Query         psy16934
Match_columns 96
No_of_seqs    104 out of 191
Neff          4.6 
Searched_HMMs 46136
Date          Fri Aug 16 17:26:27 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16934.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16934hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05826 Phospholip_A2_2:  Phos 100.0   1E-37 2.2E-42  212.6  -1.3   66   18-83      1-66  (99)
  2 cd04704 PLA2_bee_venom_like PL 100.0 1.7E-36 3.7E-41  206.4   2.6   66   17-82      1-66  (97)
  3 cd04705 PLA2_group_III_like PL  99.8 6.6E-22 1.4E-26  136.0   1.6   50   34-83     25-74  (100)
  4 cd00618 PLA2_like PLA2_like: P  99.7 1.3E-17 2.7E-22  107.7   2.2   62   19-82      1-75  (83)
  5 smart00085 PA2c Phospholipase   99.1 2.8E-11   6E-16   84.4   2.4   58   15-82     16-73  (117)
  6 cd04706 PLA2_plant PLA2_plant:  98.3 2.5E-07 5.5E-12   65.4   1.4   48   21-83     24-71  (117)
  7 cd00125 PLA2c PLA2c: Phospholi  96.9 9.5E-05 2.1E-09   51.8  -1.7   31   23-59     25-55  (115)
  8 cd04707 otoconin_90 otoconin_9  96.9 0.00014   3E-09   51.3  -1.2   18   41-58     34-51  (117)
  9 PF08398 Parvo_coat_N:  Parvovi  96.3  0.0007 1.5E-08   43.6  -0.7   40   19-61      1-41  (64)
 10 KOG4087|consensus               95.8  0.0017 3.8E-08   47.5  -0.6   28   31-58     38-75  (144)
 11 PF00068 Phospholip_A2_1:  Phos  92.1   0.021 4.5E-07   39.5  -1.6   31   23-59     26-56  (116)
 12 PF08036 Antimicrobial_6:  Diap  60.6     2.2 4.9E-05   25.0  -0.4   12   41-52     15-26  (39)
 13 PF06951 PLA2G12:  Group XII se  23.2      40 0.00087   25.6   0.9   35   18-57     75-112 (184)
 14 PF04315 DUF462:  Protein of un  21.7      48   0.001   24.9   1.1   23   22-44     50-72  (164)
 15 PF05959 DUF884:  Nucleopolyhed  21.0      80  0.0017   23.9   2.1   23    1-23      1-24  (186)

No 1  
>PF05826 Phospholip_A2_2:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1POC_A.
Probab=100.00  E-value=1e-37  Score=212.60  Aligned_cols=66  Identities=42%  Similarity=0.761  Sum_probs=50.5

Q ss_pred             eecCcccccCCCCCCCCCCCCCCCccccccccCcCCCCccccCCccCccccCCCcccccccccccc
Q psy16934         18 KSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEK   83 (96)
Q Consensus        18 i~PGTkWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~~~~kygl~N~~~~TisHCdC~~ek   83 (96)
                      |+|||||||+||+|.+|+|||.+.+||+|||+||+||++|+|+++||||+|.++||+|||+|+.++
T Consensus         1 i~pGT~WCG~gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~~hC~Cd~~f   66 (99)
T PF05826_consen    1 IYPGTKWCGPGNIAKNYSDLGEFKETDRCCREHDHCPDKIPPGETKYGLHNPRPFTISHCDCDSRF   66 (99)
T ss_dssp             B-TT-SSSBSS---SSTT---SSHHHHHHHHHHHT-SSEE-TT-EETTEE--SSS-EEBHHHHHHH
T ss_pred             CCCCCcccCCCCCccCcccccccHHHHHHHHhhccCCCccCCCccccccccCCcCceeecCcccHH
Confidence            799999999999999999999999999999999999999999999999999999999999998873


No 2  
>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of  Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s.
Probab=100.00  E-value=1.7e-36  Score=206.40  Aligned_cols=66  Identities=47%  Similarity=0.827  Sum_probs=64.2

Q ss_pred             eeecCcccccCCCCCCCCCCCCCCCccccccccCcCCCCccccCCccCccccCCCccccccccccc
Q psy16934         17 FKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWE   82 (96)
Q Consensus        17 ~i~PGTkWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~~~~kygl~N~~~~TisHCdC~~e   82 (96)
                      +|+|||||||+||+|.+|+|||.+.+||+|||+||+||++|++++++||++|.++||++||+|+.+
T Consensus         1 ~~~pGTkWCG~Gn~a~~~~dlG~~~~tD~CCr~HD~C~~~i~~~~~kyg~~N~~~~t~~~C~CD~~   66 (97)
T cd04704           1 FIVPGTKWCGPGNIATNYSDLGAFRETDKCCREHDHCPDIISAGEYKYGLTNTRLFTRSHCDCDNR   66 (97)
T ss_pred             CccCCCeecCCCCCCCCcccccCccccchHHHccccCcCcccccccccCccCCCccccccCcHHHH
Confidence            589999999999999999999999999999999999999999999999999999999999999765


No 3  
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of  Phospholipase A2, similar to human group III PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers.
Probab=99.83  E-value=6.6e-22  Score=136.00  Aligned_cols=50  Identities=20%  Similarity=0.305  Sum_probs=47.7

Q ss_pred             CCCCCCCCccccccccCcCCCCccccCCccCccccCCCcccccccccccc
Q psy16934         34 ISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEK   83 (96)
Q Consensus        34 y~dLG~~~~TD~CCR~HD~Cp~~I~~~~~kygl~N~~~~TisHCdC~~ek   83 (96)
                      +.+||.+.+||+|||+||+||++|.+++++|||+|.++||+|||+|+.++
T Consensus        25 ~~~lG~~~~~DrCCR~HD~Cp~~I~~~~~k~gl~N~~~~tisHCdCD~rf   74 (100)
T cd04705          25 FLSEGEFKEPDRCCWKHKQCPGHIIPPFSSDGHHNFHLHSVSHCDCDSRL   74 (100)
T ss_pred             ccccccccchhhhhhhhhcCccccCCcccccceecCCCcccccccHHHHH
Confidence            46899999999999999999999999999999999999999999998774


No 4  
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately 
Probab=99.68  E-value=1.3e-17  Score=107.73  Aligned_cols=62  Identities=27%  Similarity=0.387  Sum_probs=57.1

Q ss_pred             ecCcccccCCCCCCCCCCCCCCCccccccccCcCCCCccccCCccCc-------------cccCCCccccccccccc
Q psy16934         19 SIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYN-------------LTNDGSFTRRLRKFYWE   82 (96)
Q Consensus        19 ~PGTkWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~~~~kyg-------------l~N~~~~TisHCdC~~e   82 (96)
                      .|+++|||+|+.+.++.+.+  .+||+|||+||+|++.|...+.+++             +.|..+++++||+||.+
T Consensus         1 ~~ygc~CG~g~~~~~~g~p~--D~~D~CC~~HD~Cy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~C~CD~~   75 (83)
T cd00618           1 LPYGCYCGPGGSACPSGQPV--DETDRCCRKHDCCYDQISDGGCCDGCLSYSFSEGGVTCLTNSDLCTRSHCDCDRR   75 (83)
T ss_pred             CCcCcccCCCCcCCCCCCCC--CcchhhhhhCccHhhhhhccCCCCCcceeeecCCceeECCCCChhhHhhCcccHH
Confidence            47899999999998888876  7999999999999999999999888             78999999999999876


No 5  
>smart00085 PA2c Phospholipase A2.
Probab=99.12  E-value=2.8e-11  Score=84.41  Aligned_cols=58  Identities=17%  Similarity=0.080  Sum_probs=47.0

Q ss_pred             eeeeecCcccccCCCCCCCCCCCCCCCccccccccCcCCCCccccCCccCccccCCCccccccccccc
Q psy16934         15 LDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWE   82 (96)
Q Consensus        15 ~~~i~PGTkWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~~~~kygl~N~~~~TisHCdC~~e   82 (96)
                      ..++.+++.||+-|+.+....    ..+||+|||+||+|++.|++ +.-++     .++++||+|+..
T Consensus        16 ~~~~~y~~YGCyCG~gg~G~p----vD~~D~CC~~HD~Cy~~~~~-~~C~~-----~~~~y~~~c~~~   73 (117)
T smart00085       16 RAWLSYGDYGCYCGWGGSGTP----VDATDRCCFVHDCCYGKAEK-EGCNP-----KTTTYSYSCDNG   73 (117)
T ss_pred             CcccchhccCcccCCCCCCCc----cccccchhhhcCchhhhccc-CCCcc-----cccceEEEEECC
Confidence            456889999999999877653    78999999999999999987 44433     678888888644


No 6  
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of  Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. This sub-family does not appear to have a conserved active site and metal-binding loop.
Probab=98.29  E-value=2.5e-07  Score=65.39  Aligned_cols=48  Identities=23%  Similarity=0.367  Sum_probs=36.1

Q ss_pred             CcccccCCCCCCCCCCCCCCCccccccccCcCCCCccccCCccCccccCCCcccccccccccc
Q psy16934         21 RTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEK   83 (96)
Q Consensus        21 GTkWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~~~~kygl~N~~~~TisHCdC~~ek   83 (96)
                      -.+|||+|+.+..  ++..-..+|+||+.||+|.+..             ...+.+|+|+.++
T Consensus        24 YG~yCG~g~~g~~--~~~P~D~lD~CC~~HD~Cy~~~-------------~~~~~~c~C~~~f   71 (117)
T cd04706          24 YGKYCGPGYSGCP--GERPCDDLDACCMTHDACVQAK-------------KNDYLSLECNEKF   71 (117)
T ss_pred             cCcccCCCCCCCC--CCCCcchhhHHHHhCcCcccCC-------------CCCcCCchHHHHH
Confidence            6799999987532  3345689999999999999754             1336788887654


No 7  
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately to a block in 
Probab=96.94  E-value=9.5e-05  Score=51.78  Aligned_cols=31  Identities=32%  Similarity=0.761  Sum_probs=22.5

Q ss_pred             ccccCCCCCCCCCCCCCCCccccccccCcCCCCcccc
Q psy16934         23 KWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVA   59 (96)
Q Consensus        23 kWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~   59 (96)
                      -|||.|..-..      -..+|+||+.||.|.+.+..
T Consensus        25 CyCG~GG~G~P------vD~~DrCC~~HD~CY~~~~~   55 (115)
T cd00125          25 CYCGLGGSGTP------VDDTDRCCQVHDCCYDRAEK   55 (115)
T ss_pred             CccCCCCCCCC------cccHHHHHHHHHhHHhcccc
Confidence            36777654322      24789999999999998753


No 8  
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia. Interactions involving otoconin-90 may trigger or constitute key events in otoconia formation. The PLA2-like domains in otoconins may have lost their metal-binding sites.
Probab=96.88  E-value=0.00014  Score=51.26  Aligned_cols=18  Identities=33%  Similarity=0.870  Sum_probs=16.0

Q ss_pred             CccccccccCcCCCCccc
Q psy16934         41 HDIDSCCRDHDLCPENIV   58 (96)
Q Consensus        41 ~~TD~CCR~HD~Cp~~I~   58 (96)
                      .++|+||..||.|.+.+.
T Consensus        34 D~~DrCC~~HD~CY~~~~   51 (117)
T cd04707          34 DELDRCCFQHRCCLEQAS   51 (117)
T ss_pred             ccchhHHHHhHHHHhhhh
Confidence            589999999999998764


No 9  
>PF08398 Parvo_coat_N:  Parvovirus coat protein VP1;  InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides. Parvoviruses have been described that infect a wide range of invertebrates and vertebrates and are well known for causing enteric disease in mammals. Genomes contains two large ORFs: NS1 and VP1; other ORFs are found in some sub-types and different gene products can arise from splice variants and the use of different start codons [].  This is the N-terminal region of the Parvovirus VP1 coat protein []; its function is not known. ; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=96.31  E-value=0.0007  Score=43.64  Aligned_cols=40  Identities=18%  Similarity=0.263  Sum_probs=31.4

Q ss_pred             ecCcccccCCCCCCCCCCCCCCCccccccccCcCCCCc-cccCC
Q psy16934         19 SIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPEN-IVAKS   61 (96)
Q Consensus        19 ~PGTkWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~-I~~~~   61 (96)
                      +||.+++||||.-.+-.   --.++|..+|+||...+. |..+.
T Consensus         1 lPg~~YlGPgn~l~~g~---Pv~~~D~aA~~HD~aY~~~lk~G~   41 (64)
T PF08398_consen    1 LPGYKYLGPGNPLDNGE---PVNPVDAAAREHDEAYDELLKHGD   41 (64)
T ss_pred             CCCCCccCCCCCcCCCC---CCCHHHHHHHHHHHHHHHHHHcCC
Confidence            59999999999854443   346899999999988877 55553


No 10 
>KOG4087|consensus
Probab=95.85  E-value=0.0017  Score=47.54  Aligned_cols=28  Identities=32%  Similarity=0.719  Sum_probs=22.7

Q ss_pred             CCCCCCCCCC----------CccccccccCcCCCCccc
Q psy16934         31 ARDISDTGIF----------HDIDSCCRDHDLCPENIV   58 (96)
Q Consensus        31 A~~y~dLG~~----------~~TD~CCR~HD~Cp~~I~   58 (96)
                      |.+|+.+|.+          .++|+||.+||.|.+...
T Consensus        38 ~l~Y~~YGCyCGlGG~G~P~D~iDwCC~~HDcCY~~le   75 (144)
T KOG4087|consen   38 ALSYNKYGCYCGLGGSGQPKDAIDWCCHAHDCCYDRLE   75 (144)
T ss_pred             cceecCccccccCCCCCCccchHHHHHhcccHHHHHHH
Confidence            6667776665          789999999999998765


No 11 
>PF00068 Phospholip_A2_1:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1OQS_F 1S6B_B 1XXW_B 1MH2_B 2RD4_B 1OZ6_A 2OSN_A 2PH4_B 1FDK_A 2BP2_A ....
Probab=92.07  E-value=0.021  Score=39.52  Aligned_cols=31  Identities=35%  Similarity=0.812  Sum_probs=22.5

Q ss_pred             ccccCCCCCCCCCCCCCCCccccccccCcCCCCcccc
Q psy16934         23 KWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVA   59 (96)
Q Consensus        23 kWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~   59 (96)
                      -|||.|....      .-.++|+|||.|+.|..-+..
T Consensus        26 CyCg~~g~G~------PvD~iD~~C~~h~~Cy~~~~~   56 (116)
T PF00068_consen   26 CYCGFGGKGQ------PVDEIDRCCRKHDQCYKCAKE   56 (116)
T ss_dssp             TTBSSSSSSS-------SSHHHHHHHHHHHHHHHHTT
T ss_pred             ccCCCCCCCC------CcccccchhHHhHHHHHHHhc
Confidence            4888765321      246799999999999877655


No 12 
>PF08036 Antimicrobial_6:  Diapausin family of antimicrobial peptide;  InterPro: IPR012525 This family consists of diapausin-related antimicrobial peptides. Diapause during periods of environmental adversity is an essential part of the life cycle of many organisms with the molecular basis being different among animals. Diapause-specific peptides provide anti-fungal activity and act as N-type voltage-gated calcium channel blocker [].; GO: 0050832 defense response to fungus, 0005576 extracellular region; PDB: 2E2F_A.
Probab=60.56  E-value=2.2  Score=25.04  Aligned_cols=12  Identities=42%  Similarity=1.043  Sum_probs=9.7

Q ss_pred             CccccccccCcC
Q psy16934         41 HDIDSCCRDHDL   52 (96)
Q Consensus        41 ~~TD~CCR~HD~   52 (96)
                      .+-|.|||+|-+
T Consensus        15 ~Er~eCCrAhG~   26 (39)
T PF08036_consen   15 PERDECCRAHGY   26 (39)
T ss_dssp             TTTHHHHHHTT-
T ss_pred             hhHHHHHHHcCc
Confidence            578999999975


No 13 
>PF06951 PLA2G12:  Group XII secretory phospholipase A2 precursor (PLA2G12);  InterPro: IPR010711 This family consists of several group XII secretory phospholipase A2 precursor (PLA2G12) (3.1.1.4 from EC) proteins. Group XII and group V PLA(2)s are thought to participate in helper T cell immune response through release of immediate second signals and generation of downstream eicosanoids [].; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process, 0005576 extracellular region
Probab=23.16  E-value=40  Score=25.57  Aligned_cols=35  Identities=31%  Similarity=0.727  Sum_probs=22.8

Q ss_pred             eecCcccccC---CCCCCCCCCCCCCCccccccccCcCCCCcc
Q psy16934         18 KSIRTKWCGT---GDIARDISDTGIFHDIDSCCRDHDLCPENI   57 (96)
Q Consensus        18 i~PGTkWCG~---Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I   57 (96)
                      ..|=-+-||+   |..   ++. | ....-.||-+||.|.++=
T Consensus        75 k~p~~NGCGS~~~G~~---~d~-~-iP~~t~CCn~HDiCYdTC  112 (184)
T PF06951_consen   75 KPPEPNGCGSYFLGLQ---IDI-G-IPAMTKCCNQHDICYDTC  112 (184)
T ss_pred             CCCCCCCCCCcccCCc---ccC-C-CCchhccchhhhhHHHcc
Confidence            3455667887   333   222 2 223778999999999874


No 14 
>PF04315 DUF462:  Protein of unknown function, DUF462;  InterPro: IPR007411 This family consists of bacterial proteins of uncharacterised function.
Probab=21.72  E-value=48  Score=24.88  Aligned_cols=23  Identities=30%  Similarity=0.622  Sum_probs=20.1

Q ss_pred             cccccCCCCCCCCCCCCCCCccc
Q psy16934         22 TKWCGTGDIARDISDTGIFHDID   44 (96)
Q Consensus        22 TkWCG~Gn~A~~y~dLG~~~~TD   44 (96)
                      .-||-+|..-..-.|+|.+-..|
T Consensus        50 aHWciAG~~RR~l~DfGYWY~PD   72 (164)
T PF04315_consen   50 AHWCIAGPERRQLEDFGYWYCPD   72 (164)
T ss_pred             HHHHhccccccccccCCCCcCCC
Confidence            57999999988899999997766


No 15 
>PF05959 DUF884:  Nucleopolyhedrovirus protein of unknown function (DUF884);  InterPro: IPR009235 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf146; it is a family of uncharacterised viral proteins.
Probab=21.00  E-value=80  Score=23.94  Aligned_cols=23  Identities=22%  Similarity=0.390  Sum_probs=20.5

Q ss_pred             CceeeEEeCcc-ceeeeeeecCcc
Q psy16934          1 MSLQLYQVGYK-NYLLDFKSIRTK   23 (96)
Q Consensus         1 ~~~~~~q~~~~-~~l~~~i~PGTk   23 (96)
                      |..+|||-... +.++.|.+|.|.
T Consensus         1 MnvnLy~p~~~~~~~ItF~i~~t~   24 (186)
T PF05959_consen    1 MNVNLYYPNSNDDNIITFQIPHTI   24 (186)
T ss_pred             CeEEEecCCCCCCceEEEEEcCCC
Confidence            78999999988 899999999775


Done!