Diaphorina citri psyllid: psy16940


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
AVDVTEIYDKFPERTGGLKELYDRGPQDAFFLVKFWADLNSSSIQDEAGAFYGVNSHIGLIYHSSINKAVDVTEIYDKFPERTGGLKELYDRGPQDAFFLVKFWADLNSSSIQDEAGAFYGVNSQYESSDSMTITCSTKVCSFGKQVVEKVETEYPRFENGRYVYRMHRSPMCEYMVNFILKLKRLPEKYMMNSVLENFSILQVVTNRDTQETLLCTAYMFAVSTSEHGAQHHIYKLVKP
ccHHHHHHHcccccccccHHHHHccccccEEEEEHHHHcccccccccccCEEEEECccccccccccccEEEEcHHccccccccccHHHHHHccccccEEEEEEEEEcccccccccccccccccccccccccEEEEEEEEEEEEcEEEEEEEEcccccccccCEEEEEcccccHHHHHHHHHHHHcccHHHHHHHHHccccEEEEEEcccccEEEEEEEEEEEECccccccccEEEEEccc
AVDVTEIYDKFPERTGGLKELYDRGPQDAFFLVKFWADLNSSSIQDEAGAFYGVNSHIGLIYHSSINKAVDVTEIYDKFPERTGGLKELYDRGPQDAFFLVKFWADLNSSSIQDEAGAFYGVNSQYESSDSMTITCSTKVCSFGKQVVEKVETEYPRFENGRYVYRMHRSPMCEYMVNFILKLKRLPEKYMMNSVLENFSILQVVTNRDTQETLLCTAYMFAVSTSEHGAQHHIYKLVKP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AVDVTEIYDKFPERTGGLKELYDRGPQDAFFLVKFWADLNSSSIQDEAGAFYGVNSHIGLIYHSSINKAVDVTEIYDKFPERTGGLKELYDRGPQDAFFLVKFWADLNSSSIQDEAGAFYGVNSQYESSDSMTITCSTKVCSFGKQVVEKVETEYPRFENGRYVYRMHRSPMCEYMVNFILKLKRLPEKYMMNSVLENFSILQVVTNRDTQETLLCTAYMFAVSTSEHGAQHHIYKLVKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcriptional enhancer factor TEF-5 Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ.confidentQ90701
Transcriptional enhancer factor TEF-1 Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and cooperatively to the SPH and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription in vivo in a cell-specific manner. The activation function appears to be mediated by a limiting cell-specific transcriptional intermediary factor (TIF). Involved in cardiac development. Binds to the M-CAT motif.confidentP28347
Protein scalloped Transcription factor which plays a key role in the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein Hippo (Hpo), in complex with its regulatory protein Salvador (Sav), phosphorylates and activates Warts (Wts) in complex with its regulatory protein Mats, which in turn phosphorylates and inactivates the Yorkie (Yki) oncoprotein. The Hippo/SWH signaling pathway inhibits the activity of the transcriptional complex formed by Scalloped (sd) and Yki and the target genes of this pathway include cyclin-E (cycE), diap1 and bantam. Sd promotes nuclear localization of Yki. Involved in the regulation of cell-specific gene expression during development, particularly in the differentiation of the nervous system. When in combination with vestigial (vg) it acts as a transcriptional activation complex that regulates gene expression in the wing. Binding to vg switches the DNA target selectivity of sd. Required autonomously for cell proliferation and viability within the wing blade. Required for proper sensory organ precursor (SOP) differentiation at the wing margin; required for correct expression of sens.confidentP30052

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003677 [MF]DNA bindingconfidentGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0035329 [BP]hippo signaling cascadeconfidentGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityconfidentGO:0003674, GO:0001071
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0030903 [BP]notochord developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048568, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0003143 [BP]embryonic heart tube morphogenesisprobableGO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048513, GO:0048729, GO:0060562, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0008150, GO:0035295, GO:0007507, GO:0044707, GO:0048856, GO:0044767, GO:0048731
GO:0048368 [BP]lateral mesoderm developmentprobableGO:0007498, GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0048339 [BP]paraxial mesoderm developmentprobableGO:0007498, GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0001501 [BP]skeletal system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0060548 [BP]negative regulation of cell deathprobableGO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010941, GO:0050789, GO:0048523
GO:0001843 [BP]neural tube closureprobableGO:0032502, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009792, GO:0021915, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0001841, GO:0060562, GO:0043009, GO:0048646, GO:0048598, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0060606, GO:0008150, GO:0035295, GO:0001838, GO:0014020, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048731
GO:0072089 [BP]stem cell proliferationprobableGO:0008150, GO:0044699, GO:0008283
GO:0001570 [BP]vasculogenesisprobableGO:0032502, GO:0032501, GO:0048856, GO:0044707, GO:0008150, GO:0048869, GO:0001568, GO:0030154, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0044699, GO:0048731, GO:0044763, GO:0009987, GO:0009653, GO:0007275, GO:0048646
GO:0001708 [BP]cell fate specificationprobableGO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0007566 [BP]embryo implantationprobableGO:0032502, GO:0044703, GO:0044702, GO:0000003, GO:0044707, GO:0044706, GO:0007565, GO:0022414, GO:0032501, GO:0008150, GO:0007275, GO:0044699, GO:0051704
GO:0000980 [MF]RNA polymerase II distal enhancer sequence-specific DNA bindingprobableGO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0001830 [BP]trophectodermal cell fate commitmentprobableGO:0030154, GO:0009790, GO:0009792, GO:0009653, GO:0007275, GO:0044699, GO:0001701, GO:0001829, GO:0048869, GO:0001825, GO:0001824, GO:0043009, GO:0048646, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0044763, GO:0045165, GO:0044707, GO:0048856, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L15, chain A
Confidence level:very confident
Coverage over the Query: 27-239
View the alignment between query and template
View the model in PyMOL
Template: 3L15, chain A
Confidence level:very confident
Coverage over the Query: 1-135,146-170
View the alignment between query and template
View the model in PyMOL