No 87 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=71.65  E-value=3.1  Score=21.23  Aligned_cols=27  Identities=19%  Similarity=0.079  Sum_probs=20.8

Q ss_pred             CCCCCccchhhhhhhcCChHHHHHHHH
Q psy16925         17 ASTLGKYSLALMVTRFSSRSAVTAHTK   43 (166)
Q Consensus        17 ~~~~~~~~C~~C~~~~~~~~~l~~H~~   43 (166)
                      .+..-+|+|-.|+.+..-+++|-.|++
T Consensus        15 ~gkp~~ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   15 PGKPFKYKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             CCCCccceeecCCcccchHHHHHHHHH
Confidence            344456888888888888888888876


No 88 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=70.67  E-value=0.74  Score=25.09  Aligned_cols=11  Identities=55%  Similarity=1.289  Sum_probs=7.0

Q ss_pred             CCCcccCcccc
Q psy16925        117 KRPYTCPWCSR  127 (166)
Q Consensus       117 ~~p~~C~~C~~  127 (166)
                      ..+|.|+.||.
T Consensus        46 ~~~Y~CP~CGF   56 (59)
T PRK14890         46 SNPYTCPKCGF   56 (59)
T ss_pred             CCceECCCCCC
Confidence            35677777763


No 89 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=70.64  E-value=1.5  Score=22.08  Aligned_cols=11  Identities=36%  Similarity=1.008  Sum_probs=7.0

Q ss_pred             CCCcccCcccc
Q psy16925        117 KRPYTCPWCSR  127 (166)
Q Consensus       117 ~~p~~C~~C~~  127 (166)
                      ..+..|+.||.
T Consensus        24 ~~~~~CP~Cg~   34 (42)
T PF09723_consen   24 DDPVPCPECGS   34 (42)
T ss_pred             CCCCcCCCCCC
Confidence            34567777775


No 90 
>KOG2807|consensus
Probab=70.43  E-value=8.1  Score=28.91  Aligned_cols=79  Identities=15%  Similarity=0.161  Sum_probs=45.7

Q ss_pred             CCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCcccCcccccc
Q psy16925         50 RPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTF  129 (166)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f  129 (166)
                      .|-.|+.|+-+.-...+|.+-...-.+-++|.=..-...+....|-.|+...             .+...|.|+.|...|
T Consensus       289 LP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~-------------~~~~~y~C~~Ck~~F  355 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGEL-------------LSSGRYRCESCKNVF  355 (378)
T ss_pred             CCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeecccc-------------CCCCcEEchhcccee
Confidence            4667888988888888887654433344444322222222222233442111             122348999999999


Q ss_pred             cCChhhhhhhhh
Q psy16925        130 ANGSNCRSHKRR  141 (166)
Q Consensus       130 ~~~~~l~~H~~~  141 (166)
                      -...+.-.|...
T Consensus       356 CldCDv~iHesL  367 (378)
T KOG2807|consen  356 CLDCDVFIHESL  367 (378)
T ss_pred             eccchHHHHhhh
Confidence            888887777664


No 91 
>PF14353 CpXC:  CpXC protein
Probab=70.36  E-value=0.93  Score=28.95  Aligned_cols=22  Identities=27%  Similarity=0.549  Sum_probs=17.0

Q ss_pred             CcccCcccccccCChhhhhhhh
Q psy16925        119 PYTCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus       119 p~~C~~C~~~f~~~~~l~~H~~  140 (166)
                      .+.||.||..|.-...+..|..
T Consensus        38 ~~~CP~Cg~~~~~~~p~lY~D~   59 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPLLYHDP   59 (128)
T ss_pred             EEECCCCCCceecCCCEEEEcC
Confidence            4789999999887776666654


No 92 
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=70.17  E-value=4.4  Score=30.01  Aligned_cols=89  Identities=15%  Similarity=0.163  Sum_probs=45.7

Q ss_pred             CCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCCcCCCchhHHHHhh-hhcCCCCcccCccccc
Q psy16925         50 RPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHN-LHTGKRPYTCPWCSRT  128 (166)
Q Consensus        50 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~-~h~~~~p~~C~~C~~~  128 (166)
                      .|..|+.|....-...+|.+....-.+-++|.=..-+..+.+..|-.|--.|.-..   .|.. .-+....|.|+.|...
T Consensus       321 LPi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~---~~~~~~~~ss~rY~Ce~CK~~  397 (421)
T COG5151         321 LPISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPP---VSPFDESTSSGRYQCELCKST  397 (421)
T ss_pred             CCccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCC---CCcccccccccceechhhhhh
Confidence            35567777766655555554333223334443222333344444444444333211   1111 1122345999999999


Q ss_pred             ccCChhhhhhhhh
Q psy16925        129 FANGSNCRSHKRR  141 (166)
Q Consensus       129 f~~~~~l~~H~~~  141 (166)
                      |-...+.-.|...
T Consensus       398 FC~dCdvfiHe~L  410 (421)
T COG5151         398 FCSDCDVFIHETL  410 (421)
T ss_pred             hhhhhHHHHHHHH
Confidence            9888777777553


No 93 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=69.94  E-value=7.1  Score=26.02  Aligned_cols=33  Identities=15%  Similarity=0.396  Sum_probs=21.7

Q ss_pred             CCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccc
Q psy16925         48 GERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKS   89 (166)
Q Consensus        48 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~   89 (166)
                      +..-|.|+.|+..|+....+.         .-|.|+.||...
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            345578888887777665553         257777777554


No 94 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=69.53  E-value=1.3  Score=23.26  Aligned_cols=12  Identities=33%  Similarity=1.093  Sum_probs=7.9

Q ss_pred             eecccchhhcCC
Q psy16925         52 FVCHECGQSFAS   63 (166)
Q Consensus        52 ~~C~~C~~~f~~   63 (166)
                      |.|..|+..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            667777766653


No 95 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=69.51  E-value=4.1  Score=35.10  Aligned_cols=9  Identities=33%  Similarity=0.944  Sum_probs=4.9

Q ss_pred             eecccchhh
Q psy16925         52 FVCHECGQS   60 (166)
Q Consensus        52 ~~C~~C~~~   60 (166)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            456666554


No 96 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=69.07  E-value=3.6  Score=26.42  Aligned_cols=15  Identities=33%  Similarity=0.973  Sum_probs=9.6

Q ss_pred             CeecccchhhcCChH
Q psy16925         51 PFVCHECGQSFASKG   65 (166)
Q Consensus        51 ~~~C~~C~~~f~~~~   65 (166)
                      |++|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            456777777776543


No 97 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=68.66  E-value=2.3  Score=35.52  Aligned_cols=44  Identities=20%  Similarity=0.330  Sum_probs=21.5

Q ss_pred             cCCcCCccccccccccCCCcCCC---chhHHHHhhhhcCCCCcccCcccc
Q psy16925         81 KCDICSKKSLKLSNVSCGWYPDE---SKDLKNHHNLHTGKRPYTCPWCSR  127 (166)
Q Consensus        81 ~c~~C~~~~~~~~c~~c~~~f~~---~~~l~~H~~~h~~~~p~~C~~C~~  127 (166)
                      .|..||..+   .|+.|+-.+.-   ...|.-|..-+....|..|+.||.
T Consensus       437 ~C~~Cg~v~---~Cp~Cd~~lt~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs  483 (730)
T COG1198         437 LCRDCGYIA---ECPNCDSPLTLHKATGQLRCHYCGYQEPIPQSCPECGS  483 (730)
T ss_pred             ecccCCCcc---cCCCCCcceEEecCCCeeEeCCCCCCCCCCCCCCCCCC
Confidence            466666554   45555543221   122223333334456777777774


No 98 
>KOG2186|consensus
Probab=68.20  E-value=4.2  Score=29.17  Aligned_cols=47  Identities=17%  Similarity=0.378  Sum_probs=34.4

Q ss_pred             cchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhH
Q psy16925         23 YSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTI   73 (166)
Q Consensus        23 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~   73 (166)
                      |.|..|+... .++.+..|+.. ..+ .-|.|-.|+..|.. .....|..-
T Consensus         4 FtCnvCgEsv-KKp~vekH~sr-Crn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    4 FTCNVCGESV-KKPQVEKHMSR-CRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             Eehhhhhhhc-cccchHHHHHh-ccC-CeeEEeeccccccc-chhhhhhhh
Confidence            7899999974 55667779764 333 56899999999988 556666543


No 99 
>KOG3408|consensus
Probab=67.88  E-value=7.1  Score=24.69  Aligned_cols=29  Identities=17%  Similarity=0.180  Sum_probs=19.8

Q ss_pred             ccCCCCCccchhhhhhhcCChHHHHHHHH
Q psy16925         15 RNASTLGKYSLALMVTRFSSRSAVTAHTK   43 (166)
Q Consensus        15 ~~~~~~~~~~C~~C~~~~~~~~~l~~H~~   43 (166)
                      .+....|.|-|-+|..-|.+...|..|.+
T Consensus        50 ~dlPG~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   50 PDLPGGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCCCCCceeehhhhhhhhcchHHHHHHHh
Confidence            34455566777777777777777777765


No 100
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=67.74  E-value=6.4  Score=25.82  Aligned_cols=37  Identities=16%  Similarity=0.439  Sum_probs=20.0

Q ss_pred             CCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccc
Q psy16925         49 ERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKS   89 (166)
Q Consensus        49 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~   89 (166)
                      ...|.|+.|+..|.....+..   .. .+..|.|+.||...
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~---~d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL---LD-MDGTFTCPRCGEEL  133 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh---cC-CCCcEECCCCCCEE
Confidence            345778888877764332221   01 13347777776544


No 101
>KOG2186|consensus
Probab=66.49  E-value=3.3  Score=29.67  Aligned_cols=11  Identities=36%  Similarity=1.042  Sum_probs=4.7

Q ss_pred             cccCccccccc
Q psy16925        120 YTCPWCSRTFA  130 (166)
Q Consensus       120 ~~C~~C~~~f~  130 (166)
                      |.|-.|++.|.
T Consensus        30 fSCIDC~k~F~   40 (276)
T KOG2186|consen   30 FSCIDCGKTFE   40 (276)
T ss_pred             eEEeecccccc
Confidence            34444444443


No 102
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=66.47  E-value=1.9  Score=36.25  Aligned_cols=20  Identities=25%  Similarity=0.595  Sum_probs=0.0

Q ss_pred             ccCCcCCccccccccccCCC
Q psy16925         80 WKCDICSKKSLKLSNVSCGW   99 (166)
Q Consensus        80 ~~c~~C~~~~~~~~c~~c~~   99 (166)
                      ..|+.|+..-....|+.||.
T Consensus       656 r~Cp~Cg~~t~~~~Cp~CG~  675 (900)
T PF03833_consen  656 RRCPKCGKETFYNRCPECGS  675 (900)
T ss_dssp             --------------------
T ss_pred             ccCcccCCcchhhcCcccCC
Confidence            46777777666667777773


No 103
>KOG2482|consensus
Probab=66.45  E-value=11  Score=28.48  Aligned_cols=20  Identities=20%  Similarity=0.333  Sum_probs=14.8

Q ss_pred             ccCcccccccCChhhhhhhh
Q psy16925        121 TCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus       121 ~C~~C~~~f~~~~~l~~H~~  140 (166)
                      .|-.|...|.....|..|+.
T Consensus       336 ~c~~cd~~F~~e~~l~~hm~  355 (423)
T KOG2482|consen  336 RCAECDLSFWKEPGLLIHMV  355 (423)
T ss_pred             ccccccccccCcchhhhhcc
Confidence            46677777888888877764


No 104
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=64.59  E-value=5.8  Score=29.91  Aligned_cols=23  Identities=30%  Similarity=0.580  Sum_probs=13.2

Q ss_pred             ccCcccccccCChhhhhhhhhhc
Q psy16925        121 TCPWCSRTFANGSNCRSHKRRMH  143 (166)
Q Consensus       121 ~C~~C~~~f~~~~~l~~H~~~~h  143 (166)
                      .|..|...|..-..|..|.+..|
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H  244 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH  244 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh
Confidence            45556666666666666665433


No 105
>KOG2593|consensus
Probab=63.92  E-value=2.7  Score=32.47  Aligned_cols=41  Identities=20%  Similarity=0.412  Sum_probs=23.3

Q ss_pred             ccCCCCCccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchh
Q psy16925         15 RNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQ   59 (166)
Q Consensus        15 ~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~   59 (166)
                      ++.+....|.|+.|.+.|+....+..-    -.....|.|..|+.
T Consensus       121 ~d~t~~~~Y~Cp~C~kkyt~Lea~~L~----~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  121 RDDTNVAGYVCPNCQKKYTSLEALQLL----DNETGEFHCENCGG  161 (436)
T ss_pred             hhccccccccCCccccchhhhHHHHhh----cccCceEEEecCCC
Confidence            445555557777777776666655421    22244566666663


No 106
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=63.83  E-value=5.2  Score=27.27  Aligned_cols=32  Identities=19%  Similarity=0.532  Sum_probs=20.2

Q ss_pred             CCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccc
Q psy16925         49 ERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKS   89 (166)
Q Consensus        49 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~   89 (166)
                      ..-|.|+.|+..|+....+.         .-|.|+.||...
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            34577888887776655432         356777777554


No 107
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=63.24  E-value=2.1  Score=28.29  Aligned_cols=17  Identities=18%  Similarity=0.526  Sum_probs=10.0

Q ss_pred             CCCcccCcccccccCCh
Q psy16925        117 KRPYTCPWCSRTFANGS  133 (166)
Q Consensus       117 ~~p~~C~~C~~~f~~~~  133 (166)
                      +.|.-|..||+.|++..
T Consensus        66 ~~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTE   82 (158)
T ss_pred             CCChhHHhCCCCCchHH
Confidence            35556666666666543


No 108
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=62.80  E-value=4.2  Score=25.13  Aligned_cols=93  Identities=11%  Similarity=-0.006  Sum_probs=45.0

Q ss_pred             CccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHH-HHHHhHcCCCCCccCCcCCcccccccc----c
Q psy16925         21 GKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGIL-QEHLTIHSDDAPWKCDICSKKSLKLSN----V   95 (166)
Q Consensus        21 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l-~~h~~~h~~~~~~~c~~C~~~~~~~~c----~   95 (166)
                      .-..|..|...... ..+..|++..|.......-..=.+.+..-..| ........+..+..-..-...+....|    .
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~~   88 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDPP   88 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCCC
Confidence            34679999988776 88889988555433221111000111000000 000000000100000001122233467    7


Q ss_pred             cCCCcCCCchhHHHHhhhh
Q psy16925         96 SCGWYPDESKDLKNHHNLH  114 (166)
Q Consensus        96 ~c~~~f~~~~~l~~H~~~h  114 (166)
                      .|+....+...+..|.+.+
T Consensus        89 ~C~y~~~~~~~m~~H~~~~  107 (109)
T PF12013_consen   89 HCGYITRSKKTMRKHWRKE  107 (109)
T ss_pred             CCCcEeccHHHHHHHHHHh
Confidence            8888889999999998765


No 109
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=62.47  E-value=14  Score=27.89  Aligned_cols=48  Identities=23%  Similarity=0.340  Sum_probs=32.5

Q ss_pred             CCccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchh-------hcCChHHHHHHHh
Q psy16925         20 LGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQ-------SFASKGILQEHLT   72 (166)
Q Consensus        20 ~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~-------~f~~~~~l~~h~~   72 (166)
                      .|-..|..|...|=+...|..|.+..|.     .|.+|++       -|.+...|.+|.+
T Consensus       218 KGHP~C~FC~~~FYdDDEL~~HcR~~HE-----~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         218 KGHPLCIFCKIYFYDDDELRRHCRLRHE-----ACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             CCCchhhhccceecChHHHHHHHHhhhh-----hhhhhhccCccchhhhhCHHHHHHHhh
Confidence            3456799999999999999999885543     3445543       2555566666643


No 110
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=62.14  E-value=9.7  Score=31.52  Aligned_cols=17  Identities=24%  Similarity=0.640  Sum_probs=7.2

Q ss_pred             CCcCCccccccccccCC
Q psy16925         82 CDICSKKSLKLSNVSCG   98 (166)
Q Consensus        82 c~~C~~~~~~~~c~~c~   98 (166)
                      |+.||..+....|+.||
T Consensus        18 C~~CG~~l~~~~Cp~CG   34 (645)
T PRK14559         18 CQKCGTSLTHKPCPQCG   34 (645)
T ss_pred             ccccCCCCCCCcCCCCC
Confidence            44444444333444444


No 111
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=61.75  E-value=4.1  Score=28.66  Aligned_cols=31  Identities=29%  Similarity=0.678  Sum_probs=22.1

Q ss_pred             CCCcccCcccccccCChhhhhhhhhhcchhH
Q psy16925        117 KRPYTCPWCSRTFANGSNCRSHKRRMHPEEL  147 (166)
Q Consensus       117 ~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~  147 (166)
                      +..|.|++|+|.|.-..-+..|+..-|++..
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~v  105 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPEKV  105 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HHHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHHHH
Confidence            3358899999999988888899888887653


No 112
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=60.81  E-value=4.4  Score=26.08  Aligned_cols=24  Identities=29%  Similarity=0.278  Sum_probs=19.6

Q ss_pred             ccccCCCcCCCchhHHHHhhhhcCCCC
Q psy16925         93 SNVSCGWYPDESKDLKNHHNLHTGKRP  119 (166)
Q Consensus        93 ~c~~c~~~f~~~~~l~~H~~~h~~~~p  119 (166)
                      .|.++|+.|.+   |++|+.+|.+.-|
T Consensus        78 icLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          78 ICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEeccCcchHH---HHHHHhcccCCCH
Confidence            77888888876   9999999887655


No 113
>KOG4173|consensus
Probab=59.96  E-value=4.9  Score=27.96  Aligned_cols=19  Identities=32%  Similarity=0.847  Sum_probs=9.1

Q ss_pred             ccCcccccccCChhhhhhh
Q psy16925        121 TCPWCSRTFANGSNCRSHK  139 (166)
Q Consensus       121 ~C~~C~~~f~~~~~l~~H~  139 (166)
                      .|..|.+.|++.-.|..|+
T Consensus       108 sCs~C~r~~Pt~hLLd~HI  126 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHI  126 (253)
T ss_pred             hhHHHHHhCCchhhhhHHH
Confidence            4445555555444444443


No 114
>KOG4167|consensus
Probab=59.34  E-value=4.8  Score=33.38  Aligned_cols=27  Identities=22%  Similarity=0.176  Sum_probs=23.6

Q ss_pred             CCccchhhhhhhcCChHHHHHHHHHhhc
Q psy16925         20 LGKYSLALMVTRFSSRSAVTAHTKAVHL   47 (166)
Q Consensus        20 ~~~~~C~~C~~~~~~~~~l~~H~~~~h~   47 (166)
                      .+.|.|.+|++.|.....+..||+ .|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK-~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMK-THR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHH-HHH
Confidence            577999999999999999999998 454


No 115
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=58.80  E-value=2.6  Score=27.99  Aligned_cols=14  Identities=21%  Similarity=0.505  Sum_probs=8.8

Q ss_pred             cccCcccccccCCh
Q psy16925        120 YTCPWCSRTFANGS  133 (166)
Q Consensus       120 ~~C~~C~~~f~~~~  133 (166)
                      ++|+.||+.|....
T Consensus        29 ~~c~~c~~~f~~~e   42 (154)
T PRK00464         29 RECLACGKRFTTFE   42 (154)
T ss_pred             eeccccCCcceEeE
Confidence            56667777666543


No 116
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=56.70  E-value=3.4  Score=23.08  Aligned_cols=13  Identities=23%  Similarity=0.590  Sum_probs=5.8

Q ss_pred             cccCcccccccCC
Q psy16925        120 YTCPWCSRTFANG  132 (166)
Q Consensus       120 ~~C~~C~~~f~~~  132 (166)
                      +-|..||..|-..
T Consensus        26 hhCr~CG~~vC~~   38 (69)
T PF01363_consen   26 HHCRNCGRVVCSS   38 (69)
T ss_dssp             EE-TTT--EEECC
T ss_pred             EccCCCCCEECCc
Confidence            5666777666443


No 117
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=56.37  E-value=4.9  Score=19.53  Aligned_cols=8  Identities=25%  Similarity=0.588  Sum_probs=3.9

Q ss_pred             cccCcccc
Q psy16925        120 YTCPWCSR  127 (166)
Q Consensus       120 ~~C~~C~~  127 (166)
                      -.|..||-
T Consensus        22 ~~Cd~cg~   29 (36)
T PF05191_consen   22 GVCDNCGG   29 (36)
T ss_dssp             TBCTTTTE
T ss_pred             CccCCCCC
Confidence            34555554


No 118
>KOG0782|consensus
Probab=56.01  E-value=2.1  Score=34.44  Aligned_cols=52  Identities=15%  Similarity=0.203  Sum_probs=34.7

Q ss_pred             hhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhhhcchhHHHHHHHhhhhhhhhc
Q psy16925        105 KDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYGK  162 (166)
Q Consensus       105 ~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~f~~~~  162 (166)
                      +.+..|.-.|..-..=+|..|+++|.++-.+      |-.+.....|+||...|-.+.
T Consensus       239 ~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  239 SGFVRHHWVHRRRQEGKCNTCGKGFQQKFFF------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchHHhHhhHhhhccccchhhhhhhhheee------ccccEEEEEehHHHHHhhcch
Confidence            4566666666554446899999999877544      223334566999988876543


No 119
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=55.81  E-value=4.8  Score=17.69  Aligned_cols=10  Identities=40%  Similarity=1.165  Sum_probs=6.4

Q ss_pred             CCcccCcccc
Q psy16925        118 RPYTCPWCSR  127 (166)
Q Consensus       118 ~p~~C~~C~~  127 (166)
                      .+|.||.||.
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            3577777763


No 120
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=53.92  E-value=1.7  Score=35.72  Aligned_cols=17  Identities=35%  Similarity=0.980  Sum_probs=7.7

Q ss_pred             cCcccccccCChhhhhh
Q psy16925        122 CPWCSRTFANGSNCRSH  138 (166)
Q Consensus       122 C~~C~~~f~~~~~l~~H  138 (166)
                      |+.|.+.|....+.+-|
T Consensus       154 C~~C~~EY~dP~nRRfH  170 (750)
T COG0068         154 CPFCDKEYKDPLNRRFH  170 (750)
T ss_pred             CHHHHHHhcCccccccc
Confidence            44454444444443333


No 121
>PHA00626 hypothetical protein
Probab=53.91  E-value=6.3  Score=21.23  Aligned_cols=15  Identities=20%  Similarity=0.403  Sum_probs=12.2

Q ss_pred             CCcccCcccccccCC
Q psy16925        118 RPYTCPWCSRTFANG  132 (166)
Q Consensus       118 ~p~~C~~C~~~f~~~  132 (166)
                      ..|+|+.||..|+..
T Consensus        22 nrYkCkdCGY~ft~~   36 (59)
T PHA00626         22 DDYVCCDCGYNDSKD   36 (59)
T ss_pred             cceEcCCCCCeechh
Confidence            469999999988743


No 122
>KOG1842|consensus
Probab=53.52  E-value=9.3  Score=29.85  Aligned_cols=32  Identities=19%  Similarity=0.283  Sum_probs=28.3

Q ss_pred             CCCccchhhhhhhcCChHHHHHHHHHhhcCCC
Q psy16925         19 TLGKYSLALMVTRFSSRSAVTAHTKAVHLGER   50 (166)
Q Consensus        19 ~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~   50 (166)
                      ....|.|++|...|.....|..|+...|.++.
T Consensus        12 i~egflCPiC~~dl~~~~~L~~H~d~eH~~ed   43 (505)
T KOG1842|consen   12 ILEGFLCPICLLDLPNLSALNDHLDVEHFEED   43 (505)
T ss_pred             hhhcccCchHhhhhhhHHHHHHHHhhhccccc
Confidence            35569999999999999999999998898764


No 123
>PF12773 DZR:  Double zinc ribbon
Probab=53.48  E-value=18  Score=18.55  Aligned_cols=10  Identities=30%  Similarity=0.780  Sum_probs=6.5

Q ss_pred             CcccCccccc
Q psy16925        119 PYTCPWCSRT  128 (166)
Q Consensus       119 p~~C~~C~~~  128 (166)
                      ...|+.|+..
T Consensus        29 ~~~C~~Cg~~   38 (50)
T PF12773_consen   29 KKICPNCGAE   38 (50)
T ss_pred             CCCCcCCcCC
Confidence            4567777764


No 124
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=51.51  E-value=3.4  Score=23.63  Aligned_cols=20  Identities=30%  Similarity=0.444  Sum_probs=13.3

Q ss_pred             CCCCcccC--cccccccCChhh
Q psy16925        116 GKRPYTCP--WCSRTFANGSNC  135 (166)
Q Consensus       116 ~~~p~~C~--~C~~~f~~~~~l  135 (166)
                      .+.-++|.  .||..|.....+
T Consensus        24 ~~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         24 KERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             heeeeecCCCCCCCEEEEEEEE
Confidence            34556786  888888765543


No 125
>KOG4727|consensus
Probab=50.97  E-value=8.3  Score=25.97  Aligned_cols=26  Identities=15%  Similarity=0.109  Sum_probs=20.7

Q ss_pred             CCCCccchhhhhhhcCChHHHHHHHH
Q psy16925         18 STLGKYSLALMVTRFSSRSAVTAHTK   43 (166)
Q Consensus        18 ~~~~~~~C~~C~~~~~~~~~l~~H~~   43 (166)
                      +..+.|-|.+|+..+.+.-.+..|+.
T Consensus        71 sq~~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   71 SQKGGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             cccCceeeeecceeehhhHHHHHHhc
Confidence            34456889999999999888888875


No 126
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=50.58  E-value=3.4  Score=20.83  Aligned_cols=12  Identities=25%  Similarity=0.379  Sum_probs=6.7

Q ss_pred             HHHhhhhhhhhc
Q psy16925        151 ESSLGKIFLYGK  162 (166)
Q Consensus       151 c~~c~~~f~~~~  162 (166)
                      |..||+-|.+.+
T Consensus        11 C~~C~rpf~WRK   22 (42)
T PF10013_consen   11 CPVCGRPFTWRK   22 (42)
T ss_pred             CcccCCcchHHH
Confidence            555555555544


No 127
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=50.56  E-value=6.4  Score=19.26  Aligned_cols=29  Identities=21%  Similarity=0.298  Sum_probs=18.7

Q ss_pred             cccCcccccccCChhhhhhhhhhcchhHHHHHHHhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGK  156 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~  156 (166)
                      |+|+.||..|........        .....|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~--------~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKISD--------DPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEecCC--------CCCCCCCCCCC
Confidence            789999998875433211        22455888886


No 128
>PRK04023 DNA polymerase II large subunit; Validated
Probab=50.51  E-value=16  Score=31.81  Aligned_cols=23  Identities=26%  Similarity=0.458  Sum_probs=18.9

Q ss_pred             CCccCCcCCccccccccccCCCc
Q psy16925         78 APWKCDICSKKSLKLSNVSCGWY  100 (166)
Q Consensus        78 ~~~~c~~C~~~~~~~~c~~c~~~  100 (166)
                      ....|+.||.......|+.||..
T Consensus       625 g~RfCpsCG~~t~~frCP~CG~~  647 (1121)
T PRK04023        625 GRRKCPSCGKETFYRRCPFCGTH  647 (1121)
T ss_pred             cCccCCCCCCcCCcccCCCCCCC
Confidence            34689999988888899999975


No 129
>KOG3408|consensus
Probab=50.51  E-value=6.9  Score=24.72  Aligned_cols=25  Identities=24%  Similarity=0.591  Sum_probs=20.2

Q ss_pred             CCCCcccCcccccccCChhhhhhhh
Q psy16925        116 GKRPYTCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus       116 ~~~p~~C~~C~~~f~~~~~l~~H~~  140 (166)
                      |...|.|-.|.+-|.+...|..|.+
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHh
Confidence            3445888899999999999988876


No 130
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=50.02  E-value=15  Score=20.42  Aligned_cols=14  Identities=36%  Similarity=0.828  Sum_probs=9.7

Q ss_pred             CCCcccCccccccc
Q psy16925        117 KRPYTCPWCSRTFA  130 (166)
Q Consensus       117 ~~p~~C~~C~~~f~  130 (166)
                      .+.|.|+.||..+.
T Consensus        44 ~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   44 GRVFTCPNCGFEMD   57 (69)
T ss_pred             cceEEcCCCCCEEC
Confidence            44588888887643


No 131
>KOG2482|consensus
Probab=49.74  E-value=25  Score=26.68  Aligned_cols=22  Identities=23%  Similarity=0.745  Sum_probs=20.3

Q ss_pred             cccCcccccccCChhhhhhhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      +.|-.|.+.|..+..|..||+.
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            7899999999999999999973


No 132
>KOG0696|consensus
Probab=48.89  E-value=5.1  Score=31.38  Aligned_cols=50  Identities=16%  Similarity=0.279  Sum_probs=29.7

Q ss_pred             HHHHhhhhcCCCCcccCcccccccCChhhhhhhhhhcchhHHHHHHHhhhh
Q psy16925        107 LKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKI  157 (166)
Q Consensus       107 l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~  157 (166)
                      +..|.+-|.- ..|.||--++.+..-.....|.-..|+=..|..|..||..
T Consensus        81 fvvHkrChef-VtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCGsL  130 (683)
T KOG0696|consen   81 FVVHKRCHEF-VTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCGSL  130 (683)
T ss_pred             ehhhhhhcce-EEEECCCCCCCCCCCCcccccceeeeecCCCchhhhHHHH
Confidence            3445554432 2366666666666666666666556665666667777643


No 133
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.63  E-value=12  Score=23.22  Aligned_cols=13  Identities=15%  Similarity=0.715  Sum_probs=10.9

Q ss_pred             CCcccCccccccc
Q psy16925        118 RPYTCPWCSRTFA  130 (166)
Q Consensus       118 ~p~~C~~C~~~f~  130 (166)
                      .|..||.||++|+
T Consensus        25 dPiVsPytG~s~P   37 (129)
T COG4530          25 DPIVSPYTGKSYP   37 (129)
T ss_pred             CccccCcccccch
Confidence            5788999999984


No 134
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=48.51  E-value=10  Score=19.93  Aligned_cols=10  Identities=30%  Similarity=1.145  Sum_probs=5.3

Q ss_pred             eecccchhhc
Q psy16925         52 FVCHECGQSF   61 (166)
Q Consensus        52 ~~C~~C~~~f   61 (166)
                      |.|..|++.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5555555554


No 135
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=47.49  E-value=7.5  Score=20.85  Aligned_cols=27  Identities=33%  Similarity=0.773  Sum_probs=16.2

Q ss_pred             chhHHHHhhhhcCCCCcccCc----cccccc
Q psy16925        104 SKDLKNHHNLHTGKRPYTCPW----CSRTFA  130 (166)
Q Consensus       104 ~~~l~~H~~~h~~~~p~~C~~----C~~~f~  130 (166)
                      ...|..|+...-..++..|+.    |+..+.
T Consensus        23 r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen   23 RKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             CCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             HHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            345777877666666777877    766554


No 136
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=47.10  E-value=6.4  Score=18.00  Aligned_cols=19  Identities=37%  Similarity=0.910  Sum_probs=10.2

Q ss_pred             cccCcccccccCChhhhhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHK  139 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~  139 (166)
                      |.|-.|++.|. ......|-
T Consensus         1 ~sCiDC~~~F~-~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDFD-GDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEEE-GGGTTT--
T ss_pred             CeeecCCCCcC-cCCcCCCC
Confidence            45777888873 33444553


No 137
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=47.06  E-value=4.3  Score=29.29  Aligned_cols=17  Identities=24%  Similarity=0.602  Sum_probs=7.1

Q ss_pred             CCeecccchhhcCChHH
Q psy16925         50 RPFVCHECGQSFASKGI   66 (166)
Q Consensus        50 ~~~~C~~C~~~f~~~~~   66 (166)
                      +++.|+.|+........
T Consensus       208 k~~PCPKCg~et~eTkd  224 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKD  224 (314)
T ss_pred             CCCCCCCCCCccccccc
Confidence            34444444444333333


No 138
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=46.14  E-value=5.3  Score=19.21  Aligned_cols=14  Identities=21%  Similarity=0.226  Sum_probs=4.8

Q ss_pred             HHHhhhhhhhhccc
Q psy16925        151 ESSLGKIFLYGKMK  164 (166)
Q Consensus       151 c~~c~~~f~~~~~~  164 (166)
                      |.+||+.|..+-|.
T Consensus         6 C~eC~~~f~dSyL~   19 (34)
T PF01286_consen    6 CDECGKPFMDSYLL   19 (34)
T ss_dssp             -TTT--EES-SSCC
T ss_pred             HhHhCCHHHHHHHH
Confidence            44555555544443


No 139
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.87  E-value=8.6  Score=19.96  Aligned_cols=14  Identities=14%  Similarity=0.059  Sum_probs=9.6

Q ss_pred             HHHHHhhhhhhhhc
Q psy16925        149 LYESSLGKIFLYGK  162 (166)
Q Consensus       149 ~~c~~c~~~f~~~~  162 (166)
                      ..|+.|++-|.|.+
T Consensus        13 KICpvCqRPFsWRk   26 (54)
T COG4338          13 KICPVCQRPFSWRK   26 (54)
T ss_pred             hhhhhhcCchHHHH
Confidence            34777777777765


No 140
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=44.53  E-value=9.4  Score=20.49  Aligned_cols=9  Identities=56%  Similarity=1.206  Sum_probs=4.1

Q ss_pred             cCCcCCccc
Q psy16925         81 KCDICSKKS   89 (166)
Q Consensus        81 ~c~~C~~~~   89 (166)
                      .|+.|+..|
T Consensus         7 ~C~~Cg~~~   15 (54)
T PF14446_consen    7 KCPVCGKKF   15 (54)
T ss_pred             cChhhCCcc
Confidence            344444444


No 141
>KOG2593|consensus
Probab=44.13  E-value=30  Score=27.05  Aligned_cols=40  Identities=15%  Similarity=0.489  Sum_probs=27.8

Q ss_pred             cCCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccc
Q psy16925         47 LGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKS   89 (166)
Q Consensus        47 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~   89 (166)
                      +....|.|+.|.+.|+.-..   -+..-..+..|.|..|+...
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea---~~L~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEA---LQLLDNETGEFHCENCGGEL  163 (436)
T ss_pred             cccccccCCccccchhhhHH---HHhhcccCceEEEecCCCch
Confidence            44567999999999965443   33334445678999998655


No 142
>PLN02294 cytochrome c oxidase subunit Vb
Probab=43.24  E-value=13  Score=25.14  Aligned_cols=16  Identities=25%  Similarity=0.818  Sum_probs=13.1

Q ss_pred             CCCcccCcccccccCC
Q psy16925        117 KRPYTCPWCSRTFANG  132 (166)
Q Consensus       117 ~~p~~C~~C~~~f~~~  132 (166)
                      .+|++|++||..|...
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            4689999999998643


No 143
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=41.10  E-value=13  Score=18.41  Aligned_cols=14  Identities=21%  Similarity=0.748  Sum_probs=11.5

Q ss_pred             CcccCcccccccCC
Q psy16925        119 PYTCPWCSRTFANG  132 (166)
Q Consensus       119 p~~C~~C~~~f~~~  132 (166)
                      |+.|..|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78999999888644


No 144
>KOG2272|consensus
Probab=40.80  E-value=32  Score=24.93  Aligned_cols=32  Identities=9%  Similarity=0.072  Sum_probs=18.1

Q ss_pred             ccccCCcccCCCCCccchhhhhhhcCChHHHH
Q psy16925          8 GIRAAGFRNASTLGKYSLALMVTRFSSRSAVT   39 (166)
Q Consensus         8 ~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~   39 (166)
                      |.....+.++--..=|.|++|.+...+...+.
T Consensus        85 GrVikamnnSwHp~CF~Cd~Cn~~Lad~gf~r  116 (332)
T KOG2272|consen   85 GRVIKAMNNSWHPACFRCDLCNKHLADQGFYR  116 (332)
T ss_pred             hHHHHhhccccCcccchhHHHHHHHhhhhhHh
Confidence            33444455555556677777776655555443


No 145
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=40.79  E-value=11  Score=24.43  Aligned_cols=15  Identities=27%  Similarity=0.793  Sum_probs=10.4

Q ss_pred             CCeecccchhhcCCh
Q psy16925         50 RPFVCHECGQSFASK   64 (166)
Q Consensus        50 ~~~~C~~C~~~f~~~   64 (166)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            347788888777654


No 146
>KOG4124|consensus
Probab=40.41  E-value=9.4  Score=28.85  Aligned_cols=25  Identities=28%  Similarity=0.743  Sum_probs=19.3

Q ss_pred             CCCCcccCcccccccCChhhhhhhh
Q psy16925        116 GKRPYTCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus       116 ~~~p~~C~~C~~~f~~~~~l~~H~~  140 (166)
                      ..|||+|++|.+.+.....|.-|..
T Consensus       395 ~nk~~r~~i~~~~~k~~~~l~~~~~  419 (442)
T KOG4124|consen  395 ENKPYRCEVCSKRYKNLNGLKYHRT  419 (442)
T ss_pred             ccCcccChhhhhhhccCCCCCceee
Confidence            3678999999999887777766643


No 147
>PHA02998 RNA polymerase subunit; Provisional
Probab=40.15  E-value=2.2  Score=28.80  Aligned_cols=16  Identities=19%  Similarity=0.073  Sum_probs=9.7

Q ss_pred             HHHHhhhhhhhhcccC
Q psy16925        150 YESSLGKIFLYGKMKN  165 (166)
Q Consensus       150 ~c~~c~~~f~~~~~~~  165 (166)
                      .|..||..|..++.++
T Consensus       173 kC~~CG~~wkppkf~~  188 (195)
T PHA02998        173 ACRDCKKHFKPPKFRD  188 (195)
T ss_pred             EcCCCCCccCCccccc
Confidence            3666666666665543


No 148
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=40.10  E-value=15  Score=22.34  Aligned_cols=20  Identities=35%  Similarity=0.752  Sum_probs=15.0

Q ss_pred             hhhhcCCCCcccCcccccccC
Q psy16925        111 HNLHTGKRPYTCPWCSRTFAN  131 (166)
Q Consensus       111 ~~~h~~~~p~~C~~C~~~f~~  131 (166)
                      +..+.+ +|++|++||..|..
T Consensus        72 ~~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          72 MWLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEEeCC-CceeCCCCCcEEEE
Confidence            344555 79999999998863


No 149
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=39.75  E-value=21  Score=17.50  Aligned_cols=22  Identities=14%  Similarity=0.140  Sum_probs=8.0

Q ss_pred             CccchhhhhhhcCChH--HHHHHH
Q psy16925         21 GKYSLALMVTRFSSRS--AVTAHT   42 (166)
Q Consensus        21 ~~~~C~~C~~~~~~~~--~l~~H~   42 (166)
                      ..|.|++|...+...+  .-..|.
T Consensus         2 ~ryyCdyC~~~~~~d~~~~Rk~H~   25 (38)
T PF06220_consen    2 PRYYCDYCKKYLTHDSPSIRKQHE   25 (38)
T ss_dssp             -S-B-TTT--B-S--SHHHHHHHT
T ss_pred             cCeecccccceecCCChHHHHHhh
Confidence            3578888888883333  334443


No 151
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=39.64  E-value=19  Score=19.30  Aligned_cols=10  Identities=20%  Similarity=0.601  Sum_probs=6.0

Q ss_pred             cccCcccccc
Q psy16925        120 YTCPWCSRTF  129 (166)
Q Consensus       120 ~~C~~C~~~f  129 (166)
                      ..|+.||..+
T Consensus        23 V~Cp~CGael   32 (54)
T TIGR01206        23 VICDECGAEL   32 (54)
T ss_pred             EeCCCCCCEE
Confidence            4666666544


No 152
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=39.24  E-value=22  Score=21.95  Aligned_cols=29  Identities=21%  Similarity=0.212  Sum_probs=23.0

Q ss_pred             ccCCCCCccchhhhhhhcCChHHHHHHHH
Q psy16925         15 RNASTLGKYSLALMVTRFSSRSAVTAHTK   43 (166)
Q Consensus        15 ~~~~~~~~~~C~~C~~~~~~~~~l~~H~~   43 (166)
                      ++....|.+-|-+|..-|.+...|..|.+
T Consensus        48 p~lPGlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          48 PELPGLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCCCCCceeeeehhHHHHHHHHHHHHHhc
Confidence            34556677889999999999999988865


No 153
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=38.91  E-value=21  Score=16.83  Aligned_cols=10  Identities=40%  Similarity=1.125  Sum_probs=5.5

Q ss_pred             CcccCccccc
Q psy16925        119 PYTCPWCSRT  128 (166)
Q Consensus       119 p~~C~~C~~~  128 (166)
                      +..|+.||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            4566666643


No 154
>KOG2907|consensus
Probab=38.72  E-value=16  Score=22.84  Aligned_cols=13  Identities=46%  Similarity=1.037  Sum_probs=9.0

Q ss_pred             CcccCcccccccC
Q psy16925        119 PYTCPWCSRTFAN  131 (166)
Q Consensus       119 p~~C~~C~~~f~~  131 (166)
                      -|.|+.|++.|..
T Consensus       102 FYTC~kC~~k~~e  114 (116)
T KOG2907|consen  102 FYTCPKCKYKFTE  114 (116)
T ss_pred             EEEcCccceeeec
Confidence            3678888777654


No 155
>KOG0978|consensus
Probab=38.64  E-value=7.7  Score=32.20  Aligned_cols=20  Identities=30%  Similarity=0.639  Sum_probs=13.1

Q ss_pred             CCcccCcccccccCChhhhh
Q psy16925        118 RPYTCPWCSRTFANGSNCRS  137 (166)
Q Consensus       118 ~p~~C~~C~~~f~~~~~l~~  137 (166)
                      +.-+||.|+.+|....-+..
T Consensus       677 RqRKCP~Cn~aFganDv~~I  696 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRI  696 (698)
T ss_pred             hcCCCCCCCCCCCccccccc
Confidence            34578888888876654433


No 156
>KOG2785|consensus
Probab=38.41  E-value=35  Score=26.23  Aligned_cols=53  Identities=17%  Similarity=0.115  Sum_probs=41.7

Q ss_pred             CccchhhhhhhcCChHHHHHHHHHhhcCC----------------------CCeecccch---hhcCChHHHHHHHhH
Q psy16925         21 GKYSLALMVTRFSSRSAVTAHTKAVHLGE----------------------RPFVCHECG---QSFASKGILQEHLTI   73 (166)
Q Consensus        21 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~----------------------~~~~C~~C~---~~f~~~~~l~~h~~~   73 (166)
                      .+-.|..|+..+.+...-..||...|.--                      ..+.|-.|+   ..|..-.....||..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            34779999999999999999998666421                      236787788   888888888888765


No 157
>KOG1842|consensus
Probab=38.25  E-value=13  Score=29.12  Aligned_cols=29  Identities=31%  Similarity=0.399  Sum_probs=22.5

Q ss_pred             CcccCcccccccCChhhhhhhhhhcchhH
Q psy16925        119 PYTCPWCSRTFANGSNCRSHKRRMHPEEL  147 (166)
Q Consensus       119 p~~C~~C~~~f~~~~~l~~H~~~~h~~~~  147 (166)
                      -|.||+|...|.....|..|.-.-|.++.
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~ed   43 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEED   43 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccccc
Confidence            47888888888888888888877776553


No 158
>KOG0782|consensus
Probab=37.72  E-value=6.9  Score=31.67  Aligned_cols=43  Identities=19%  Similarity=0.171  Sum_probs=30.3

Q ss_pred             ChHHHHHHHhHcCCCCCccCCcCCcccccc-----------ccccCCCcCCCch
Q psy16925         63 SKGILQEHLTIHSDDAPWKCDICSKKSLKL-----------SNVSCGWYPDESK  105 (166)
Q Consensus        63 ~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~-----------~c~~c~~~f~~~~  105 (166)
                      .++.+.+|-..|.....-+|..|+++|.+.           +|.+|.+.|-.+.
T Consensus       237 rE~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~FhsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  237 RESGFVRHHWVHRRRQEGKCNTCGKGFQQKFFFHSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccccchHHhHhhHhhhccccchhhhhhhhheeeccccEEEEEehHHHHHhhcch
Confidence            344677777777665566899999998664           7777777766554


No 159
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=37.53  E-value=16  Score=19.20  Aligned_cols=12  Identities=25%  Similarity=0.493  Sum_probs=8.2

Q ss_pred             CCcccCcccccc
Q psy16925        118 RPYTCPWCSRTF  129 (166)
Q Consensus       118 ~p~~C~~C~~~f  129 (166)
                      ..+.|..||..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            347788887654


No 160
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=37.27  E-value=11  Score=31.44  Aligned_cols=82  Identities=16%  Similarity=0.277  Sum_probs=40.6

Q ss_pred             cchhhhhhhcCChHHHHHHHHHhhcCCCC-eecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCCcC
Q psy16925         23 YSLALMVTRFSSRSAVTAHTKAVHLGERP-FVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYP  101 (166)
Q Consensus        23 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~-~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~~f  101 (166)
                      -.|+.|-+-+.+..+-..+.        | -.|+.||-+|+-...|.-- |.++.=..|           ..|+.|.+.+
T Consensus       102 a~C~~Cl~Ei~dp~~rrY~Y--------PF~~CT~CGPRfTIi~alPYD-R~nTsM~~F-----------~lC~~C~~EY  161 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRYLY--------PFINCTNCGPRFTIIEALPYD-RENTSMADF-----------PLCPFCDKEY  161 (750)
T ss_pred             hhhHHHHHHhcCCCCcceec--------cccccCCCCcceeeeccCCCC-cccCccccC-----------cCCHHHHHHh
Confidence            45777766555444332211        2 2477777777655443211 111111111           1344455555


Q ss_pred             CCchhHHHHhhhhcCCCCcccCccccccc
Q psy16925        102 DESKDLKNHHNLHTGKRPYTCPWCSRTFA  130 (166)
Q Consensus       102 ~~~~~l~~H~~~h~~~~p~~C~~C~~~f~  130 (166)
                      .+..+    .|.|  .+|..|+.||....
T Consensus       162 ~dP~n----RRfH--AQp~aCp~CGP~~~  184 (750)
T COG0068         162 KDPLN----RRFH--AQPIACPKCGPHLF  184 (750)
T ss_pred             cCccc----cccc--cccccCcccCCCeE
Confidence            55544    2334  45789999997543


No 161
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=37.13  E-value=13  Score=19.71  Aligned_cols=12  Identities=33%  Similarity=1.010  Sum_probs=6.4

Q ss_pred             ccCcccccccCC
Q psy16925        121 TCPWCSRTFANG  132 (166)
Q Consensus       121 ~C~~C~~~f~~~  132 (166)
                      .||+|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999988753


No 162
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=36.67  E-value=32  Score=18.59  Aligned_cols=20  Identities=35%  Similarity=0.526  Sum_probs=11.8

Q ss_pred             cCCcCCccccccccccCCCc
Q psy16925         81 KCDICSKKSLKLSNVSCGWY  100 (166)
Q Consensus        81 ~c~~C~~~~~~~~c~~c~~~  100 (166)
                      .|+.|+.-.....|+.||..
T Consensus         7 ~C~~CgvYTLk~~CP~CG~~   26 (56)
T PRK13130          7 KCPKCGVYTLKEICPVCGGK   26 (56)
T ss_pred             ECCCCCCEEccccCcCCCCC
Confidence            56666655545566666644


No 163
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=36.50  E-value=25  Score=22.73  Aligned_cols=36  Identities=28%  Similarity=0.646  Sum_probs=21.7

Q ss_pred             cCCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCcccCccccc
Q psy16925         81 KCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRT  128 (166)
Q Consensus        81 ~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~  128 (166)
                      -|+.||..+-...| .|++.|--           .++....||.|+..
T Consensus        79 gCP~CGn~~~fa~C-~CGkl~Ci-----------~g~~~~~CPwCg~~  114 (131)
T PF15616_consen   79 GCPHCGNQYAFAVC-GCGKLFCI-----------DGEGEVTCPWCGNE  114 (131)
T ss_pred             CCCCCcChhcEEEe-cCCCEEEe-----------CCCCCEECCCCCCe
Confidence            57777776655555 56665432           22334678888764


No 164
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=36.34  E-value=2  Score=20.83  Aligned_cols=11  Identities=18%  Similarity=0.782  Sum_probs=4.7

Q ss_pred             cccCccccccc
Q psy16925        120 YTCPWCSRTFA  130 (166)
Q Consensus       120 ~~C~~C~~~f~  130 (166)
                      ..|..||-.++
T Consensus        22 isC~~CGPr~~   32 (35)
T PF07503_consen   22 ISCTNCGPRYS   32 (35)
T ss_dssp             --BTTCC-SCC
T ss_pred             ccCCCCCCCEE
Confidence            46666665543


No 165
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=36.04  E-value=19  Score=28.50  Aligned_cols=25  Identities=40%  Similarity=0.998  Sum_probs=14.0

Q ss_pred             ccCcccccccCChhhhhhhhhhcch
Q psy16925        121 TCPWCSRTFANGSNCRSHKRRMHPE  145 (166)
Q Consensus       121 ~C~~C~~~f~~~~~l~~H~~~~h~~  145 (166)
                      .|+.|.+.|.....+..|+...|.+
T Consensus        59 iCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   59 ICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eCCcccceeCCHHHHHHHHHHhhhh
Confidence            4555555566655566665544544


No 166
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=35.91  E-value=51  Score=17.53  Aligned_cols=44  Identities=11%  Similarity=0.064  Sum_probs=21.8

Q ss_pred             cCCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCcccCccccccc
Q psy16925         81 KCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFA  130 (166)
Q Consensus        81 ~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~  130 (166)
                      .|+.|+..+.......||..|.. ..+..++..     ...||.|+..+.
T Consensus         3 ~Cpi~~~~~~~Pv~~~~G~v~~~-~~i~~~~~~-----~~~cP~~~~~~~   46 (63)
T smart00504        3 LCPISLEVMKDPVILPSGQTYER-RAIEKWLLS-----HGTDPVTGQPLT   46 (63)
T ss_pred             CCcCCCCcCCCCEECCCCCEEeH-HHHHHHHHH-----CCCCCCCcCCCC
Confidence            34444444443333334444333 334444443     247888887764


No 167
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=35.55  E-value=10  Score=19.06  Aligned_cols=15  Identities=27%  Similarity=0.893  Sum_probs=9.5

Q ss_pred             CCcccCcccccccCC
Q psy16925        118 RPYTCPWCSRTFANG  132 (166)
Q Consensus       118 ~p~~C~~C~~~f~~~  132 (166)
                      .|+.|+.|+..|=..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478999999988654


No 168
>PRK14873 primosome assembly protein PriA; Provisional
Probab=35.15  E-value=27  Score=29.15  Aligned_cols=46  Identities=17%  Similarity=0.403  Sum_probs=22.0

Q ss_pred             ecccchhhcCChHHHHHHHhHcCCCCCccCCcCCccccccccccCCC
Q psy16925         53 VCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGW   99 (166)
Q Consensus        53 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~c~~c~~   99 (166)
                      .|..||+......- ...+..|.......|..||.......|+.|+.
T Consensus       385 ~C~~Cg~~~~C~~C-~~~L~~h~~~~~l~Ch~CG~~~~p~~Cp~Cgs  430 (665)
T PRK14873        385 ACARCRTPARCRHC-TGPLGLPSAGGTPRCRWCGRAAPDWRCPRCGS  430 (665)
T ss_pred             EhhhCcCeeECCCC-CCceeEecCCCeeECCCCcCCCcCccCCCCcC
Confidence            56666665543310 00112233344566777765444445555553


No 169
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=34.95  E-value=30  Score=17.79  Aligned_cols=16  Identities=13%  Similarity=0.316  Sum_probs=11.9

Q ss_pred             CcccCcccccccCChh
Q psy16925        119 PYTCPWCSRTFANGSN  134 (166)
Q Consensus       119 p~~C~~C~~~f~~~~~  134 (166)
                      .+.|+.||..+.....
T Consensus        20 ~~vC~~Cg~~~~~~~~   35 (52)
T smart00661       20 RFVCRKCGYEEPIEQK   35 (52)
T ss_pred             EEECCcCCCeEECCCc
Confidence            5789999987765544


No 170
>PRK12496 hypothetical protein; Provisional
Probab=34.85  E-value=25  Score=23.65  Aligned_cols=10  Identities=40%  Similarity=0.614  Sum_probs=6.5

Q ss_pred             ccCCcCCccc
Q psy16925         80 WKCDICSKKS   89 (166)
Q Consensus        80 ~~c~~C~~~~   89 (166)
                      +.|..|++.|
T Consensus       128 ~~C~gC~~~~  137 (164)
T PRK12496        128 KVCKGCKKKY  137 (164)
T ss_pred             EECCCCCccc
Confidence            5577776666


No 171
>KOG4167|consensus
Probab=33.98  E-value=13  Score=30.97  Aligned_cols=26  Identities=15%  Similarity=0.397  Sum_probs=21.5

Q ss_pred             CcccCcccccccCChhhhhhhhhhcc
Q psy16925        119 PYTCPWCSRTFANGSNCRSHKRRMHP  144 (166)
Q Consensus       119 p~~C~~C~~~f~~~~~l~~H~~~~h~  144 (166)
                      -|-|.+|++.|..--++..|++.|-.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            37899999999988888999987543


No 172
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=33.28  E-value=53  Score=21.30  Aligned_cols=19  Identities=16%  Similarity=0.489  Sum_probs=12.5

Q ss_pred             CCCCeecccchhhcCChHH
Q psy16925         48 GERPFVCHECGQSFASKGI   66 (166)
Q Consensus        48 ~~~~~~C~~C~~~f~~~~~   66 (166)
                      ..+.|.|.+|..+...+..
T Consensus        77 d~~lYeCnIC~etS~ee~F   95 (140)
T PF05290_consen   77 DPKLYECNICKETSAEERF   95 (140)
T ss_pred             CCCceeccCcccccchhhc
Confidence            4566888888777655443


No 173
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=32.69  E-value=31  Score=17.16  Aligned_cols=21  Identities=33%  Similarity=0.776  Sum_probs=12.7

Q ss_pred             cccCcccccccCC--hhhhhhhh
Q psy16925        120 YTCPWCSRTFANG--SNCRSHKR  140 (166)
Q Consensus       120 ~~C~~C~~~f~~~--~~l~~H~~  140 (166)
                      ..|+.||-.|...  .+-..|.+
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~   36 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKK   36 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHH
Confidence            5788888777643  33345544


No 174
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=32.40  E-value=28  Score=27.68  Aligned_cols=27  Identities=15%  Similarity=0.223  Sum_probs=24.2

Q ss_pred             cchhhhhhhcCChHHHHHHHHHhhcCC
Q psy16925         23 YSLALMVTRFSSRSAVTAHTKAVHLGE   49 (166)
Q Consensus        23 ~~C~~C~~~~~~~~~l~~H~~~~h~~~   49 (166)
                      +.|+.|.+.|.+...+..|+...|.+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            679999999999999999999888764


No 175
>PRK05580 primosome assembly protein PriA; Validated
Probab=32.01  E-value=18  Score=30.15  Aligned_cols=45  Identities=24%  Similarity=0.385  Sum_probs=22.3

Q ss_pred             cCCcCCccccccccccCCCcCC---CchhHHHHhhhhcCCCCcccCccccc
Q psy16925         81 KCDICSKKSLKLSNVSCGWYPD---ESKDLKNHHNLHTGKRPYTCPWCSRT  128 (166)
Q Consensus        81 ~c~~C~~~~~~~~c~~c~~~f~---~~~~l~~H~~~h~~~~p~~C~~C~~~  128 (166)
                      .|..|+...   .|+.|+-.+.   ....+.-|..-.....|..|+.||..
T Consensus       383 ~C~~Cg~~~---~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~  430 (679)
T PRK05580        383 LCRDCGWVA---ECPHCDASLTLHRFQRRLRCHHCGYQEPIPKACPECGST  430 (679)
T ss_pred             EhhhCcCcc---CCCCCCCceeEECCCCeEECCCCcCCCCCCCCCCCCcCC
Confidence            566666554   4555654432   12222233333334456677777654


No 176
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=31.45  E-value=24  Score=22.10  Aligned_cols=8  Identities=50%  Similarity=1.394  Sum_probs=5.3

Q ss_pred             cccCcccc
Q psy16925        120 YTCPWCSR  127 (166)
Q Consensus       120 ~~C~~C~~  127 (166)
                      +.||.||.
T Consensus        87 ~~CP~Cgs   94 (115)
T TIGR00100        87 YRCPKCHG   94 (115)
T ss_pred             ccCcCCcC
Confidence            56777764


No 177
>KOG1280|consensus
Probab=31.36  E-value=34  Score=25.96  Aligned_cols=37  Identities=11%  Similarity=0.193  Sum_probs=26.2

Q ss_pred             ccchhhhhhhcCChHHHHHHHHHhhcCCCC-eecccch
Q psy16925         22 KYSLALMVTRFSSRSAVTAHTKAVHLGERP-FVCHECG   58 (166)
Q Consensus        22 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~-~~C~~C~   58 (166)
                      -|.|++|+..=-+...+..|+...|..-.+ ..|+.|.
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            488888888888888888888877764332 3455555


No 178
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=31.34  E-value=26  Score=24.73  Aligned_cols=30  Identities=20%  Similarity=0.127  Sum_probs=21.8

Q ss_pred             CCCccchhhhhhhcCChHHHHHHHHHhhcC
Q psy16925         19 TLGKYSLALMVTRFSSRSAVTAHTKAVHLG   48 (166)
Q Consensus        19 ~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~   48 (166)
                      ...+|.|..|.+.|.-..-...|+...|..
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            345699999999999999999998876653


No 179
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=30.84  E-value=27  Score=21.45  Aligned_cols=15  Identities=40%  Similarity=1.008  Sum_probs=10.3

Q ss_pred             CcccCcccccccCCh
Q psy16925        119 PYTCPWCSRTFANGS  133 (166)
Q Consensus       119 p~~C~~C~~~f~~~~  133 (166)
                      |+.|..||..|...+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            567777777777643


No 180
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.51  E-value=12  Score=21.56  Aligned_cols=8  Identities=38%  Similarity=0.846  Sum_probs=4.8

Q ss_pred             ccCccccc
Q psy16925        121 TCPWCSRT  128 (166)
Q Consensus       121 ~C~~C~~~  128 (166)
                      .|+.|+-.
T Consensus        35 ~ce~c~a~   42 (82)
T COG2331          35 TCEECGAR   42 (82)
T ss_pred             cChhhChH
Confidence            56666643


No 181
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=30.51  E-value=28  Score=21.29  Aligned_cols=10  Identities=20%  Similarity=0.810  Sum_probs=5.4

Q ss_pred             CCccCCcCCc
Q psy16925         78 APWKCDICSK   87 (166)
Q Consensus        78 ~~~~c~~C~~   87 (166)
                      +.|.|+.|+.
T Consensus        21 k~FtCp~Cgh   30 (104)
T COG4888          21 KTFTCPRCGH   30 (104)
T ss_pred             ceEecCccCC
Confidence            4455666554


No 182
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=30.48  E-value=47  Score=17.90  Aligned_cols=16  Identities=19%  Similarity=0.457  Sum_probs=11.0

Q ss_pred             CCCCcccCcccccccC
Q psy16925        116 GKRPYTCPWCSRTFAN  131 (166)
Q Consensus       116 ~~~p~~C~~C~~~f~~  131 (166)
                      +...|.|+.||..+--
T Consensus        11 ~~v~~~Cp~cGipthc   26 (55)
T PF13824_consen   11 AHVNFECPDCGIPTHC   26 (55)
T ss_pred             cccCCcCCCCCCcCcc
Confidence            3456899999876543


No 183
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=29.69  E-value=16  Score=18.24  Aligned_cols=12  Identities=33%  Similarity=1.256  Sum_probs=8.9

Q ss_pred             CCcccCcccccc
Q psy16925        118 RPYTCPWCSRTF  129 (166)
Q Consensus       118 ~p~~C~~C~~~f  129 (166)
                      ++..|+.|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            357888888776


No 184
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=29.45  E-value=29  Score=21.67  Aligned_cols=7  Identities=43%  Similarity=1.303  Sum_probs=4.6

Q ss_pred             cccCccc
Q psy16925        120 YTCPWCS  126 (166)
Q Consensus       120 ~~C~~C~  126 (166)
                      +.||.||
T Consensus        87 ~~CP~Cg   93 (113)
T PRK12380         87 AQCPHCH   93 (113)
T ss_pred             ccCcCCC
Confidence            4577776


No 185
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=29.29  E-value=14  Score=17.96  Aligned_cols=11  Identities=27%  Similarity=0.326  Sum_probs=4.4

Q ss_pred             HHHhhhhhhhh
Q psy16925        151 ESSLGKIFLYG  161 (166)
Q Consensus       151 c~~c~~~f~~~  161 (166)
                      |+.|+|.|-|+
T Consensus         5 CprC~kg~Hwa   15 (36)
T PF14787_consen    5 CPRCGKGFHWA   15 (36)
T ss_dssp             -TTTSSSCS-T
T ss_pred             CcccCCCcchh
Confidence            44555554443


No 186
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=28.48  E-value=39  Score=22.90  Aligned_cols=39  Identities=15%  Similarity=0.113  Sum_probs=23.1

Q ss_pred             CCcccCcccccccCChhhhhhh---hhhc------chhHHHHHHHhhh
Q psy16925        118 RPYTCPWCSRTFANGSNCRSHK---RRMH------PEELKLYESSLGK  156 (166)
Q Consensus       118 ~p~~C~~C~~~f~~~~~l~~H~---~~~h------~~~~~~~c~~c~~  156 (166)
                      .++.|..||+.|.....+..-.   ..+.      ..+....|+.|.+
T Consensus       113 ~~~~C~~CG~~f~~~~~i~~~~~~l~~~~~~~~~~~~~~~~~C~~Cr~  160 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEIDYAIALLKHNGDSRAENHRESFETCPECKR  160 (180)
T ss_pred             CcccchhhCCccccHHHHHHHHHHHhhccchhHHHHHHHHhhCHHHhc
Confidence            4679999999998765443221   1110      1233455888876


No 187
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=28.46  E-value=43  Score=22.12  Aligned_cols=12  Identities=17%  Similarity=0.534  Sum_probs=5.8

Q ss_pred             cCCcCCcccccc
Q psy16925         81 KCDICSKKSLKL   92 (166)
Q Consensus        81 ~c~~C~~~~~~~   92 (166)
                      .|..|++.|.+.
T Consensus        30 eC~~C~~RFTTy   41 (147)
T TIGR00244        30 ECLECHERFTTF   41 (147)
T ss_pred             cCCccCCcccee
Confidence            455555555443


No 188
>KOG4118|consensus
Probab=26.88  E-value=75  Score=17.76  Aligned_cols=26  Identities=8%  Similarity=0.138  Sum_probs=15.2

Q ss_pred             ccchhhhhhhcCChHHHHHHHHHhhc
Q psy16925         22 KYSLALMVTRFSSRSAVTAHTKAVHL   47 (166)
Q Consensus        22 ~~~C~~C~~~~~~~~~l~~H~~~~h~   47 (166)
                      .|.|..|.-...+...+..|....|.
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHp   63 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHP   63 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCC
Confidence            35666666666666666666554443


No 189
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=26.85  E-value=26  Score=16.28  Aligned_cols=9  Identities=33%  Similarity=0.925  Sum_probs=5.4

Q ss_pred             CcccCcccc
Q psy16925        119 PYTCPWCSR  127 (166)
Q Consensus       119 p~~C~~C~~  127 (166)
                      .+.|+.|+.
T Consensus        19 ~~vCp~C~~   27 (30)
T PF08274_consen   19 LLVCPECGH   27 (30)
T ss_dssp             SEEETTTTE
T ss_pred             EEeCCcccc
Confidence            366666654


No 190
>COG1773 Rubredoxin [Energy production and conversion]
Probab=26.09  E-value=29  Score=18.70  Aligned_cols=16  Identities=13%  Similarity=0.542  Sum_probs=12.1

Q ss_pred             CcccCcccccccCChh
Q psy16925        119 PYTCPWCSRTFANGSN  134 (166)
Q Consensus       119 p~~C~~C~~~f~~~~~  134 (166)
                      .|+|..||..|.....
T Consensus         3 ~~~C~~CG~vYd~e~G   18 (55)
T COG1773           3 RWRCSVCGYVYDPEKG   18 (55)
T ss_pred             ceEecCCceEeccccC
Confidence            4789999998875543


No 191
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=26.04  E-value=50  Score=21.93  Aligned_cols=12  Identities=17%  Similarity=0.551  Sum_probs=6.6

Q ss_pred             cCCcCCcccccc
Q psy16925         81 KCDICSKKSLKL   92 (166)
Q Consensus        81 ~c~~C~~~~~~~   92 (166)
                      .|..|+..|.+.
T Consensus        30 eC~~C~~RFTTf   41 (156)
T COG1327          30 ECLECGERFTTF   41 (156)
T ss_pred             cccccccccchh
Confidence            456666555543


No 192
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=26.03  E-value=21  Score=18.89  Aligned_cols=23  Identities=26%  Similarity=0.592  Sum_probs=11.6

Q ss_pred             CcccCcccccccCChhhhhhhhh
Q psy16925        119 PYTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus       119 p~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      .|+|+.|+..|-..-+.-.|...
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~L   43 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHETL   43 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTTS
T ss_pred             eEECCCCCCccccCcChhhhccc
Confidence            47777777777666666666554


No 193
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=25.99  E-value=50  Score=25.91  Aligned_cols=14  Identities=14%  Similarity=0.456  Sum_probs=10.2

Q ss_pred             CcccCcccccccCC
Q psy16925        119 PYTCPWCSRTFANG  132 (166)
Q Consensus       119 p~~C~~C~~~f~~~  132 (166)
                      -|+|+.||..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            58888888776644


No 194
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=25.95  E-value=11  Score=18.77  Aligned_cols=10  Identities=30%  Similarity=1.059  Sum_probs=6.7

Q ss_pred             cccCcccccc
Q psy16925        120 YTCPWCSRTF  129 (166)
Q Consensus       120 ~~C~~C~~~f  129 (166)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            6777777654


No 195
>KOG0320|consensus
Probab=25.88  E-value=20  Score=24.39  Aligned_cols=14  Identities=21%  Similarity=0.520  Sum_probs=8.8

Q ss_pred             CCeecccchhhcCC
Q psy16925         50 RPFVCHECGQSFAS   63 (166)
Q Consensus        50 ~~~~C~~C~~~f~~   63 (166)
                      ..|.|++|...+..
T Consensus       130 ~~~~CPiCl~~~se  143 (187)
T KOG0320|consen  130 GTYKCPICLDSVSE  143 (187)
T ss_pred             cccCCCceecchhh
Confidence            34777777766644


No 196
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=25.86  E-value=41  Score=24.30  Aligned_cols=12  Identities=33%  Similarity=1.057  Sum_probs=7.0

Q ss_pred             CCeecccchhhc
Q psy16925         50 RPFVCHECGQSF   61 (166)
Q Consensus        50 ~~~~C~~C~~~f   61 (166)
                      ..|.|..|....
T Consensus       111 rqFaC~~Cd~~W  122 (278)
T PF15135_consen  111 RQFACSSCDHMW  122 (278)
T ss_pred             eeeeccccchHH
Confidence            446677666443


No 197
>KOG2636|consensus
Probab=25.75  E-value=46  Score=26.23  Aligned_cols=28  Identities=21%  Similarity=0.427  Sum_probs=22.6

Q ss_pred             hhhcCCCCcccCccc-ccccCChhhhhhh
Q psy16925        112 NLHTGKRPYTCPWCS-RTFANGSNCRSHK  139 (166)
Q Consensus       112 ~~h~~~~p~~C~~C~-~~f~~~~~l~~H~  139 (166)
                      +.|.-...|.|.+|| +++.-.-.+.+|.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHh
Confidence            346667789999999 8888888888885


No 198
>PRK05978 hypothetical protein; Provisional
Probab=24.97  E-value=53  Score=21.73  Aligned_cols=7  Identities=43%  Similarity=1.341  Sum_probs=3.1

Q ss_pred             ecccchh
Q psy16925         53 VCHECGQ   59 (166)
Q Consensus        53 ~C~~C~~   59 (166)
                      +|+.|++
T Consensus        35 rCP~CG~   41 (148)
T PRK05978         35 RCPACGE   41 (148)
T ss_pred             cCCCCCC
Confidence            3444443


No 199
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=24.54  E-value=26  Score=22.81  Aligned_cols=15  Identities=33%  Similarity=0.869  Sum_probs=12.5

Q ss_pred             CCCcccCcccccccC
Q psy16925        117 KRPYTCPWCSRTFAN  131 (166)
Q Consensus       117 ~~p~~C~~C~~~f~~  131 (166)
                      .+|.+|++||..|..
T Consensus       110 g~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  110 GKPQRCPECGQVFKL  124 (136)
T ss_dssp             TSEEEETTTEEEEEE
T ss_pred             CCccCCCCCCeEEEE
Confidence            458999999999864


No 200
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=24.03  E-value=30  Score=15.97  Aligned_cols=6  Identities=33%  Similarity=1.542  Sum_probs=2.4

Q ss_pred             CCcCCc
Q psy16925         82 CDICSK   87 (166)
Q Consensus        82 c~~C~~   87 (166)
                      |.+|+.
T Consensus         5 C~vC~~   10 (30)
T PF04438_consen    5 CSVCGN   10 (30)
T ss_dssp             ETSSSS
T ss_pred             CccCcC
Confidence            334443


No 201
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.93  E-value=36  Score=21.66  Aligned_cols=8  Identities=38%  Similarity=1.161  Sum_probs=5.3

Q ss_pred             cccCcccc
Q psy16925        120 YTCPWCSR  127 (166)
Q Consensus       120 ~~C~~C~~  127 (166)
                      +.||.||.
T Consensus        93 ~~CP~Cgs  100 (124)
T PRK00762         93 IECPVCGN  100 (124)
T ss_pred             CcCcCCCC
Confidence            46777773


No 202
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.92  E-value=43  Score=21.07  Aligned_cols=7  Identities=29%  Similarity=0.885  Sum_probs=4.4

Q ss_pred             ccCcccc
Q psy16925        121 TCPWCSR  127 (166)
Q Consensus       121 ~C~~C~~  127 (166)
                      .||.||.
T Consensus        90 ~CP~Cgs   96 (117)
T PRK00564         90 VCEKCHS   96 (117)
T ss_pred             cCcCCCC
Confidence            3777764


No 203
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=23.77  E-value=43  Score=23.85  Aligned_cols=16  Identities=25%  Similarity=0.459  Sum_probs=13.1

Q ss_pred             CCCCcccCcccccccC
Q psy16925        116 GKRPYTCPWCSRTFAN  131 (166)
Q Consensus       116 ~~~p~~C~~C~~~f~~  131 (166)
                      ..++.+|++||..|..
T Consensus       178 EGkpqRCpECGqVFKL  193 (268)
T PTZ00043        178 EGFLYRCGECDQIFML  193 (268)
T ss_pred             CCCCccCCCCCcEEEE
Confidence            4558999999999874


No 204
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=23.75  E-value=50  Score=15.70  Aligned_cols=20  Identities=35%  Similarity=0.664  Sum_probs=11.5

Q ss_pred             cccCcccccccCChhhhhhhh
Q psy16925        120 YTCPWCSRTFANGSNCRSHKR  140 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~  140 (166)
                      +.|+.|++... .+.+..|+.
T Consensus         5 ~~C~nC~R~v~-a~RfA~HLe   24 (33)
T PF08209_consen    5 VECPNCGRPVA-ASRFAPHLE   24 (33)
T ss_dssp             EE-TTTSSEEE-GGGHHHHHH
T ss_pred             EECCCCcCCcc-hhhhHHHHH
Confidence            57777877654 344556654


No 205
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=23.64  E-value=29  Score=24.10  Aligned_cols=46  Identities=20%  Similarity=0.432  Sum_probs=28.5

Q ss_pred             CCCccCCcCCccccccccccCCCcCCCchhHHHHhhhhcCCCCcccCccccc
Q psy16925         77 DAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRT  128 (166)
Q Consensus        77 ~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~  128 (166)
                      +.||.|..|-+.|....-..||-.|-..-....-      .+.-.|.+||+.
T Consensus       194 ~IPF~C~iCKkdy~spvvt~CGH~FC~~Cai~~y------~kg~~C~~Cgk~  239 (259)
T COG5152         194 KIPFLCGICKKDYESPVVTECGHSFCSLCAIRKY------QKGDECGVCGKA  239 (259)
T ss_pred             CCceeehhchhhccchhhhhcchhHHHHHHHHHh------ccCCcceecchh
Confidence            4678888888888776666677666544332221      122467888775


No 206
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=23.08  E-value=38  Score=17.81  Aligned_cols=13  Identities=23%  Similarity=0.779  Sum_probs=10.7

Q ss_pred             cccCcccccccCC
Q psy16925        120 YTCPWCSRTFANG  132 (166)
Q Consensus       120 ~~C~~C~~~f~~~  132 (166)
                      |+|..||+.|...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            7899999988754


No 207
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.99  E-value=21  Score=19.66  Aligned_cols=18  Identities=17%  Similarity=0.257  Sum_probs=11.4

Q ss_pred             cCCCCCccchhhhhhhcC
Q psy16925         16 NASTLGKYSLALMVTRFS   33 (166)
Q Consensus        16 ~~~~~~~~~C~~C~~~~~   33 (166)
                      +.+..+...|++|+..|+
T Consensus        42 ~mg~~gev~CPYC~t~y~   59 (62)
T COG4391          42 DMGDEGEVVCPYCSTRYR   59 (62)
T ss_pred             EcCCCCcEecCccccEEE
Confidence            345556677777776664


No 208
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=22.37  E-value=23  Score=19.16  Aligned_cols=13  Identities=23%  Similarity=0.848  Sum_probs=7.3

Q ss_pred             CCCeecccchhhc
Q psy16925         49 ERPFVCHECGQSF   61 (166)
Q Consensus        49 ~~~~~C~~C~~~f   61 (166)
                      -..|.|..|....
T Consensus        29 i~tYmC~eC~~RI   41 (56)
T PF09963_consen   29 IHTYMCDECKERI   41 (56)
T ss_pred             CcceeChhHHHHH
Confidence            3346676666543


No 209
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=22.08  E-value=66  Score=19.69  Aligned_cols=12  Identities=25%  Similarity=0.296  Sum_probs=6.6

Q ss_pred             cccCcccccccC
Q psy16925        120 YTCPWCSRTFAN  131 (166)
Q Consensus       120 ~~C~~C~~~f~~  131 (166)
                      ..|+.||..+..
T Consensus        43 ~~C~~CG~y~~~   54 (99)
T PRK14892         43 ITCGNCGLYTEF   54 (99)
T ss_pred             EECCCCCCccCE
Confidence            456666655443


No 210
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=21.90  E-value=42  Score=16.68  Aligned_cols=6  Identities=50%  Similarity=1.824  Sum_probs=1.6

Q ss_pred             cccCcc
Q psy16925        120 YTCPWC  125 (166)
Q Consensus       120 ~~C~~C  125 (166)
                      +.|++|
T Consensus        37 ~~CP~C   42 (42)
T PF15227_consen   37 FSCPEC   42 (42)
T ss_dssp             ---SSS
T ss_pred             CCCcCC
Confidence            556554


No 211
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=21.02  E-value=84  Score=20.93  Aligned_cols=30  Identities=23%  Similarity=0.329  Sum_probs=15.8

Q ss_pred             CCCccCCcCCccccccccccCCCcCCCchhHHHHhh
Q psy16925         77 DAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHN  112 (166)
Q Consensus        77 ~~~~~c~~C~~~~~~~~c~~c~~~f~~~~~l~~H~~  112 (166)
                      .-.-+|..|++.|..      |+.-...+.+..|+.
T Consensus        12 ~~vv~C~~c~kWFCN------g~~~~s~SHIv~HLv   41 (152)
T PF09416_consen   12 SCVVKCNTCNKWFCN------GRGNTSGSHIVNHLV   41 (152)
T ss_dssp             CCEEEETTTTEEEES--------TTSSS-HHHHHHH
T ss_pred             ccEeEcCCCCcEeec------CCCCCcccHHHHHHH
Confidence            344567777777732      222235666777753


No 212
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=20.87  E-value=36  Score=17.64  Aligned_cols=15  Identities=27%  Similarity=0.844  Sum_probs=11.6

Q ss_pred             cccCcccccccCChh
Q psy16925        120 YTCPWCSRTFANGSN  134 (166)
Q Consensus       120 ~~C~~C~~~f~~~~~  134 (166)
                      |+|..|+..+.....
T Consensus         2 y~C~~CgyvYd~~~G   16 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKG   16 (47)
T ss_dssp             EEETTTSBEEETTTB
T ss_pred             cCCCCCCEEEcCCcC
Confidence            789999988876544


No 213
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.75  E-value=18  Score=25.74  Aligned_cols=29  Identities=17%  Similarity=0.472  Sum_probs=19.3

Q ss_pred             CCCeecccchhhcCChHHHHHHHhHcCCC
Q psy16925         49 ERPFVCHECGQSFASKGILQEHLTIHSDD   77 (166)
Q Consensus        49 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~   77 (166)
                      ++...|++|+..|..+.-+..-+++-.++
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRiiagD   45 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRIIAGD   45 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEeccc
Confidence            55678999998887766555555554443


No 214
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=20.69  E-value=43  Score=15.85  Aligned_cols=11  Identities=27%  Similarity=0.918  Sum_probs=7.5

Q ss_pred             cccCccccccc
Q psy16925        120 YTCPWCSRTFA  130 (166)
Q Consensus       120 ~~C~~C~~~f~  130 (166)
                      +.|..|+.+|.
T Consensus        22 ~~C~~Cg~~~~   32 (33)
T PF08792_consen   22 EVCIFCGSSFP   32 (33)
T ss_pred             EEcccCCcEee
Confidence            56777777664


Done!