Diaphorina citri psyllid: psy16929

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--

MSSTYESSTRMRMSMYVNSDEFQENVSQSFEKLYMKERVRLTTCSTKYVTVCSMFYFTGTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDANPLAIEVGIAYFDILKPMCFRFDFPRIGCKKFFGDTEQCAEFEMDLTKAKKWQWLGIALPLGSI

cccHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccCEEEEEECcccccccEEEcccccccEEEEEccccccccc

*********RMR*****************FEKLYMKERVRLTTCSTKYVTVCSMFYFTGTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDANPLAIEVGIAYFDILKPMCFRFDFPRIGCKKFFGDTEQCAEFEMDLTKAKKWQWLGIALPLGSI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSTYESSTRMRMSMYVNSDEFQENVSQSFEKLYMKERVRLTTCSTKYVTVCSMFYFTGTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDANPLAIEVGIAYFDILKPMCFRFDFPRIGCKKFFGDTEQCAEFEMDLTKAKKWQWLGIALPLGSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0032024 [BP]	positive regulation of insulin secretion	probable	GO:0090087, GO:0051046, GO:0051047, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048518, GO:0051050, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046887, GO:0032879, GO:0002791, GO:0002793, GO:0090277, GO:0048522
GO:0004623 [MF]	phospholipase A2 activity	probable	GO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0004620, GO:0016298
GO:0003104 [BP]	positive regulation of glomerular filtration	probable	GO:0003073, GO:0003071, GO:0050878, GO:0044057, GO:0008015, GO:0051240, GO:0003093, GO:0003008, GO:0001977, GO:0032501, GO:0003014, GO:0008150, GO:0051239, GO:0008217, GO:0048518, GO:0065007, GO:0003013, GO:0065008, GO:0050789, GO:0044699, GO:0044707
GO:0009405 [BP]	pathogenesis	probable	GO:0008150, GO:0051704
GO:0035810 [BP]	positive regulation of urine volume	probable	GO:0032501, GO:0050878, GO:0044707, GO:0008150, GO:0035809, GO:0003014, GO:0065007, GO:0065008, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1POC, chain A
Confidence level:very confident
Coverage over the Query: 55-167
View the alignment between query and template
View the model in PyMOL