Diaphorina citri psyllid: psy16970


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MRIASGASMNDRFIVSQVLRNCFATALEVRQELQDVRKVHLNEGTVRIRLNENNLTAKRLHRAPELSIRNQRARSRKVENVVLKPVLGQIYIYIYHMHWTPAQQANVLFSDEPRVNFGDVRIPKGFDFPRPQKIGQLAGVHGVSSDPIVIVDAQTLLVPNFSYDGEAPDAKFWVGTGPHPSPQGIRVPDENGKEEPLRRYNRKTIVLTLPGELTVFEIGHFGVWCEAFTVDFGHIQIPANVNMPPSLKMLGVSPQYL
ccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHccEEcHHHHHHHccccccccccccccccccccccccccccccEEEEcccccEEEEEEEcccccccccCEEEEccccccccCEEECcccccccccCEccccccccccCCccEEEEEccEEEEccCEEccccccEEEEECcccccccccEECccccccccccccccccEEEEEccccccEEEEcEEEEEEccccccCEEEEccccccccccccccccccccc
***********RFIVSQVLRNCFATALEVRQELQDVRKVHLNEGTVRIRLNENNLTA******************RKVENVVLKPVLGQIYIYIYHMHWTPAQQANVLFSDEPRVNFGDVRIPKGFDFPRPQKIGQLAGVHGVSSDPIVIVDAQTLLVPNFSYDGEAPDAKFWVGTGPHPS****************RRYNRKTIVLTLPGELTVFEIGHFGVWCEAFTVDFGHIQIPANVNMPPSLKM********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIASGASMNDRFIVSQVLRNCFATALEVRQELQDVRKVHLNEGTVRIRLNENNLTAKRLHRAPELSIRNQRARSRKVENVVLKPVLGQIYIYIYHMHWTPAQQANVLFSDEPRVNFGDVRIPKGFDFPRPQKIGQLAGVHGVSSDPIVIVDAQTLLVPNFSYDGEAPDAKFWVGTGPHPSPQGIRVPDENGKEEPLRRYNRKTIVLTLPGELTVFEIGHFGVWCEAFTVDFGHIQIPANVNMPPSLKMLGVSPQYL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005198 [MF]structural molecule activityprobableGO:0003674
GO:0016363 [CC]nuclear matrixprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0005652 [CC]nuclear laminaprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051225 [BP]spindle assemblyprobableGO:0006996, GO:0022607, GO:0007010, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0044763, GO:0016043, GO:0065003, GO:0007051, GO:0044085, GO:0000226, GO:0044699, GO:0008150, GO:0022402, GO:0009987, GO:0070925, GO:0007049, GO:0007017
GO:0006584 [BP]catecholamine metabolic processprobableGO:0009987, GO:1901564, GO:0009712, GO:0006725, GO:0044237, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0018958, GO:1901360, GO:1901615
GO:0004500 [MF]dopamine beta-monooxygenase activityprobableGO:0004497, GO:0016715, GO:0016705, GO:0003824, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HOT, chain A
Confidence level:confident
Coverage over the Query: 27-76,92-130
View the alignment between query and template
View the model in PyMOL
Template: 3F2K, chain A
Confidence level:probable
Coverage over the Query: 64-76,92-119,141-168
View the alignment between query and template
View the model in PyMOL