Query         psy16929
Match_columns 172
No_of_seqs    123 out of 203
Neff          4.3 
Searched_HMMs 46136
Date          Fri Aug 16 17:17:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16929.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16929hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05826 Phospholip_A2_2:  Phos 100.0 9.3E-38   2E-42  234.5   2.1   78   56-133     1-99  (99)
  2 cd04704 PLA2_bee_venom_like PL 100.0 6.5E-37 1.4E-41  229.6   4.8   76   55-130     1-97  (97)
  3 cd04705 PLA2_group_III_like PL  99.6 1.2E-16 2.5E-21  121.2   1.3   59   71-129    24-100 (100)
  4 cd00618 PLA2_like PLA2_like: P  99.1 1.9E-11 4.2E-16   87.0   2.7   46   57-104     1-46  (83)
  5 smart00085 PA2c Phospholipase   98.9 1.4E-10   3E-15   89.5  -0.4   76   51-131    14-102 (117)
  6 cd04706 PLA2_plant PLA2_plant:  97.6 4.9E-05 1.1E-09   59.5   2.5   38   56-95     21-58  (117)
  7 cd04707 otoconin_90 otoconin_9  96.1  0.0017 3.7E-08   50.6   0.4   31   60-96     21-51  (117)
  8 cd00125 PLA2c PLA2c: Phospholi  96.0  0.0019 4.1E-08   50.1   0.0   31   61-97     25-55  (115)
  9 PF08398 Parvo_coat_N:  Parvovi  95.7  0.0022 4.8E-08   45.6  -0.5   43   57-102     1-44  (64)
 10 KOG4087|consensus               93.6   0.022 4.8E-07   46.1   0.3   30   61-96     46-75  (144)
 11 PF00068 Phospholip_A2_1:  Phos  89.7   0.047   1E-06   41.9  -1.8   31   61-97     26-56  (116)
 12 PF08036 Antimicrobial_6:  Diap  44.9     6.1 0.00013   25.6  -0.3   12   79-90     15-26  (39)
 13 KOG3784|consensus               22.7      23 0.00049   33.3  -0.6   42  118-168   302-343 (407)

No 1  
>PF05826 Phospholip_A2_2:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1POC_A.
Probab=100.00  E-value=9.3e-38  Score=234.51  Aligned_cols=78  Identities=49%  Similarity=1.070  Sum_probs=59.8

Q ss_pred             eecCccccCCCCCCCCCCCCCCCCccccccccccCCccccccCCccCCccCCCh---------------------HHHHH
Q psy16929         56 YFTGTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDAN---------------------PLAIE  114 (172)
Q Consensus        56 i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~~~~tkyGl~N~~~---------------------~~S~~  114 (172)
                      |+|||||||+||+|.+|+|||.+.+||+|||+||+||++|+++++||||+|.++                     .+|+.
T Consensus         1 i~pGT~WCG~gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~~hC~Cd~~f~~CL~~~~~~~a~~   80 (99)
T PF05826_consen    1 IYPGTKWCGPGNIAKNYSDLGEFKETDRCCREHDHCPDKIPPGETKYGLHNPRPFTISHCDCDSRFYQCLKNVNTSTANE   80 (99)
T ss_dssp             B-TT-SSSBSS---SSTT---SSHHHHHHHHHHHT-SSEE-TT-EETTEE--SSS-EEBHHHHHHHHHHHHTS-HHHHHH
T ss_pred             CCCCCcccCCCCCccCcccccccHHHHHHHHhhccCCCccCCCccccccccCCcCceeecCcccHHHHHHHHcCCchHHH
Confidence            799999999999999999999999999999999999999999999999999999                     78999


Q ss_pred             HHhHhhcccCCceeeecCC
Q psy16929        115 VGIAYFDILKPMCFRFDFP  133 (172)
Q Consensus       115 VG~~YFnvl~~~CF~~~~p  133 (172)
                      ||.+||||++++||++++|
T Consensus        81 Vg~~yF~v~~~~Cf~~~~p   99 (99)
T PF05826_consen   81 VGNIYFNVLQPPCFELEYP   99 (99)
T ss_dssp             HHHHHHHTS---EEEEES-
T ss_pred             HHHHHHhccCCCeeCccCC
Confidence            9999999999999999987


No 2  
>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of  Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s.
Probab=100.00  E-value=6.5e-37  Score=229.63  Aligned_cols=76  Identities=47%  Similarity=0.968  Sum_probs=73.9

Q ss_pred             eeecCccccCCCCCCCCCCCCCCCCccccccccccCCccccccCCccCCccCCCh---------------------HHHH
Q psy16929         55 FYFTGTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDAN---------------------PLAI  113 (172)
Q Consensus        55 ~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~~~~tkyGl~N~~~---------------------~~S~  113 (172)
                      +|+|||||||+||+|.+|+|||.+.+||+|||+||+||++|.+++++|||+|.++                     .+|+
T Consensus         1 ~~~pGTkWCG~Gn~a~~~~dlG~~~~tD~CCr~HD~C~~~i~~~~~kyg~~N~~~~t~~~C~CD~~f~~CL~~~~~~~s~   80 (97)
T cd04704           1 FIVPGTKWCGPGNIATNYSDLGAFRETDKCCREHDHCPDIISAGEYKYGLTNTRLFTRSHCDCDNRFRQCLKNVNDSTSN   80 (97)
T ss_pred             CccCCCeecCCCCCCCCcccccCccccchHHHccccCcCcccccccccCccCCCccccccCcHHHHHHHHHHHcCCHHHH
Confidence            5899999999999999999999999999999999999999999999999999999                     8899


Q ss_pred             HHHhHhhcccCCceeee
Q psy16929        114 EVGIAYFDILKPMCFRF  130 (172)
Q Consensus       114 ~VG~~YFnvl~~~CF~~  130 (172)
                      +||++||||++++||++
T Consensus        81 ~vG~~yFnv~~~~Cf~~   97 (97)
T cd04704          81 QVGKIYFNVLQVPCFEL   97 (97)
T ss_pred             HHHHHhhcccCCCccCC
Confidence            99999999999999975


No 3  
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of  Phospholipase A2, similar to human group III PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers.
Probab=99.61  E-value=1.2e-16  Score=121.23  Aligned_cols=59  Identities=25%  Similarity=0.479  Sum_probs=49.5

Q ss_pred             CCCCCCCCCccccccccccCCccccccCCccCCccCCCh------------------HHHHHHHhHhhcccCCceee
Q psy16929         71 DISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDAN------------------PLAIEVGIAYFDILKPMCFR  129 (172)
Q Consensus        71 ~y~dLG~~~~tD~CCR~HD~Cp~~I~~~~tkyGl~N~~~------------------~~S~~VG~~YFnvl~~~CF~  129 (172)
                      ...+||.+.+||+|||+||+||+.|.+++++|||+|.++                  .-+-+||.++|+++++.||.
T Consensus        24 ~~~~lG~~~~~DrCCR~HD~Cp~~I~~~~~k~gl~N~~~~tisHCdCD~rf~~CL~~~n~~~~~~~~s~~lG~~~Fn  100 (100)
T cd04705          24 PFLSEGEFKEPDRCCWKHKQCPGHIIPPFSSDGHHNFHLHSVSHCDCDSRLKDCLRLSSSSRVGPTCSHLLGTTCFN  100 (100)
T ss_pred             cccccccccchhhhhhhhhcCccccCCcccccceecCCCcccccccHHHHHHHHHHHcCCccccccHHHHhcccccC
Confidence            347899999999999999999999999999999999999                  11112677888888888774


No 4  
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately 
Probab=99.15  E-value=1.9e-11  Score=87.00  Aligned_cols=46  Identities=26%  Similarity=0.495  Sum_probs=41.7

Q ss_pred             ecCccccCCCCCCCCCCCCCCCCccccccccccCCccccccCCccCCc
Q psy16929         57 FTGTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNL  104 (172)
Q Consensus        57 ~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~~~~tkyGl  104 (172)
                      .|+++|||.|+.|.++..++  .+||+|||.||+|++.|...+.+++.
T Consensus         1 ~~ygc~CG~g~~~~~~g~p~--D~~D~CC~~HD~Cy~~~~~~~~~~~~   46 (83)
T cd00618           1 LPYGCYCGPGGSACPSGQPV--DETDRCCRKHDCCYDQISDGGCCDGC   46 (83)
T ss_pred             CCcCcccCCCCcCCCCCCCC--CcchhhhhhCccHhhhhhccCCCCCc
Confidence            37899999999999888887  69999999999999999999888873


No 5  
>smart00085 PA2c Phospholipase A2.
Probab=98.93  E-value=1.4e-10  Score=89.45  Aligned_cols=76  Identities=20%  Similarity=0.180  Sum_probs=57.9

Q ss_pred             eccceeecCccccCCCCCCCCCCCCCCCCccccccccccCCccccccCCccCCccCCCh-------------HHHHHHHh
Q psy16929         51 VCSMFYFTGTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDAN-------------PLAIEVGI  117 (172)
Q Consensus        51 ~~~~~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~~~~tkyGl~N~~~-------------~~S~~VG~  117 (172)
                      ..+.++.++|+||+-|+.+....    ..+||+||++||+|.+.|++ +.-+..++.+-             ..+..++.
T Consensus        14 ~~~~~~~y~~YGCyCG~gg~G~p----vD~~D~CC~~HD~Cy~~~~~-~~C~~~~~~y~~~c~~~~~~C~~~~~~C~~~~   88 (117)
T smart00085       14 GKRAWLSYGDYGCYCGWGGSGTP----VDATDRCCFVHDCCYGKAEK-EGCNPKTTTYSYSCDNGFITCGGKNTACLVFV   88 (117)
T ss_pred             CCCcccchhccCcccCCCCCCCc----cccccchhhhcCchhhhccc-CCCcccccceEEEEECCcceECcCCCccceee
Confidence            34668999999999998876543    46899999999999999987 44333333222             34678889


Q ss_pred             HhhcccCCceeeec
Q psy16929        118 AYFDILKPMCFRFD  131 (172)
Q Consensus       118 ~YFnvl~~~CF~~~  131 (172)
                      .+||.....||+..
T Consensus        89 C~CD~~aa~Cf~~~  102 (117)
T smart00085       89 CECDRAAAICFAKN  102 (117)
T ss_pred             cccCHHHHHHhhhC
Confidence            99999999999864


No 6  
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of  Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. This sub-family does not appear to have a conserved active site and metal-binding loop.
Probab=97.55  E-value=4.9e-05  Score=59.47  Aligned_cols=38  Identities=29%  Similarity=0.667  Sum_probs=28.8

Q ss_pred             eecCccccCCCCCCCCCCCCCCCCccccccccccCCcccc
Q psy16929         56 YFTGTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENI   95 (172)
Q Consensus        56 i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I   95 (172)
                      ..--.+|||+|+.+..  ++..-..+|+||+.||+|-+..
T Consensus        21 y~~YG~yCG~g~~g~~--~~~P~D~lD~CC~~HD~Cy~~~   58 (117)
T cd04706          21 FLRYGKYCGPGYSGCP--GERPCDDLDACCMTHDACVQAK   58 (117)
T ss_pred             ccccCcccCCCCCCCC--CCCCcchhhHHHHhCcCcccCC
Confidence            3347899999987632  3334568999999999999854


No 7  
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia. Interactions involving otoconin-90 may trigger or constitute key events in otoconia formation. The PLA2-like domains in otoconins may have lost their metal-binding sites.
Probab=96.12  E-value=0.0017  Score=50.63  Aligned_cols=31  Identities=26%  Similarity=0.673  Sum_probs=23.9

Q ss_pred             ccccCCCCCCCCCCCCCCCCccccccccccCCccccc
Q psy16929         60 TKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIV   96 (172)
Q Consensus        60 TkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~   96 (172)
                      --|||.|.....-      -++|+||..||.|-+.+.
T Consensus        21 GCyCG~GG~G~Pv------D~~DrCC~~HD~CY~~~~   51 (117)
T cd04707          21 GCYCGQEGEGLPV------DELDRCCFQHRCCLEQAS   51 (117)
T ss_pred             CCcccCCCCCCCc------ccchhHHHHhHHHHhhhh
Confidence            3589999864433      269999999999998554


No 8  
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately to a block in 
Probab=95.97  E-value=0.0019  Score=50.08  Aligned_cols=31  Identities=32%  Similarity=0.793  Sum_probs=24.2

Q ss_pred             cccCCCCCCCCCCCCCCCCccccccccccCCcccccc
Q psy16929         61 KWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVA   97 (172)
Q Consensus        61 kWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~~   97 (172)
                      -|||.|....+-      -.+|+||+.||.|-..+..
T Consensus        25 CyCG~GG~G~Pv------D~~DrCC~~HD~CY~~~~~   55 (115)
T cd00125          25 CYCGLGGSGTPV------DDTDRCCQVHDCCYDRAEK   55 (115)
T ss_pred             CccCCCCCCCCc------ccHHHHHHHHHhHHhcccc
Confidence            589998865433      2589999999999987754


No 9  
>PF08398 Parvo_coat_N:  Parvovirus coat protein VP1;  InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides. Parvoviruses have been described that infect a wide range of invertebrates and vertebrates and are well known for causing enteric disease in mammals. Genomes contains two large ORFs: NS1 and VP1; other ORFs are found in some sub-types and different gene products can arise from splice variants and the use of different start codons [].  This is the N-terminal region of the Parvovirus VP1 coat protein []; its function is not known. ; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=95.71  E-value=0.0022  Score=45.59  Aligned_cols=43  Identities=21%  Similarity=0.400  Sum_probs=32.2

Q ss_pred             ecCccccCCCCCCCCCCCCCCCCccccccccccCCcc-ccccCCccC
Q psy16929         57 FTGTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPE-NIVAKSTKY  102 (172)
Q Consensus        57 ~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~-~I~~~~tky  102 (172)
                      +||++++||||.-.+-..   -..+|..||+||.+-+ .|..+..-|
T Consensus         1 lPg~~YlGPgn~l~~g~P---v~~~D~aA~~HD~aY~~~lk~G~NPY   44 (64)
T PF08398_consen    1 LPGYKYLGPGNPLDNGEP---VNPVDAAAREHDEAYDELLKHGDNPY   44 (64)
T ss_pred             CCCCCccCCCCCcCCCCC---CCHHHHHHHHHHHHHHHHHHcCCCCc
Confidence            599999999998655443   3579999999998877 555554333


No 10 
>KOG4087|consensus
Probab=93.59  E-value=0.022  Score=46.15  Aligned_cols=30  Identities=33%  Similarity=0.806  Sum_probs=23.4

Q ss_pred             cccCCCCCCCCCCCCCCCCccccccccccCCccccc
Q psy16929         61 KWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIV   96 (172)
Q Consensus        61 kWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~   96 (172)
                      =|||-|-....-+      ++|+||..||.|-+-..
T Consensus        46 CyCGlGG~G~P~D------~iDwCC~~HDcCY~~le   75 (144)
T KOG4087|consen   46 CYCGLGGSGQPKD------AIDWCCHAHDCCYDRLE   75 (144)
T ss_pred             ccccCCCCCCccc------hHHHHHhcccHHHHHHH
Confidence            5899888655432      59999999999988554


No 11 
>PF00068 Phospholip_A2_1:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1OQS_F 1S6B_B 1XXW_B 1MH2_B 2RD4_B 1OZ6_A 2OSN_A 2PH4_B 1FDK_A 2BP2_A ....
Probab=89.69  E-value=0.047  Score=41.86  Aligned_cols=31  Identities=35%  Similarity=0.832  Sum_probs=21.9

Q ss_pred             cccCCCCCCCCCCCCCCCCccccccccccCCcccccc
Q psy16929         61 KWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVA   97 (172)
Q Consensus        61 kWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~~   97 (172)
                      -|||.|....+      --++|+||+.|+.|-.-+..
T Consensus        26 CyCg~~g~G~P------vD~iD~~C~~h~~Cy~~~~~   56 (116)
T PF00068_consen   26 CYCGFGGKGQP------VDEIDRCCRKHDQCYKCAKE   56 (116)
T ss_dssp             TTBSSSSSSS-------SSHHHHHHHHHHHHHHHHTT
T ss_pred             ccCCCCCCCCC------cccccchhHHhHHHHHHHhc
Confidence            38988764332      23689999999999875544


No 12 
>PF08036 Antimicrobial_6:  Diapausin family of antimicrobial peptide;  InterPro: IPR012525 This family consists of diapausin-related antimicrobial peptides. Diapause during periods of environmental adversity is an essential part of the life cycle of many organisms with the molecular basis being different among animals. Diapause-specific peptides provide anti-fungal activity and act as N-type voltage-gated calcium channel blocker [].; GO: 0050832 defense response to fungus, 0005576 extracellular region; PDB: 2E2F_A.
Probab=44.85  E-value=6.1  Score=25.64  Aligned_cols=12  Identities=42%  Similarity=1.043  Sum_probs=9.8

Q ss_pred             CccccccccccC
Q psy16929         79 HDIDSCCRDHDL   90 (172)
Q Consensus        79 ~~tD~CCR~HD~   90 (172)
                      .+-|.|||+|-+
T Consensus        15 ~Er~eCCrAhG~   26 (39)
T PF08036_consen   15 PERDECCRAHGY   26 (39)
T ss_dssp             TTTHHHHHHTT-
T ss_pred             hhHHHHHHHcCc
Confidence            578999999986


No 13 
>KOG3784|consensus
Probab=22.73  E-value=23  Score=33.29  Aligned_cols=42  Identities=26%  Similarity=0.372  Sum_probs=32.7

Q ss_pred             HhhcccCCceeeecCCccccceeccccccccccccCcCcccceeeeccCCC
Q psy16929        118 AYFDILKPMCFRFDFPRIGCKKFFGDTEQCAEFEMDLTKAKKWQWLGIALP  168 (172)
Q Consensus       118 ~YFnvl~~~CF~~~~p~~~C~~~~~~~~~C~eY~~d~s~~k~wQ~fd~~~~  168 (172)
                      +=|.+-.++|++....-         ...|-||..+..+.|+|||+.+-+|
T Consensus       302 i~F~~trmr~Wrvte~~---------la~~FEy~~~~~~d~k~rWv~I~T~  343 (407)
T KOG3784|consen  302 IAFRWTRMRCWRVTEEG---------LAFSFEYLRDEVKDKKLRWVTIFTP  343 (407)
T ss_pred             eEEEeeeeEeeeccHHH---------HHHHHHHHHhhccccceeEEEEcCc
Confidence            34677788888875221         2469999999999999999998877


Done!