Query         psy16971
Match_columns 383
No_of_seqs    171 out of 242
Neff          4.7 
Searched_HMMs 46136
Date          Fri Aug 16 18:24:24 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16971.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16971hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4731|consensus              100.0 2.9E-30 6.2E-35  260.8  12.6  288    5-354   210-511 (512)
  2 smart00664 DoH Possible catech  99.8 2.7E-20 5.9E-25  162.0  14.5  118    4-137    27-145 (148)
  3 PF03351 DOMON:  DOMON domain;   99.8 4.3E-19 9.2E-24  149.2  12.8   95    4-112    29-124 (124)
  4 KOG3568|consensus               99.5 3.5E-14 7.5E-19  145.5   6.3  113    3-133    66-179 (603)
  5 KOG4731|consensus               98.1 3.5E-06 7.6E-11   87.1   6.1  103  216-331   305-407 (512)
  6 cd00241 CDH_cytochrome Cellobi  96.8   0.021 4.6E-07   53.4  12.1  115    3-138    51-174 (184)
  7 PF09459 EB_dh:  Ethylbenzene d  88.8    0.65 1.4E-05   45.3   4.9   40   73-112   208-249 (261)
  8 TIGR03477 DMSO_red_II_gam DMSO  78.6     4.2   9E-05   38.9   5.4   40   73-112   144-183 (205)
  9 TIGR02656 cyanin_plasto plasto  65.6      33 0.00072   28.3   7.3   43  218-285     1-43  (99)
 10 PF04526 DUF568:  Protein of un  65.0      89  0.0019   26.7  10.6   88   20-126     1-89  (101)
 11 cd04972 Ig_TrkABC_d4 Fourth do  57.6      20 0.00044   28.3   4.5   19  234-252    24-42  (90)
 12 COG2025 FixB Electron transfer  51.1     7.6 0.00016   39.4   1.2   30    2-31    251-281 (313)
 13 cd05855 Ig_TrkB_d5 Fifth domai  50.3      11 0.00024   30.3   1.8   20  234-253     7-26  (79)
 14 cd05863 Ig2_VEGFR-3 Second imm  48.9      15 0.00032   28.5   2.3   19  234-252     7-25  (67)
 15 PF07679 I-set:  Immunoglobulin  48.7      20 0.00043   27.6   3.1   39  234-285    24-62  (90)
 16 TIGR03154 sulfolob_CbsA cytoch  48.5      63  0.0014   33.8   7.2   82   29-116   301-396 (465)
 17 PRK03363 fixB putative electro  47.2     8.2 0.00018   39.1   0.8   29    2-30    252-281 (313)
 18 cd05864 Ig2_VEGFR-2 Second imm  46.6      23 0.00049   27.4   3.0   20  234-253     7-26  (70)
 19 cd05867 Ig4_L1-CAM_like Fourth  45.2      15 0.00033   28.0   1.9   20  234-253    10-29  (76)
 20 PLN00022 electron transfer fla  45.0      10 0.00022   39.1   1.1   29    2-30    293-322 (356)
 21 PF00394 Cu-oxidase:  Multicopp  41.9      34 0.00074   30.3   3.9   54  249-310    57-118 (159)
 22 PRK11916 electron transfer fla  41.4      12 0.00026   37.9   0.9   29    2-30    251-280 (312)
 23 cd04978 Ig4_L1-NrCAM_like Four  38.8      24 0.00052   26.4   2.1   18  235-252    11-28  (76)
 24 cd04971 Ig_TrKABC_d5 Fifth dom  38.8      21 0.00047   28.2   1.9   19  234-252     7-25  (81)
 25 PF00127 Copper-bind:  Copper b  38.7 1.2E+02  0.0026   24.8   6.4   27  252-285    17-43  (99)
 26 cd05737 Ig_Myomesin_like_C C-t  38.5      54  0.0012   26.0   4.2   18  234-251    25-42  (92)
 27 PF02550 AcetylCoA_hydro:  Acet  37.5     5.9 0.00013   36.8  -1.8   37    1-39    135-171 (198)
 28 TIGR03095 rusti_cyanin rusticy  36.3      60  0.0013   29.2   4.5   39  243-285    43-81  (148)
 29 PRK10883 FtsI repressor; Provi  35.0      42 0.00091   35.6   3.8   47  243-291   211-261 (471)
 30 cd05868 Ig4_NrCAM Fourth immun  34.4      61  0.0013   24.9   3.8   19  234-252    10-28  (76)
 31 TIGR03389 laccase laccase, pla  33.9      73  0.0016   34.2   5.5   65  243-310   168-245 (539)
 32 cd05760 Ig2_PTK7 Second immuno  33.7      31 0.00067   26.6   2.0   17  235-251     8-24  (77)
 33 TIGR02376 Cu_nitrite_red nitri  33.6 2.3E+02  0.0049   28.4   8.6   38  243-283    49-87  (311)
 34 PF00868 Transglut_N:  Transglu  33.3      37 0.00081   29.3   2.6   21  250-270    23-43  (118)
 35 cd07693 Ig1_Robo First immunog  33.2      94   0.002   23.9   4.7   19  235-253    26-44  (100)
 36 cd05744 Ig_Myotilin_C_like Imm  33.1      33 0.00072   26.4   2.1   19  234-252     7-25  (75)
 37 cd05748 Ig_Titin_like Immunogl  30.8      37 0.00079   25.5   1.9   18  234-251     8-25  (74)
 38 PLN02835 oxidoreductase         29.8      61  0.0013   35.1   4.1   29  243-271   193-222 (539)
 39 cd05745 Ig3_Peroxidasin Third   29.3      40 0.00087   25.5   2.0   18  235-252    12-29  (74)
 40 cd04976 Ig2_VEGFR Second immun  28.9      55  0.0012   24.9   2.7   20  234-253     7-26  (71)
 41 PRK02710 plastocyanin; Provisi  28.5      90   0.002   26.7   4.2   38  216-272    29-66  (119)
 42 cd05892 Ig_Myotilin_C C-termin  28.5      41 0.00089   26.3   1.9   19  234-252     7-25  (75)
 43 cd05739 Ig3_RPTP_IIa_LAR_like   28.2      76  0.0016   24.1   3.3   19  235-253    11-29  (69)
 44 PLN02168 copper ion binding /   28.0      82  0.0018   34.2   4.7   50  243-293   190-244 (545)
 45 cd02856 Glycogen_debranching_e  27.7      80  0.0017   26.0   3.6   40  243-287    46-85  (103)
 46 PLN02991 oxidoreductase         27.5      64  0.0014   35.1   3.7   48  243-291   192-243 (543)
 47 cd05885 Ig2_Necl-4 Second immu  27.5 1.2E+02  0.0026   24.5   4.5   19  236-254    11-29  (80)
 48 cd05848 Ig1_Contactin-5 First   26.7      79  0.0017   25.4   3.3   18  235-252    29-46  (94)
 49 cd05743 Ig_Perlecan_D2_like Im  26.7      43 0.00094   25.7   1.7   19  235-253    11-29  (78)
 50 cd05895 Ig_Pro_neuregulin-1 Im  26.0      54  0.0012   24.8   2.1   17  236-252    10-26  (76)
 51 PF07711 RabGGT_insert:  Rab ge  25.0      53  0.0011   28.4   2.0   41   69-109     3-43  (102)
 52 cd05728 Ig4_Contactin-2-like F  24.4      53  0.0011   25.7   1.9   18  235-252    24-41  (85)
 53 cd05893 Ig_Palladin_C C-termin  24.3      51  0.0011   25.6   1.7   19  234-252     7-25  (75)
 54 PRK10965 multicopper oxidase;   23.8      77  0.0017   34.2   3.5   49  241-291   212-264 (523)
 55 cd05850 Ig1_Contactin-2 First   23.8      63  0.0014   25.9   2.2   18  235-252    29-46  (94)
 56 cd02178 GH16_beta_agarase Beta  23.5   1E+02  0.0022   29.7   3.9   11  241-251   193-203 (258)
 57 smart00408 IGc2 Immunoglobulin  22.8 1.4E+02  0.0031   20.0   3.7   16  237-252    14-29  (63)
 58 PRK10965 multicopper oxidase;   22.7      77  0.0017   34.2   3.2   39  242-284   412-454 (523)
 59 smart00758 PA14 domain in bact  22.6 1.8E+02  0.0039   24.5   5.0   15  254-268    96-110 (136)
 60 KOG3954|consensus               22.1      61  0.0013   32.8   2.2   44    2-45    274-319 (336)
 61 cd05859 Ig4_PDGFR-alpha Fourth  22.1      57  0.0012   27.0   1.7   19  235-253    28-46  (101)
 62 cd07702 Ig2_VEGFR-1 Second imm  21.9      64  0.0014   25.3   1.9   20  234-253     7-26  (72)
 63 PF12000 Glyco_trans_4_3:  Gkyc  21.7      36 0.00079   31.6   0.5   36  234-270    70-105 (171)
 64 cd05763 Ig_1 Subgroup of the i  21.6      74  0.0016   24.0   2.1   17  234-250     7-23  (75)
 65 cd05773 Ig8_hNephrin_like Eigh  20.9      80  0.0017   26.2   2.4   18  235-252    33-50  (109)
 66 cd05736 Ig2_Follistatin_like S  20.6      76  0.0016   23.9   2.0   18  234-251     7-24  (76)
 67 cd05875 Ig6_hNeurofascin_like   20.5 1.9E+02  0.0041   22.3   4.3   18  234-251     7-24  (77)
 68 cd05729 Ig2_FGFR_like Second i  20.3 2.5E+02  0.0054   20.8   4.8   17  236-252    20-36  (85)
 69 PF12480 DUF3699:  Protein of u  20.2      87  0.0019   25.5   2.3   29  346-374    26-54  (77)

No 1  
>KOG4731|consensus
Probab=99.97  E-value=2.9e-30  Score=260.81  Aligned_cols=288  Identities=14%  Similarity=0.069  Sum_probs=225.4

Q ss_pred             cEEEEeecCC-CCCCCCccccEEEEEEeCCCCceEEEEeeeeCCCccc----CCCCCCCCccccC------CccceEEEe
Q psy16971          5 EYMSFGLSGD-PLRNQMIGADVVVAWIDQETLNGYAVDYYLTDKSQCA----GGRGSCPDYRIQD------NTESVRLLN   73 (383)
Q Consensus         5 ~YmAFG~S~~-~~~~~M~GADVVVa~vD~~~G~~~a~Dyyit~~s~C~----~~~GvcPDt~~gd------gtnDi~Lvs   73 (383)
                      .+|||++... ...-.|.+++.||..++.+ +. ++.+-||+-+..|.    +.-++|+|+.+..      ..+.. .++
T Consensus       210 ai~~~~~~~~~~~sl~~~n~k~Ivl~Lped-~t-IfDI~wIsV~c~ky~~dfGhv~v~~d~n~e~~~~~v~si~~s-k~~  286 (512)
T KOG4731|consen  210 AIMAFDDEKGYETSLRMYNAKDIVLELPED-GT-IFDIDWISVYCVKYVVDFGHVLVPPDLNVEPSPPYVPSINNS-KVN  286 (512)
T ss_pred             eeecccccccCCchhHhhccceEEEECCCC-Cc-EEeeceEEEEEEEEeeccceeecCCccccCcCCCccCccccc-ccc
Confidence            5899999644 3567899999999999764 55 88889999987775    3567899877642      12333 388


Q ss_pred             eEEECCEEEEEEEccCCCCCCCCccccCCCcEEEEEeeCCCCCcccccccccccCcceEEEeCCC-CCCCCCCCCCCCCC
Q psy16971         74 AALVNGYSIVTYQRPLRSHDILDHDIYTNQSQAIIWAIGPLNSKQEVSFHSVFPKKNILFNFGRT-PYWNCPIPEGETGT  152 (383)
Q Consensus        74 g~r~nGvT~V~FrRpL~T~D~~D~~I~~~~t~~VIWA~G~ln~~~e~s~H~~~~~g~~~I~fg~~-~~~~C~~~~~~~~~  152 (383)
                      ++|..++..+    +|+-.-+.|..+.....+.+||++|-        +|..+...++.+.+... +...|....++.. 
T Consensus       287 ~~qi~~~~~v----~l~d~~~r~n~v~~~~~~~~i~nl~~--------~~~~~~~~~v~~~~~~~e~~~~~~~n~~~~~-  353 (512)
T KOG4731|consen  287 GSQIDGVSQV----PLNDDNKRDNPVNSTESLTVIWNLGV--------IKPPPYYLPVNHGGVESENFGHFSLNLSDHV-  353 (512)
T ss_pred             cccccchhee----eccCcccccccceecCCceeeeccCc--------ccCCCcccccccCCceecccceeEEEccccc-
Confidence            9999998877    66653345666655677788888763        34333334444433332 2334422111100 


Q ss_pred             CCCCCCCCCCcCcccchheecceeEEeeecccCCCCCCCCCCCCCCCCCCCCCCCcccCCCCCceeEEEeCCCCccCCCC
Q psy16971        153 PNHGEYSDESSGANTKVQEVLGYWVIVSVAVEPARSKSPPTPAPAPRDEAWEIPPIQCNEPDDGVLYAQMGPTGGKRGYP  232 (383)
Q Consensus       153 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~t~~p~~~~~~w~~~~i~~~~~~~~~f~a~~gp~gg~rgy~  232 (383)
                                                     +.             -..+|+++-+.  +-+++.|-|.++|.++.|+|.
T Consensus       354 -------------------------------~~-------------~~p~l~~~~~~--d~dv~~~~a~l~~~~~~r~~~  387 (512)
T KOG4731|consen  354 -------------------------------DE-------------CLPPLDADNKY--DQDVIIADAHLPLVVTARPSV  387 (512)
T ss_pred             -------------------------------cc-------------cCCcccccccc--CcceeeeccccCccccccccc
Confidence                                           00             12347777654  445789999999999999999


Q ss_pred             CccCCCCccEEEEEcCeecceEEEEeCCeEEEEEEcCCCCCCCCCcCCeEEecCCCCCccCCChhhhcceEEEeCcccCC
Q psy16971        233 AITGHVGWGISWYINGLLIPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITDDSVGGYQHKTPEEKEKVRIFAGAKRDK  312 (383)
Q Consensus       233 ~iTg~~~~g~awyiN~~l~Pel~v~RG~tYtF~VegG~dp~~~~~yHP~yItd~~~GG~~~~~~~~~~~~~v~aG~~~~~  312 (383)
                      ..+|+++.+.+||||++++|+|+|+||+||+|.|+||+|+|++++||++-|++++.++++++.+.-|+.++|++++++.+
T Consensus       388 h~pn~~~s~~~~yin~~~~p~l~~~rg~ty~f~~~~g~dvhs~~~~~~l~~~~~l~~~~~~~~~~gq~~~~Vl~~pe~~~  467 (512)
T KOG4731|consen  388 HYPNPPNSSKVLYINKKEAPVLKVERGVTYKFSIEAGHDVHSYITSDFLGGNASLRNRTETIYAGGQETHGVLSSPEELV  467 (512)
T ss_pred             cCCCCCCCCcceeeeeccChhhhhccCCcEEEeccCCCCcccccccCcccCccccccCccccccCCcceEEEecChHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccccccccccccC--CCCCCCCCCcccchhhhccceeeeec
Q psy16971        313 FGNVVPTGVGRLCNWT--PDPEQPPADEFVSFGAYQRTLSLICD  354 (383)
Q Consensus       313 ~g~~~pt~~gr~c~w~--~~~~~~~~d~~~sF~~y~rtL~l~C~  354 (383)
                      ++.++||+.+.||.-.  .+..++..+.+.||.++.+.++-.|+
T Consensus       468 ~~~~~pt~~~~~~~s~~~~~~~~kv~~~~~tl~~~~~~~vt~~~  511 (512)
T KOG4731|consen  468 WAPNRPTPDQLYYHSIFQEKMGWKVQVVDGTLSDMYNNSVTLDD  511 (512)
T ss_pred             cCCCCCCcccchhhhhhhhhhCceeccccchHHHHHhhheeeec
Confidence            9999999999999744  55667778899999999999999886


No 2  
>smart00664 DoH Possible catecholamine-binding domain present in a variety of eukaryotic proteins. A predominantly beta-sheet domain present as a regulatory N-terminal domain in dopamine beta-hydroxylase, mono-oxygenase X and SDR2. Its function remains unknown at present (Ponting, Human Molecular Genetics, in press).
Probab=99.84  E-value=2.7e-20  Score=162.03  Aligned_cols=118  Identities=30%  Similarity=0.476  Sum_probs=100.1

Q ss_pred             CcEEEEeecCCCCCCCCccccEEEEEEeCCCCceEEEEeeeeCCCcccCCCCCCCCccccCCccceEEE-eeEEECCEEE
Q psy16971          4 GEYMSFGLSGDPLRNQMIGADVVVAWIDQETLNGYAVDYYLTDKSQCAGGRGSCPDYRIQDNTESVRLL-NAALVNGYSI   82 (383)
Q Consensus         4 ~~YmAFG~S~~~~~~~M~GADVVVa~vD~~~G~~~a~Dyyit~~s~C~~~~GvcPDt~~gdgtnDi~Lv-sg~r~nGvT~   82 (383)
                      ++|||||||.+   .+|.++|+||+|++++ |++++.|||+++++.|      -+|+     ++|+.+. ++.+++|+++
T Consensus        27 ~gwvaiGfs~~---~~M~~~d~vv~~~~~~-g~~~v~d~~~~~~~~~------~~d~-----~~~~~~~~~~~~~~g~~~   91 (148)
T smart00664       27 NGWVAIGFSPD---GQMAGADVVVAWVDNN-GRVTVKDYYTPGYGPP------VEDD-----QQDVTDLLSATYENGVLT   91 (148)
T ss_pred             CCEEEEEECCC---CCcCCCCEEEEEEcCC-CCEEEEEEEcCCCCCC------CcCc-----ccccccceeEEEECCEEE
Confidence            89999999986   6999999999999875 8999999999999764      1453     3444433 9999999999


Q ss_pred             EEEEccCCCCCCCCccccCCCcEEEEEeeCCCCCcccccccccccCcceEEEeCC
Q psy16971         83 VTYQRPLRSHDILDHDIYTNQSQAIIWAIGPLNSKQEVSFHSVFPKKNILFNFGR  137 (383)
Q Consensus        83 V~FrRpL~T~D~~D~~I~~~~t~~VIWA~G~ln~~~e~s~H~~~~~g~~~I~fg~  137 (383)
                      ++|+|+|.++|+.|..+. ++++++|||+|++...+++.+|....++...|+|.+
T Consensus        92 ~~f~R~l~t~d~~d~~~~-~~~~~~i~a~G~~~~~~~~~~H~~~~~~~~~i~~~~  145 (148)
T smart00664       92 CRFRRKLGSNDPDDKSLL-DGTVHVLWAKGPLSPNGGLGYHDFSLKSTKKVCLSS  145 (148)
T ss_pred             EEEEEEccCCCccccccC-CCeEEEEEEECCCCCCCCeeeccccccCceEEEecc
Confidence            999999999999998775 789999999998666677899998767778888865


No 3  
>PF03351 DOMON:  DOMON domain;  InterPro: IPR005018 The DOMON domain is an 110-125 residue long domain which has been identified in the physiologically important enzyme dopamine beta-monooxygenase and in several other secreted and transmembrane proteins from both plants and animals. It has been named after DOpamine beta-MOnooxygenase N-terminal domain. The DOMON domain can be found in one to four copies and in association with other domains, such as the Cu-ascorbate dependent monooxygenase domain, the epidermal growth factor domain, the trypsin inhibitor-like domain (TIL), the SEA domain and the Reelin domain. The architectures of the DOMON domain proteins strongly suggest a function in extracellular adhesion [].  The sequence conservation is predominantly centred around patches of hydrophobic residues. The secondary structure prediction of the DOMON domain points to an all-beta-strand fold with seven or eight core strands supported by a buried core of conserved hydrophobic residues. There is a chraracteristic motif with two small positions (Gly or Ser) corresponding to a conserved turn immediately C-terminal to strand three. It has been proposed that the DOMON domain might form a beta-sandwich structure, with the strands distributed into two beta sheets as is seen in many extracellular adhesion domains such as the immunoglobulin, fibronectin type III, cadherin and PKD domains [].
Probab=99.80  E-value=4.3e-19  Score=149.25  Aligned_cols=95  Identities=33%  Similarity=0.614  Sum_probs=85.1

Q ss_pred             CcEEEEeecCCCCCCCCccccEEEEEEeCCCCceEEEEee-eeCCCcccCCCCCCCCccccCCccceEEEeeEEECCEEE
Q psy16971          4 GEYMSFGLSGDPLRNQMIGADVVVAWIDQETLNGYAVDYY-LTDKSQCAGGRGSCPDYRIQDNTESVRLLNAALVNGYSI   82 (383)
Q Consensus         4 ~~YmAFG~S~~~~~~~M~GADVVVa~vD~~~G~~~a~Dyy-it~~s~C~~~~GvcPDt~~gdgtnDi~Lvsg~r~nGvT~   82 (383)
                      .+|||||||..   ..|.++||||+|+++  |++++.|+| +.+++      .++.|+.   +++++.++++.+++|.++
T Consensus        29 ~~w~aiGfs~~---~~M~~~Dvv~~~~~~--~~~~v~d~~~~~~~~------~p~~d~~---~~~~~~~~~~~~~~g~~~   94 (124)
T PF03351_consen   29 NGWVAIGFSDD---GGMGGSDVVVCWVDD--GKVYVQDYYSTGGYG------PPTVDDQ---GSQDIQLLSGSYSNGTTT   94 (124)
T ss_pred             CCEEEEEEccc---cCCCCCcEEEEEEcC--CceeEEEeeccCccc------ceeeccc---cCCcEEEEEEEEECCEEE
Confidence            79999999985   579999999999984  899999999 66664      3556632   579999999999999999


Q ss_pred             EEEEccCCCCCCCCccccCCCcEEEEEeeC
Q psy16971         83 VTYQRPLRSHDILDHDIYTNQSQAIIWAIG  112 (383)
Q Consensus        83 V~FrRpL~T~D~~D~~I~~~~t~~VIWA~G  112 (383)
                      ++|+|||.++|++|..|..+.+++||||+|
T Consensus        95 ~~F~R~l~t~d~~d~~l~~~~~~~~i~A~G  124 (124)
T PF03351_consen   95 CSFTRPLNTGDSQDYDLDSNGTYYVIWAYG  124 (124)
T ss_pred             EEEEEEccCCCCCccEecCCCcEEEEEEeC
Confidence            999999999999999998899999999998


No 4  
>KOG3568|consensus
Probab=99.48  E-value=3.5e-14  Score=145.50  Aligned_cols=113  Identities=22%  Similarity=0.316  Sum_probs=92.7

Q ss_pred             CCcEEEEeecCCCCCCCCccccEEEEEEeCCCCceEEEEeeeeCCCcccCCCCCCCCccccCCccceEEEeeEEECCEEE
Q psy16971          3 FGEYMSFGLSGDPLRNQMIGADVVVAWIDQETLNGYAVDYYLTDKSQCAGGRGSCPDYRIQDNTESVRLLNAALVNGYSI   82 (383)
Q Consensus         3 e~~YmAFG~S~~~~~~~M~GADVVVa~vD~~~G~~~a~Dyyit~~s~C~~~~GvcPDt~~gdgtnDi~Lvsg~r~nGvT~   82 (383)
                      ..+|+.||||+.   +.|.+|||||+|.++  +..|+.|+|.+...|-      .     .|.+||++|+...++...++
T Consensus        66 t~~~v~fGfSdr---G~lanaDivv~~n~g--~~~~~~DayTn~d~qi------~-----~D~QQDyqll~~~e~~~~~~  129 (603)
T KOG3568|consen   66 TAGYVGFGFSDR---GALANADIVVGGNAG--GRPYLQDAYTNADGQI------K-----KDAQQDYQLLYAMENSTHTI  129 (603)
T ss_pred             cCCEEEEecCCc---CCcccCcEEEEeccC--CchhhhhhhcCCCCce------e-----cchhhhhHHHhhhccCCccE
Confidence            468999999976   589999999999974  7899999999988652      2     25899999999999999999


Q ss_pred             EEEEccCCCCCCCCccccCCCcEEEEEeeCCCCCccc-ccccccccCcceEE
Q psy16971         83 VTYQRPLRSHDILDHDIYTNQSQAIIWAIGPLNSKQE-VSFHSVFPKKNILF  133 (383)
Q Consensus        83 V~FrRpL~T~D~~D~~I~~~~t~~VIWA~G~ln~~~e-~s~H~~~~~g~~~I  133 (383)
                      |.|||||.|||+.|+.|. +++|+||||+-..+.+.. .-+|+. +++..+.
T Consensus       130 i~frRkl~TCDp~Dy~i~-dgTv~vv~a~~eed~r~l~~v~~~~-~~~v~~~  179 (603)
T KOG3568|consen  130 IEFRRKLHTCDPNDYSIT-DGTVRVVWAYLEEDARELGPVYHDS-NRGVKSL  179 (603)
T ss_pred             EEEecccCcCCccceecc-CCeEEEEEEEeccchhhcccccccc-ccceeee
Confidence            999999999999999997 899999999876654432 345543 4444433


No 5  
>KOG4731|consensus
Probab=98.13  E-value=3.5e-06  Score=87.08  Aligned_cols=103  Identities=8%  Similarity=-0.094  Sum_probs=84.4

Q ss_pred             ceeEEEeCCCCccCCCCCccCCCCccEEEEEcCeecceEEEEeCCeEEEEEEcCCCCCCCCCcCCeEEecCCCCCccCCC
Q psy16971        216 GVLYAQMGPTGGKRGYPAITGHVGWGISWYINGLLIPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITDDSVGGYQHKT  295 (383)
Q Consensus       216 ~~f~a~~gp~gg~rgy~~iTg~~~~g~awyiN~~l~Pel~v~RG~tYtF~VegG~dp~~~~~yHP~yItd~~~GG~~~~~  295 (383)
                      .+|+++.+-.--..+..+|  +|+    ||.|..++|.++.||-.+|.|.+++|.|...|..|.|.||-+|-.+|.++|+
T Consensus       305 ~n~v~~~~~~~~i~nl~~~--~~~----~~~~~v~~~~~~~e~~~~~~~n~~~~~~~~~p~l~~~~~~d~dv~~~~a~l~  378 (512)
T KOG4731|consen  305 DNPVNSTESLTVIWNLGVI--KPP----PYYLPVNHGGVESENFGHFSLNLSDHVDECLPPLDADNKYDQDVIIADAHLP  378 (512)
T ss_pred             cccceecCCceeeeccCcc--cCC----CcccccccCCceecccceeEEEccccccccCCccccccccCcceeeeccccC
Confidence            4667777666666666665  443    9999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcceEEEeCcccCCCCcccccccccccccCCCC
Q psy16971        296 PEEKEKVRIFAGAKRDKFGNVVPTGVGRLCNWTPDP  331 (383)
Q Consensus       296 ~~~~~~~~v~aG~~~~~~g~~~pt~~gr~c~w~~~~  331 (383)
                      ..+..+..|..-.       +.....+.||+|++.+
T Consensus       379 ~~~~~r~~~h~pn-------~~~s~~~~yin~~~~p  407 (512)
T KOG4731|consen  379 LVVTARPSVHYPN-------PPNSSKVLYINKKEAP  407 (512)
T ss_pred             ccccccccccCCC-------CCCCCcceeeeeccCh
Confidence            8877654443222       3456678999999876


No 6  
>cd00241 CDH_cytochrome Cellobiose dehydrogenase (CellobioseDH), cytochrome domain; This extracellular fungal oxidoreductase degrades both lignin and cellulose. It is a hemoflavoenzyme that is comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The 2 domains can be separated  proteolytically. The cytochrome domain folds as a beta sandwich and complexes a heme molecule.
Probab=96.79  E-value=0.021  Score=53.37  Aligned_cols=115  Identities=14%  Similarity=0.179  Sum_probs=78.6

Q ss_pred             CCcEEEEeecCCCCCCCCccccEEEEEEeCCCCceEEEEeeeeCCCcccCCCCCCCCccccCCccceEEEeeE-EECCEE
Q psy16971          3 FGEYMSFGLSGDPLRNQMIGADVVVAWIDQETLNGYAVDYYLTDKSQCAGGRGSCPDYRIQDNTESVRLLNAA-LVNGYS   81 (383)
Q Consensus         3 e~~YmAFG~S~~~~~~~M~GADVVVa~vD~~~G~~~a~Dyyit~~s~C~~~~GvcPDt~~gdgtnDi~Lvsg~-r~nGvT   81 (383)
                      .-+|+|||+.+     +|.++-+.|+|-++  .+..+.=|+.+++.++        + .+. +.-.+.++.++ -.+++-
T Consensus        51 ~~gW~gls~Gg-----~M~~~~L~vaw~~g--~~Vt~S~R~atg~~~P--------~-~y~-g~a~~t~L~gs~vn~t~~  113 (184)
T cd00241          51 ASGWIGLALGG-----AMTNSLLLVAWPNG--NQIVSSTRYATGYTLP--------D-AYT-GPATITQLPSSSVNSTHW  113 (184)
T ss_pred             CCCeEEEeecc-----cCCCCeEEEEEcCC--CeEEEeEEEecCccCC--------C-ccC-CCceEEECCCCcEeCCEE
Confidence            36899999974     79999999999976  4689999999999763        2 222 33367777544 556688


Q ss_pred             EEEEEccCCCCCCC--CccccCCCcEEEEEeeC---CCCCc---ccccccccccCcceEEEeCCC
Q psy16971         82 IVTYQRPLRSHDIL--DHDIYTNQSQAIIWAIG---PLNSK---QEVSFHSVFPKKNILFNFGRT  138 (383)
Q Consensus        82 ~V~FrRpL~T~D~~--D~~I~~~~t~~VIWA~G---~ln~~---~e~s~H~~~~~g~~~I~fg~~  138 (383)
                      +++||=.  .|-..  +-.+.....-.++||++   +.++.   ..+.+|.  ..|...++|...
T Consensus       114 t~~~rC~--nC~~W~~gg~~~~t~~~~~~wA~~~~~~~~p~~~~a~i~~Hd--~~G~f~~dl~~A  174 (184)
T cd00241         114 KLVFRCQ--NCTSWNNGGGIDPTSQGVLAWAFSNVAVDDPSDPQSTFSEHT--DFGFFGINLSDA  174 (184)
T ss_pred             EEEEEeC--CCcccCCCCccCcCCCceEEEEECCCCCCCCCCcccCCceec--CCcceeEechhc
Confidence            8888865  44432  22344344448999995   33322   2367886  468888888654


No 7  
>PF09459 EB_dh:  Ethylbenzene dehydrogenase;  InterPro: IPR019020 This entry represents a haem-binding domain found in cytochromes b558/566 (subunit A), c-551 and c-552, as well as in members of the type-II members of the microbial dimethyl sulphoxide (DMSO) reductase family. The DMSO reductase family is a large and rapidly expanding group of enzymes found in bacteria and archaea that share a common form of molybdenum cofactor known as bis(molybdopterin guanine dinucleotide)Mo []. In addition to the molybdopterin subunit, these enzymes also contain an iron-sulphur subunit. These include two distinct but very closely related periplasmic proteins of anaerobic respiration: selenate reductase and chlorate reductase []. Other proteins containing this subunit include dimethyl sulphide dehydrogenase and ethylbenzene dehydrogenase [, , ].  One member of the DMSO reductase family is eythylbenzene dehydrogenase, which is a heterotrimer of three subunits that catalyses the anaerobic degradation of hydrocarbons (alpha, beta and gamma subunits). This entry matches the gamma subunit, whose structure is known []. The alpha subunit contains the catalytic centre as a Molybdenum cofactor-complex. This removes an electron-pair from the hydrocarbon and passes it along an electron transport system involving iron-sulphur complexes held in the beta subunit and a Haem b molecule contained in the gamma subunit. The electron-pair is then subsequently passed to an as yet unknown receiver. The enzyme is found in a variety of different bacteria.; GO: 0020037 heme binding; PDB: 2IVF_C.
Probab=88.79  E-value=0.65  Score=45.29  Aligned_cols=40  Identities=23%  Similarity=0.389  Sum_probs=25.9

Q ss_pred             eeEEECCEEEEEEEccCCCCC--CCCccccCCCcEEEEEeeC
Q psy16971         73 NAALVNGYSIVTYQRPLRSHD--ILDHDIYTNQSQAIIWAIG  112 (383)
Q Consensus        73 sg~r~nGvT~V~FrRpL~T~D--~~D~~I~~~~t~~VIWA~G  112 (383)
                      .+..+||.-+|+|+|||+|.+  ++|..|....++.|-.|+-
T Consensus       208 ~~~~~dG~Wtv~~~R~L~t~~~~~~d~~~~~g~~~~~~fAvw  249 (261)
T PF09459_consen  208 GGKWKDGYWTVEFSRPLDTGDPSPYDVQFEPGKTYYVAFAVW  249 (261)
T ss_dssp             EEEEETTEEEEEEEEES---T-T--S----TTEEEEEEEEEE
T ss_pred             eeEECCCEEEEEEEEECCCCCCcccceeecCCCEEEEEEEEE
Confidence            467799999999999999995  5799999777788877874


No 8  
>TIGR03477 DMSO_red_II_gam DMSO reductase family type II enzyme, heme b subunit. This model represents a heme b-binding subunit, typically called the gamma subunit, of various proteins that also contain a molybdopterin subunit and an iron-sulfur protein. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase and ethylbenzene dehydrogenase.
Probab=78.56  E-value=4.2  Score=38.91  Aligned_cols=40  Identities=23%  Similarity=0.179  Sum_probs=35.3

Q ss_pred             eeEEECCEEEEEEEccCCCCCCCCccccCCCcEEEEEeeC
Q psy16971         73 NAALVNGYSIVTYQRPLRSHDILDHDIYTNQSQAIIWAIG  112 (383)
Q Consensus        73 sg~r~nGvT~V~FrRpL~T~D~~D~~I~~~~t~~VIWA~G  112 (383)
                      .+...||.-+|.|+|||++....+..|..++.+.|-+|+-
T Consensus       144 ~a~~~~~~WtVv~~RpL~~~~~~~~~l~~g~~~~vaFAVW  183 (205)
T TIGR03477       144 VATYDNGEWTVVLSRPLASKGEGLASLQAGGDSKVAFAVW  183 (205)
T ss_pred             eEEEcCCEEEEEEEEECCCCCcccceeccCCeEEEEEEEE
Confidence            5777899999999999999888888888889999999984


No 9  
>TIGR02656 cyanin_plasto plastocyanin. Members of this family are plastocyanin, a blue copper protein related to pseudoazurin, halocyanin, amicyanin, etc. This protein, located in the thylakoid luman, performs electron transport to photosystem I in Cyanobacteria and chloroplasts.
Probab=65.64  E-value=33  Score=28.27  Aligned_cols=43  Identities=16%  Similarity=0.293  Sum_probs=30.4

Q ss_pred             eEEEeCCCCccCCCCCccCCCCccEEEEEcCeecceEEEEeCCeEEEEEEcCCCCCCCCCcCCeEEec
Q psy16971        218 LYAQMGPTGGKRGYPAITGHVGWGISWYINGLLIPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITD  285 (383)
Q Consensus       218 f~a~~gp~gg~rgy~~iTg~~~~g~awyiN~~l~Pel~v~RG~tYtF~VegG~dp~~~~~yHP~yItd  285 (383)
                      ++.+||...|.--|..                  .+|.|+.|.+++|.- .+.      .-|-+++.+
T Consensus         1 ~~v~~g~~~g~~~F~P------------------~~i~v~~G~~V~~~N-~~~------~~H~~~~~~   43 (99)
T TIGR02656         1 VTVKMGADKGALVFEP------------------AKISIAAGDTVEWVN-NKG------GPHNVVFDE   43 (99)
T ss_pred             CEEEEecCCCceeEeC------------------CEEEECCCCEEEEEE-CCC------CCceEEECC
Confidence            4677887677666664                  589999999999983 222      237777754


No 10 
>PF04526 DUF568:  Protein of unknown function (DUF568);  InterPro: IPR017214 This group represents an uncharacterised conserved protein.
Probab=65.04  E-value=89  Score=26.75  Aligned_cols=88  Identities=20%  Similarity=0.216  Sum_probs=59.8

Q ss_pred             CccccEEEEEEeCCCCceEEEEeeeeCCCc-ccCCCCCCCCccccCCccceEEEeeEEECCEEEEEEEccCCCCCCCCcc
Q psy16971         20 MIGADVVVAWIDQETLNGYAVDYYLTDKSQ-CAGGRGSCPDYRIQDNTESVRLLNAALVNGYSIVTYQRPLRSHDILDHD   98 (383)
Q Consensus        20 M~GADVVVa~vD~~~G~~~a~Dyyit~~s~-C~~~~GvcPDt~~gdgtnDi~Lvsg~r~nGvT~V~FrRpL~T~D~~D~~   98 (383)
                      |+|+-+.||+=+..+|...+.-|.|+++.. +      -|-    .=.=++..+++...+|.-+|-=+=+|.        
T Consensus         1 M~GtqALvAf~~~~~G~~~v~T~~i~sy~~~l------~~~----~lsf~v~~lsae~~~~~~~IfAtl~Lp--------   62 (101)
T PF04526_consen    1 MVGTQALVAFKNSNGGSVTVYTYNITSYSPSL------QPG----PLSFDVSDLSAEYSGGEMTIFATLKLP--------   62 (101)
T ss_pred             CCCceEEEEEeCCCCceEEEEEEeeccccccc------ccc----cccccccceEeEEeCCEEEEEEEEEcC--------
Confidence            999999999998876788888889999874 2      111    013345566777777744333232332        


Q ss_pred             ccCCCcEEEEEeeCCCCCcccccccccc
Q psy16971         99 IYTNQSQAIIWAIGPLNSKQEVSFHSVF  126 (383)
Q Consensus        99 I~~~~t~~VIWA~G~ln~~~e~s~H~~~  126 (383)
                       .....+.-||-.|+.-....+..|+..
T Consensus        63 -~n~t~vnhVWQ~G~~v~gg~p~~H~~~   89 (101)
T PF04526_consen   63 -GNSTSVNHVWQVGPSVQGGSPQPHPTS   89 (101)
T ss_pred             -CCCcEEEEEeCcCCccCCCccccCCCC
Confidence             113578899999998766678899864


No 11 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=57.55  E-value=20  Score=28.27  Aligned_cols=19  Identities=26%  Similarity=0.485  Sum_probs=15.9

Q ss_pred             ccCCCCccEEEEEcCeecc
Q psy16971        234 ITGHVGWGISWYINGLLIP  252 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~P  252 (383)
                      .+|.|.+.+.|+.||..+.
T Consensus        24 ~~G~P~p~v~W~~~g~~~~   42 (90)
T cd04972          24 AEGSPLPKVEWIIAGLIVI   42 (90)
T ss_pred             EEEcCCCeEEEEECCEEcc
Confidence            3488999999999998753


No 12 
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion]
Probab=51.10  E-value=7.6  Score=39.43  Aligned_cols=30  Identities=27%  Similarity=0.313  Sum_probs=24.4

Q ss_pred             CCCcEEEEeecCCCC-CCCCccccEEEEEEe
Q psy16971          2 EFGEYMSFGLSGDPL-RNQMIGADVVVAWID   31 (383)
Q Consensus         2 ~e~~YmAFG~S~~~~-~~~M~GADVVVa~vD   31 (383)
                      ..+-|+|+|+||... ..+|.+|+++||--.
T Consensus       251 ~P~LYIA~GISGAiQHlaGm~~Sk~IVAINk  281 (313)
T COG2025         251 APKLYIALGISGAIQHLAGMKDSKVIVAINK  281 (313)
T ss_pred             cccEEEEEecccHHHHHhhcccCcEEEEEcC
Confidence            457799999999754 489999999999643


No 13 
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=50.25  E-value=11  Score=30.30  Aligned_cols=20  Identities=20%  Similarity=0.612  Sum_probs=17.8

Q ss_pred             ccCCCCccEEEEEcCeecce
Q psy16971        234 ITGHVGWGISWYINGLLIPE  253 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~Pe  253 (383)
                      ++|.|-+.|.||-||+++++
T Consensus         7 v~G~P~Pti~W~kng~~l~~   26 (79)
T cd05855           7 VKGNPKPTLQWFHEGAILNE   26 (79)
T ss_pred             EeEeCCCceEEEECCEECCC
Confidence            57999999999999998864


No 14 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=48.90  E-value=15  Score=28.47  Aligned_cols=19  Identities=26%  Similarity=0.510  Sum_probs=16.9

Q ss_pred             ccCCCCccEEEEEcCeecc
Q psy16971        234 ITGHVGWGISWYINGLLIP  252 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~P  252 (383)
                      ++|.|.+.+.||-||+.|.
T Consensus         7 v~g~P~P~v~W~kdg~~l~   25 (67)
T cd05863           7 VAAYPPPEFQWYKDGKLIS   25 (67)
T ss_pred             EEEeCCCEEEEEECCEECc
Confidence            5688999999999999885


No 15 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=48.75  E-value=20  Score=27.56  Aligned_cols=39  Identities=23%  Similarity=0.546  Sum_probs=28.4

Q ss_pred             ccCCCCccEEEEEcCeecceEEEEeCCeEEEEEEcCCCCCCCCCcCCeEEec
Q psy16971        234 ITGHVGWGISWYINGLLIPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITD  285 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~Pel~v~RG~tYtF~VegG~dp~~~~~yHP~yItd  285 (383)
                      ++|.|...+.|+.||..+.+     +..|.+...++        .+=|.|.+
T Consensus        24 ~~~~p~~~v~W~~~~~~l~~-----~~~~~~~~~~~--------~~~L~I~~   62 (90)
T PF07679_consen   24 VSGNPPPTVTWYKNGRPLTS-----SQRYQIESDGG--------SSSLTIKN   62 (90)
T ss_dssp             EEESSSSEEEEEETTEEEES-----SSSEEEEEETT--------EEEEEESS
T ss_pred             EEeCCCCcccccccccceee-----eeeeeeecccc--------eeEEccCC
Confidence            35667789999999998765     77777777763        35666654


No 16 
>TIGR03154 sulfolob_CbsA cytochrome b558/566, subunit A. Members of this protein family are CbsA, one subunit of a highly glycosylated, heterodimeric, mono-heme cytochrome b558/566, found in Sulfolobus acidocaldarius and several other members of the Sulfolobales, a branch of the Crenarchaeota.
Probab=48.53  E-value=63  Score=33.80  Aligned_cols=82  Identities=24%  Similarity=0.376  Sum_probs=51.7

Q ss_pred             EEeCCCCceEEEEeeeeCCCc----ccC--CCCCCCCccccCCcc-ce--EEEeeEEECCEEEEEEEccCCCCC---CCC
Q psy16971         29 WIDQETLNGYAVDYYLTDKSQ----CAG--GRGSCPDYRIQDNTE-SV--RLLNAALVNGYSIVTYQRPLRSHD---ILD   96 (383)
Q Consensus        29 ~vD~~~G~~~a~Dyyit~~s~----C~~--~~GvcPDt~~gdgtn-Di--~Lvsg~r~nGvT~V~FrRpL~T~D---~~D   96 (383)
                      ++|.. ..+|+.+.|......    |.+  +..|. -    .|.| .+  .--.+..+||+-+|+|.|||...-   +.=
T Consensus       301 y~dp~-nhgfavplytnntnmyevd~~giwytpv~-s----~glngslffi~TgAtY~nG~WTVefaRPL~vp~~y~~~m  374 (465)
T TIGR03154       301 YVDPG-NHGFAVPLYTNNTNMYEVDTAGIWYTPVA-S----EGLNGSLFFIWTGATYENGYWTVEFARPLAVPLDYAPWM  374 (465)
T ss_pred             eecCC-CCceEeeeEecCCCceeeccCceeccccc-c----CCCCCceEEEEeccEEeCCeEEEEEEeccCCCccccccc
Confidence            45553 567888888665432    322  12221 1    1222 22  223478899999999999999765   344


Q ss_pred             ccccCCCcEEEEEee--CCCCC
Q psy16971         97 HDIYTNQSQAIIWAI--GPLNS  116 (383)
Q Consensus        97 ~~I~~~~t~~VIWA~--G~ln~  116 (383)
                      -.|..+...+|-+|.  |.+..
T Consensus       375 pnitvg~tyyVAFAVWqGs~GE  396 (465)
T TIGR03154       375 PNITVGKTYYVAFAVWQGKLGE  396 (465)
T ss_pred             cccccCCeEEEEEEEEcCcccc
Confidence            557778889999988  76543


No 17 
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional
Probab=47.24  E-value=8.2  Score=39.05  Aligned_cols=29  Identities=17%  Similarity=0.181  Sum_probs=23.7

Q ss_pred             CCCcEEEEeecCCCC-CCCCccccEEEEEE
Q psy16971          2 EFGEYMSFGLSGDPL-RNQMIGADVVVAWI   30 (383)
Q Consensus         2 ~e~~YmAFG~S~~~~-~~~M~GADVVVa~v   30 (383)
                      ..+-|+|+|+||.-. ..+|.+|+++|+=-
T Consensus       252 ~P~lYiA~GISGaiQH~~Gm~~s~~IVAIN  281 (313)
T PRK03363        252 KPELYLAVGISGQIQHMVGANASQTIFAIN  281 (313)
T ss_pred             CccEEEEEccccHHHHHhhcccCCEEEEEc
Confidence            457799999998743 47899999999864


No 18 
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=46.58  E-value=23  Score=27.44  Aligned_cols=20  Identities=35%  Similarity=0.466  Sum_probs=17.3

Q ss_pred             ccCCCCccEEEEEcCeecce
Q psy16971        234 ITGHVGWGISWYINGLLIPE  253 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~Pe  253 (383)
                      ++|.|.+.+.||-||+.+..
T Consensus         7 v~G~P~P~v~W~k~g~~l~~   26 (70)
T cd05864           7 YYGYPPPEVKWYKNGQLIVL   26 (70)
T ss_pred             EEEeCCCEEEEEECCEECCC
Confidence            46899999999999998853


No 19 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=45.24  E-value=15  Score=28.05  Aligned_cols=20  Identities=35%  Similarity=0.522  Sum_probs=16.6

Q ss_pred             ccCCCCccEEEEEcCeecce
Q psy16971        234 ITGHVGWGISWYINGLLIPE  253 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~Pe  253 (383)
                      ++|.|.+.+.||.||.++.+
T Consensus        10 ~~G~P~p~i~W~k~g~~i~~   29 (76)
T cd05867          10 VEGIPTPNITWSINGAPIEG   29 (76)
T ss_pred             eeEeCCCeEEEEECCEECCC
Confidence            35788899999999998754


No 20 
>PLN00022 electron transfer flavoprotein subunit alpha; Provisional
Probab=44.96  E-value=10  Score=39.11  Aligned_cols=29  Identities=28%  Similarity=0.299  Sum_probs=23.7

Q ss_pred             CCCcEEEEeecCCCC-CCCCccccEEEEEE
Q psy16971          2 EFGEYMSFGLSGDPL-RNQMIGADVVVAWI   30 (383)
Q Consensus         2 ~e~~YmAFG~S~~~~-~~~M~GADVVVa~v   30 (383)
                      ..+-|+|||+||.-. ..+|.+|+++|+=-
T Consensus       293 ~P~lYIA~GISGAiQH~~Gm~~s~~IVAIN  322 (356)
T PLN00022        293 APELYIAVGISGAIQHLAGMKDSKVIVAIN  322 (356)
T ss_pred             CCcEEEEEecchHHHHHhhcccCCEEEEEC
Confidence            457799999998743 47899999999854


No 21 
>PF00394 Cu-oxidase:  Multicopper oxidase;  InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties. Since free copper is toxic, even at very low concentrations, its homeostasis in living organisms is tightly controlled by subtle molecular mechanisms. In eukaryotes, before being transported inside the cell via the high-affinity copper transporters of the CTR family, the copper (II) ion is reduced to copper (I). In blue copper proteins such as cupredoxin, the copper (I) ion form is stabilised by a constrained His2Cys coordination environment. Multicopper oxidases oxidise their substrate by accepting electrons at a mononuclear copper centre and transferring them to a trinuclear copper centre; dioxygen binds to the trinuclear centre and, following the transfer of four electrons, is reduced to two molecules of water []. There are three spectroscopically different copper centres found in multicopper oxidases: type 1 (or blue), type 2 (or normal) and type 3 (or coupled binuclear) [, ]. Multicopper oxidases consist of 2, 3 or 6 of these homologous domains, which also share homology to the cupredoxins azurin and plastocyanin. Structurally, these domains consist of a cupredoxin-like fold, a beta-sandwich consisting of 7 strands in 2 beta-sheets, arranged in a Greek-key beta-barrel []. Multicopper oxidases include:   Ceruloplasmin (1.16.3.1 from EC) (ferroxidase), a 6-domain enzyme found in the serum of mammals and birds that oxidizes different inorganic and organic substances; exhibits internal sequence homology that appears to have evolved from the triplication of a Cu-binding domain similar to that of laccase and ascorbate oxidase.  Laccase (1.10.3.2 from EC) (urishiol oxidase), a 3-domain enzyme found in fungi and plants, which oxidizes different phenols and diamines. CueO is a laccase found in Escherichia coli that is involved in copper-resistance []. Ascorbate oxidase (1.10.3.3 from EC), a 3-domain enzyme found in higher plants. Nitrite reductase (1.7.2.1 from EC), a 2-domain enzyme containing type-1 and type-2 copper centres [, ].   In addition to the above enzymes there are a number of other proteins that are similar to the multi-copper oxidases in terms of structure and sequence, some of which have lost the ability to bind copper. These include: copper resistance protein A (copA) from a plasmid in Pseudomonas syringae; domain A of (non-copper binding) blood coagulation factors V (Fa V) and VIII (Fa VIII) []; yeast FET3 required for ferrous iron uptake []; yeast hypothetical protein YFL041w; and the fission yeast homologue SpAC1F7.08. This entry represents multicopper oxidase type 1 (blue) domains. These domains are also present in proteins that have lost the ability to bind copper.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1RZP_A 2AVF_D 1NIA_A 1KCB_A 2NRD_A 1NIB_A 2BW4_A 1RZQ_C 2BWD_A 2BWI_A ....
Probab=41.88  E-value=34  Score=30.34  Aligned_cols=54  Identities=20%  Similarity=0.268  Sum_probs=32.4

Q ss_pred             eecceEEEEeCCeEEEE-EEcCCCCCCCCCcCCeEE-------ecCCCCCccCCChhhhcceEEEeCccc
Q psy16971        249 LLIPEINVVRGKTYTFI-VEGGLDPNTPAKYHPFYI-------TDDSVGGYQHKTPEEKEKVRIFAGAKR  310 (383)
Q Consensus       249 ~l~Pel~v~RG~tYtF~-VegG~dp~~~~~yHP~yI-------td~~~GG~~~~~~~~~~~~~v~aG~~~  310 (383)
                      ...|.|.|+.|++|.|+ |.+|..     .+|.|-|       ... .|.+-+  +.+...+.|..|-.+
T Consensus        57 ~~~~~~~v~~g~~~rlRliNa~~~-----~~~~~~i~gh~~~Via~-DG~~v~--p~~~~~l~l~~G~R~  118 (159)
T PF00394_consen   57 GEPPVIKVKPGERYRLRLINAGAS-----TSFNFSIDGHPMTVIAA-DGVPVE--PYKVDTLVLAPGQRY  118 (159)
T ss_dssp             STSGEEEEETTTEEEEEEEEESSS------BEEEEETTBCEEEEEE-TTEEEE--EEEESBEEE-TTEEE
T ss_pred             cccceEEEcCCcEEEEEEEeccCC-----eeEEEEeeccceeEeee-cccccc--ccccceEEeeCCeEE
Confidence            56799999999999994 455553     2444444       222 355544  445555666555554


No 22 
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional
Probab=41.38  E-value=12  Score=37.88  Aligned_cols=29  Identities=31%  Similarity=0.354  Sum_probs=23.6

Q ss_pred             CCCcEEEEeecCCCC-CCCCccccEEEEEE
Q psy16971          2 EFGEYMSFGLSGDPL-RNQMIGADVVVAWI   30 (383)
Q Consensus         2 ~e~~YmAFG~S~~~~-~~~M~GADVVVa~v   30 (383)
                      ..+-|+|+|+||.-. ..+|.+|++||+=-
T Consensus       251 ~P~lYiA~GISGAiQH~aGm~~s~~IVAIN  280 (312)
T PRK11916        251 KSDLYLTLGISGQIQHMVGGNGAKVIVAIN  280 (312)
T ss_pred             CccEEEEeccccHHHHHhhcccCCEEEEEC
Confidence            456799999998743 37899999999854


No 23 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=38.80  E-value=24  Score=26.39  Aligned_cols=18  Identities=33%  Similarity=0.547  Sum_probs=15.3

Q ss_pred             cCCCCccEEEEEcCeecc
Q psy16971        235 TGHVGWGISWYINGLLIP  252 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~P  252 (383)
                      +|.|.+-|.|+.||.++.
T Consensus        11 ~g~P~p~i~W~~~g~~~~   28 (76)
T cd04978          11 EGIPQPTITWRLNGVPIE   28 (76)
T ss_pred             eeeCCCEEEEEECCEECC
Confidence            477888899999999875


No 24 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=38.76  E-value=21  Score=28.24  Aligned_cols=19  Identities=26%  Similarity=0.679  Sum_probs=16.5

Q ss_pred             ccCCCCccEEEEEcCeecc
Q psy16971        234 ITGHVGWGISWYINGLLIP  252 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~P  252 (383)
                      ++|.|.+.+.||-||++|.
T Consensus         7 v~G~P~P~v~W~k~g~~i~   25 (81)
T cd04971           7 VRGNPKPTLTWYHNGAVLN   25 (81)
T ss_pred             eEeeCCCcEEEEECCEECc
Confidence            4689999999999999873


No 25 
>PF00127 Copper-bind:  Copper binding proteins, plastocyanin/azurin family;  InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ]. The most well known members of this class of proteins are the plant chloroplastic plastocyanins, which exchange electrons with cytochrome c6, and the distantly related bacterial azurins, which exchange electrons with cytochrome c551. This family of proteins also includes amicyanin from bacteria such as Methylobacterium extorquens or Paracoccus versutus (Thiobacillus versutus) that can grow on methylamine; auracyanins A and B from Chloroflexus aurantiacus []; blue copper protein from Alcaligenes faecalis; cupredoxin (CPC) from Cucumis sativus (Cucumber) peelings []; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from Natronomonas pharaonis (Natronobacterium pharaonis) [], a membrane associated copper-binding protein; pseudoazurin from Pseudomonas; rusticyanin from Thiobacillus ferrooxidans []; stellacyanin from Rhus vernicifera (Japanese lacquer tree); umecyanin from the roots of Armoracia rusticana (Horseradish); and allergen Ra3 from ragweed. This pollen protein is evolutionary related to the above proteins, but seems to have lost the ability to bind copper. Although there is an appreciable amount of divergence in the sequences of all these proteins, the copper ligand sites are conserved.; GO: 0005507 copper ion binding, 0009055 electron carrier activity; PDB: 1UAT_A 1CUO_A 1PLC_A 4PCY_A 3PCY_A 1PND_A 1PNC_A 1JXG_A 6PCY_A 1TKW_A ....
Probab=38.74  E-value=1.2e+02  Score=24.79  Aligned_cols=27  Identities=30%  Similarity=0.374  Sum_probs=22.0

Q ss_pred             ceEEEEeCCeEEEEEEcCCCCCCCCCcCCeEEec
Q psy16971        252 PEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITD  285 (383)
Q Consensus       252 Pel~v~RG~tYtF~VegG~dp~~~~~yHP~yItd  285 (383)
                      ++|.|+.|.|++|...++       .-|-+.+.+
T Consensus        17 ~~i~V~~G~tV~~~n~~~-------~~Hnv~~~~   43 (99)
T PF00127_consen   17 SEITVKAGDTVTFVNNDS-------MPHNVVFVA   43 (99)
T ss_dssp             SEEEEETTEEEEEEEESS-------SSBEEEEET
T ss_pred             CEEEECCCCEEEEEECCC-------CCceEEEec
Confidence            699999999999998732       348888877


No 26 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=38.49  E-value=54  Score=25.96  Aligned_cols=18  Identities=22%  Similarity=0.403  Sum_probs=15.3

Q ss_pred             ccCCCCccEEEEEcCeec
Q psy16971        234 ITGHVGWGISWYINGLLI  251 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~  251 (383)
                      ++|.|.+.+.||-||..+
T Consensus        25 v~G~P~p~v~W~k~g~~l   42 (92)
T cd05737          25 VFGDPDPEVSWLKNDQAL   42 (92)
T ss_pred             EEecCCCeEEEEECCEEC
Confidence            357888999999999875


No 27 
>PF02550 AcetylCoA_hydro:  Acetyl-CoA hydrolase/transferase N-terminal domain;  InterPro: IPR003702 This family contains several enzymes which take part in pathways involving acetyl-CoA. Acetyl-CoA hydrolase 3.1.2.1 from EC from yeast catalyses the formation of acetate from acetyl-CoA, CoA transferase (CAT1) 2.8.3 from EC produces succinyl-CoA, and acetate-CoA transferase 2.8.3.8 from EC utilises acyl-CoA and acetate to form acetyl-CoA.; GO: 0003824 catalytic activity, 0006084 acetyl-CoA metabolic process; PDB: 2NVV_C 2G39_A 3D3U_A 3S8D_B 3QLI_B 3QLK_B 3GK7_B 3QDQ_A 3EH7_A 2OAS_A ....
Probab=37.48  E-value=5.9  Score=36.76  Aligned_cols=37  Identities=22%  Similarity=0.223  Sum_probs=28.9

Q ss_pred             CCCCcEEEEeecCCCCCCCCccccEEEEEEeCCCCceEE
Q psy16971          1 MEFGEYMSFGLSGDPLRNQMIGADVVVAWIDQETLNGYA   39 (383)
Q Consensus         1 ~~e~~YmAFG~S~~~~~~~M~GADVVVa~vD~~~G~~~a   39 (383)
                      ++++||+.||+|.+..+..+..|++||+-|+.+  .++.
T Consensus       135 ~De~Gy~slG~s~~~~~~~ie~A~~vI~eVN~~--~P~~  171 (198)
T PF02550_consen  135 MDEHGYFSLGTSVDYTKAAIEQAKKVIVEVNPN--MPRT  171 (198)
T ss_dssp             E-TTSEEECTTBHBTHHHHHHHTSEEEEEEETT--STS-
T ss_pred             cCCCCCEeecHHHHhHHHHHhcCCeEEEEcCCC--CCCC
Confidence            479999999998766567788899999999874  5544


No 28 
>TIGR03095 rusti_cyanin rusticyanin. Rusticyanin is a blue copper protein, described in an obligate acidophilic chemolithoautroph, Acidithiobacillus ferrooxidans, as an electron transfer protein. It can constitute up to 5 percent of protein in cells grown on Fe(II) and is thought to be part of an electron chain for Fe(II) oxidation, with two c-type cytochromes, an aa3-type cytochrome oxidase, and 02 as terminal electron acceptor. It is rather closely related to sulfocyanin (TIGR03094).
Probab=36.27  E-value=60  Score=29.23  Aligned_cols=39  Identities=31%  Similarity=0.326  Sum_probs=31.5

Q ss_pred             EEEEcCeecceEEEEeCCeEEEEEEcCCCCCCCCCcCCeEEec
Q psy16971        243 SWYINGLLIPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITD  285 (383)
Q Consensus       243 awyiN~~l~Pel~v~RG~tYtF~VegG~dp~~~~~yHP~yItd  285 (383)
                      ..-|||+.-|.|.|++|.+.+|.|.=-.+    ..-|.|-|..
T Consensus        43 ~f~~~~~~~P~I~v~~Gd~V~v~v~N~~~----~~~H~~~I~~   81 (148)
T TIGR03095        43 SFEIHDLKNPTIVIPEGVTVHFTVINTDT----DSGHNFDISK   81 (148)
T ss_pred             eEEecCCCCCEEEEcCCCEEEEEEEeCCC----CccccEEeec
Confidence            56789999999999999999998765332    2469999874


No 29 
>PRK10883 FtsI repressor; Provisional
Probab=34.95  E-value=42  Score=35.58  Aligned_cols=47  Identities=17%  Similarity=0.330  Sum_probs=32.4

Q ss_pred             EEEEcCeecceEEEEeCCeEEE-EEEcCCCCCCCC---CcCCeEEecCCCCCc
Q psy16971        243 SWYINGLLIPEINVVRGKTYTF-IVEGGLDPNTPA---KYHPFYITDDSVGGY  291 (383)
Q Consensus       243 awyiN~~l~Pel~v~RG~tYtF-~VegG~dp~~~~---~yHP~yItd~~~GG~  291 (383)
                      +.-|||+..|.|.|++| +|.| +|.+++....-=   --|+|+|--. .||+
T Consensus       211 ~~lvNG~~~p~~~v~~~-~~RlRliNas~~~~~~l~l~d~~~~~vIa~-DGg~  261 (471)
T PRK10883        211 TLLVNGVQSPYVEVSRG-WVRLRLLNASNARRYQLQMSDGRPLHVIAG-DQGF  261 (471)
T ss_pred             eeEECCccCCeEEecCC-EEEEEEEEccCCceEEEEEcCCCeEEEEEe-CCCc
Confidence            57799999999999986 7999 667777542211   1378776554 2444


No 30 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=34.38  E-value=61  Score=24.86  Aligned_cols=19  Identities=37%  Similarity=0.583  Sum_probs=16.2

Q ss_pred             ccCCCCccEEEEEcCeecc
Q psy16971        234 ITGHVGWGISWYINGLLIP  252 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~P  252 (383)
                      .+|.|.+.|.|+-||+.|.
T Consensus        10 a~G~P~P~i~W~k~g~~i~   28 (76)
T cd05868          10 ANGNPKPSISWLTNGVPIE   28 (76)
T ss_pred             eeEeCCCeEEEEECCEEcc
Confidence            3588999999999999874


No 31 
>TIGR03389 laccase laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.
Probab=33.91  E-value=73  Score=34.24  Aligned_cols=65  Identities=23%  Similarity=0.359  Sum_probs=38.7

Q ss_pred             EEEEcCeec----------ceEEEEeCCeEEE-EEEcCCCCCC--CCCcCCeEEecCCCCCccCCChhhhcceEEEeCcc
Q psy16971        243 SWYINGLLI----------PEINVVRGKTYTF-IVEGGLDPNT--PAKYHPFYITDDSVGGYQHKTPEEKEKVRIFAGAK  309 (383)
Q Consensus       243 awyiN~~l~----------Pel~v~RG~tYtF-~VegG~dp~~--~~~yHP~yItd~~~GG~~~~~~~~~~~~~v~aG~~  309 (383)
                      ++-|||+.-          +.|.|++|++|.| .|.+|.+...  .=--|+|+|-.. .|.+-+  +-+...+.|.+|-.
T Consensus       168 ~~liNG~~~~~~~~~~~~~~~i~v~~G~~~RlRlINa~~~~~~~~~idgH~~~VIa~-DG~~~~--P~~~~~l~i~~GqR  244 (539)
T TIGR03389       168 AYTINGHPGPLYNCSSKDTFKLTVEPGKTYLLRIINAALNDELFFAIANHTLTVVEV-DATYTK--PFKTKTIVIGPGQT  244 (539)
T ss_pred             eEEECCCcCCCCCCCCCCceEEEECCCCEEEEEEEeccCCceEEEEECCCeEEEEEe-CCcccC--ceEeCeEEecCCCE
Confidence            577888752          4799999999999 4555543310  111377766554 355542  34445556655544


Q ss_pred             c
Q psy16971        310 R  310 (383)
Q Consensus       310 ~  310 (383)
                      +
T Consensus       245 y  245 (539)
T TIGR03389       245 T  245 (539)
T ss_pred             E
Confidence            3


No 32 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=33.75  E-value=31  Score=26.57  Aligned_cols=17  Identities=24%  Similarity=0.552  Sum_probs=14.8

Q ss_pred             cCCCCccEEEEEcCeec
Q psy16971        235 TGHVGWGISWYINGLLI  251 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~  251 (383)
                      +|.|.+.+.||-||..+
T Consensus         8 ~g~P~p~v~W~k~g~~l   24 (77)
T cd05760           8 DGHPRPTYQWFRDGTPL   24 (77)
T ss_pred             eecCCCcEEEEECCEEC
Confidence            57888999999999876


No 33 
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing. This family consists of copper-type nitrite reductase. It reduces nitrite to nitric oxide, the first step in denitrification.
Probab=33.56  E-value=2.3e+02  Score=28.41  Aligned_cols=38  Identities=18%  Similarity=0.144  Sum_probs=28.1

Q ss_pred             EEEEcCee-cceEEEEeCCeEEEEEEcCCCCCCCCCcCCeEE
Q psy16971        243 SWYINGLL-IPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYI  283 (383)
Q Consensus       243 awyiN~~l-~Pel~v~RG~tYtF~VegG~dp~~~~~yHP~yI  283 (383)
                      +|-+||+. -|.|.+++|.+....|.-..   .+...|++=+
T Consensus        49 ~~~~nG~~pGP~irv~~Gd~v~v~v~N~~---~~~~~h~~h~   87 (311)
T TIGR02376        49 AMTFDGSVPGPLIRVHEGDYVELTLINPP---TNTMPHNVDF   87 (311)
T ss_pred             EEEECCcccCceEEEECCCEEEEEEEeCC---CCCCceeeee
Confidence            79999996 48999999999999887432   1223466644


No 34 
>PF00868 Transglut_N:  Transglutaminase family;  InterPro: IPR001102 Synonym(s): Protein-glutamine gamma-glutamyltransferase, Fibrinoligase, TGase Protein-glutamine gamma-glutamyltransferases (2.3.2.13 from EC) (TGase) are calcium-dependent enzymes that catalyse the cross-linking of proteins by promoting the formation of isopeptide bonds between the gamma-carboxyl group of a glutamine in one polypeptide chain and the epsilon-amino group of a lysine in a second polypeptide chain. TGases also catalyse the conjugation of polyamines to proteins [, ]. Transglutaminases are widely distributed in various organs, tissues and body fluids. The best known transglutaminase is blood coagulation factor XIII, a plasma tetrameric protein composed of two catalytic A subunits and two non-catalytic B subunits. Factor XIII is responsible for cross-linking fibrin chains, thus stabilising the fibrin clot. There are commonly three domains: N-terminal, middle (IPR013808 from INTERPRO) and C-terminal (IPR013807 from INTERPRO). This entry represents the N-terminal domain found in transglutaminases.; GO: 0018149 peptide cross-linking; PDB: 1L9N_B 1NUF_A 1NUD_A 1NUG_B 1L9M_A 1KV3_C 3S3S_A 2Q3Z_A 3LY6_A 3S3P_A ....
Probab=33.29  E-value=37  Score=29.30  Aligned_cols=21  Identities=24%  Similarity=0.343  Sum_probs=17.4

Q ss_pred             ecceEEEEeCCeEEEEEEcCC
Q psy16971        250 LIPEINVVRGKTYTFIVEGGL  270 (383)
Q Consensus       250 l~Pel~v~RG~tYtF~VegG~  270 (383)
                      ..+.|-||||+++++.++=-.
T Consensus        23 ~~~~LVVRRGQ~F~i~l~f~r   43 (118)
T PF00868_consen   23 ESPRLVVRRGQPFTITLRFNR   43 (118)
T ss_dssp             SSSSEEEETTSEEEEEEEESS
T ss_pred             CCCCEEEECCCEEEEEEEEcC
Confidence            368999999999999987633


No 35 
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=33.21  E-value=94  Score=23.89  Aligned_cols=19  Identities=26%  Similarity=0.406  Sum_probs=15.8

Q ss_pred             cCCCCccEEEEEcCeecce
Q psy16971        235 TGHVGWGISWYINGLLIPE  253 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~Pe  253 (383)
                      +|.|.+.+.||-||+.+..
T Consensus        26 ~g~P~p~i~W~k~g~~l~~   44 (100)
T cd07693          26 EGRPTPTIQWLKNGQPLET   44 (100)
T ss_pred             CcCCCCEEEEEECCEECcc
Confidence            5778889999999998754


No 36 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=33.09  E-value=33  Score=26.39  Aligned_cols=19  Identities=16%  Similarity=0.209  Sum_probs=16.5

Q ss_pred             ccCCCCccEEEEEcCeecc
Q psy16971        234 ITGHVGWGISWYINGLLIP  252 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~P  252 (383)
                      ++|+|.+-+.||-||.++.
T Consensus         7 v~G~P~P~v~W~k~~~~i~   25 (75)
T cd05744           7 VSAIPPPQIFWKKNNEMLT   25 (75)
T ss_pred             EeecCCCeEEEEECCEECC
Confidence            4688999999999999874


No 37 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=30.81  E-value=37  Score=25.52  Aligned_cols=18  Identities=22%  Similarity=0.477  Sum_probs=15.9

Q ss_pred             ccCCCCccEEEEEcCeec
Q psy16971        234 ITGHVGWGISWYINGLLI  251 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~  251 (383)
                      ++|+|.+.+.|+-||..+
T Consensus         8 ~~G~P~p~v~W~k~g~~l   25 (74)
T cd05748           8 ISGRPTPTVTWSKDGKPL   25 (74)
T ss_pred             EeeeCCCeEEEEECCEEc
Confidence            468899999999999986


No 38 
>PLN02835 oxidoreductase
Probab=29.79  E-value=61  Score=35.10  Aligned_cols=29  Identities=38%  Similarity=0.496  Sum_probs=24.3

Q ss_pred             EEEEcCeecceEEEEeCCeEEE-EEEcCCC
Q psy16971        243 SWYINGLLIPEINVVRGKTYTF-IVEGGLD  271 (383)
Q Consensus       243 awyiN~~l~Pel~v~RG~tYtF-~VegG~d  271 (383)
                      +.-|||+..|.+.|++|++|.| +|.+|.+
T Consensus       193 ~~liNG~~~~~~~v~~G~~yRlRliNa~~~  222 (539)
T PLN02835        193 GVLINGQTQSTFSGDQGKTYMFRISNVGLS  222 (539)
T ss_pred             eEEEccccCceEEECCCCEEEEEEEEcCCC
Confidence            5779999999999999999999 4555554


No 39 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=29.29  E-value=40  Score=25.50  Aligned_cols=18  Identities=22%  Similarity=0.281  Sum_probs=15.6

Q ss_pred             cCCCCccEEEEEcCeecc
Q psy16971        235 TGHVGWGISWYINGLLIP  252 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~P  252 (383)
                      +|.|.+.|.|+-||..++
T Consensus        12 ~g~P~p~i~W~k~g~~~~   29 (74)
T cd05745          12 QGYPQPVIAWTKGGSQLS   29 (74)
T ss_pred             CEecCCEEEEEECCEECC
Confidence            578889999999999764


No 40 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=28.94  E-value=55  Score=24.85  Aligned_cols=20  Identities=40%  Similarity=0.612  Sum_probs=16.6

Q ss_pred             ccCCCCccEEEEEcCeecce
Q psy16971        234 ITGHVGWGISWYINGLLIPE  253 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~Pe  253 (383)
                      +.|.|.+.+.||-||.++.+
T Consensus         7 v~g~P~p~v~W~k~g~~l~~   26 (71)
T cd04976           7 VKAYPPPEIQWYKNGKLISE   26 (71)
T ss_pred             EEEeCCCEEEEEECCEECCC
Confidence            45788899999999998754


No 41 
>PRK02710 plastocyanin; Provisional
Probab=28.49  E-value=90  Score=26.69  Aligned_cols=38  Identities=18%  Similarity=0.428  Sum_probs=26.6

Q ss_pred             ceeEEEeCCCCccCCCCCccCCCCccEEEEEcCeecceEEEEeCCeEEEEEEcCCCC
Q psy16971        216 GVLYAQMGPTGGKRGYPAITGHVGWGISWYINGLLIPEINVVRGKTYTFIVEGGLDP  272 (383)
Q Consensus       216 ~~f~a~~gp~gg~rgy~~iTg~~~~g~awyiN~~l~Pel~v~RG~tYtF~VegG~dp  272 (383)
                      .+.+++||-.+|.-.|..                  ++|.|+.|.+++|... +..|
T Consensus        29 ~~~~V~~~~~~~~~~F~P------------------~~i~v~~Gd~V~~~N~-~~~~   66 (119)
T PRK02710         29 ETVEVKMGSDAGMLAFEP------------------STLTIKAGDTVKWVNN-KLAP   66 (119)
T ss_pred             ceEEEEEccCCCeeEEeC------------------CEEEEcCCCEEEEEEC-CCCC
Confidence            467788876555544443                  6899999999999754 3334


No 42 
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=28.47  E-value=41  Score=26.26  Aligned_cols=19  Identities=21%  Similarity=0.218  Sum_probs=16.4

Q ss_pred             ccCCCCccEEEEEcCeecc
Q psy16971        234 ITGHVGWGISWYINGLLIP  252 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~P  252 (383)
                      ++|.|-+.|.||-||.++.
T Consensus         7 v~G~P~P~i~W~k~~~~i~   25 (75)
T cd05892           7 ISAIPPPKIFWKRNNEMVQ   25 (75)
T ss_pred             EEecCCCeEEEEECCEECc
Confidence            4688999999999999873


No 43 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=28.19  E-value=76  Score=24.11  Aligned_cols=19  Identities=16%  Similarity=0.214  Sum_probs=16.2

Q ss_pred             cCCCCccEEEEEcCeecce
Q psy16971        235 TGHVGWGISWYINGLLIPE  253 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~Pe  253 (383)
                      +|.|-+.|.|+.||+.++.
T Consensus        11 ~G~P~P~v~W~k~g~~l~~   29 (69)
T cd05739          11 VGAPMPYVKWMKGGEELTK   29 (69)
T ss_pred             eecCCCEEEEEECCEECCC
Confidence            5889999999999987654


No 44 
>PLN02168 copper ion binding / pectinesterase
Probab=27.97  E-value=82  Score=34.24  Aligned_cols=50  Identities=24%  Similarity=0.318  Sum_probs=32.5

Q ss_pred             EEEEcCee--cceEEEEeCCeEEE-EEEcCCCCCC--CCCcCCeEEecCCCCCccC
Q psy16971        243 SWYINGLL--IPEINVVRGKTYTF-IVEGGLDPNT--PAKYHPFYITDDSVGGYQH  293 (383)
Q Consensus       243 awyiN~~l--~Pel~v~RG~tYtF-~VegG~dp~~--~~~yHP~yItd~~~GG~~~  293 (383)
                      +.-|||+-  .|.|.|++|++|.| +|.+|.+...  .=--|.|.|-- ..|++-.
T Consensus       190 ~~liNG~~~~~~~~~v~~G~~yRlRiiNa~~~~~~~~~IdgH~~tVIa-~DG~~v~  244 (545)
T PLN02168        190 GILFNGRGPEETFFAFEPGKTYRLRISNVGLKTCLNFRIQDHDMLLVE-TEGTYVQ  244 (545)
T ss_pred             EEEEeccCCCcceEEeCCCCEEEEEEEeccCCceEEEEECCcEEEEEE-ECCeECC
Confidence            57799983  68999999999999 4555554210  00137777663 4566554


No 45 
>cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain.  Glycogen debranching enzymes have both 4-alpha-glucanotransferase and amylo-1,6-glucosidase activities. As a transferase it transfers a segment of a 1,4-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or another 1,4-alpha-D-glucan. As a glucosidase it catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues.  The N-terminus of the glycogen debranching enzyme may be related to the immunoglobulin and/or fibronectin type III superfamilies.  These domains are associated with different types of catalytic domains at  either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions.  Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase.
Probab=27.74  E-value=80  Score=25.99  Aligned_cols=40  Identities=30%  Similarity=0.607  Sum_probs=24.6

Q ss_pred             EEEEcCeecceEEEEeCCeEEEEEEcCCCCCCCCCcCCeEEecCC
Q psy16971        243 SWYINGLLIPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITDDS  287 (383)
Q Consensus       243 awyiN~~l~Pel~v~RG~tYtF~VegG~dp~~~~~yHP~yItd~~  287 (383)
                      +|.|   .+|.+  ..|..|.|+|.|..+|+.-..+.|-.+.-||
T Consensus        46 vW~~---~v~~~--~~g~~Y~y~i~g~~~p~~~~~~~~~~~~~DP   85 (103)
T cd02856          46 VWHG---FLPGI--KAGQRYGFRVHGPYDPERGLRFNPAKLLLDP   85 (103)
T ss_pred             EEEE---EECCC--CCCCEEEEEECCccCcccCcccCCCeEEecC
Confidence            6765   23333  3689999999996666544445554444444


No 46 
>PLN02991 oxidoreductase
Probab=27.50  E-value=64  Score=35.06  Aligned_cols=48  Identities=27%  Similarity=0.340  Sum_probs=31.1

Q ss_pred             EEEEcCee-cceEEEEeCCeEEE-EEEcCCCCC--CCCCcCCeEEecCCCCCc
Q psy16971        243 SWYINGLL-IPEINVVRGKTYTF-IVEGGLDPN--TPAKYHPFYITDDSVGGY  291 (383)
Q Consensus       243 awyiN~~l-~Pel~v~RG~tYtF-~VegG~dp~--~~~~yHP~yItd~~~GG~  291 (383)
                      +--|||+- .+.|.|++|++|.| +|.+|.+..  ..=--|+|.|-.. .|++
T Consensus       192 ~~liNG~~~~~~~~v~~G~~yRlRiINa~~~~~~~~~idgH~~tVIa~-DG~~  243 (543)
T PLN02991        192 GILINGRGSGATLNIEPGKTYRLRISNVGLQNSLNFRIQNHTMKLVEV-EGTH  243 (543)
T ss_pred             EEEEccCCCCceEEECCCCEEEEEEEeccCCeeEEEEECCCEEEEEEe-CCcc
Confidence            67799995 47899999999999 455555431  1111477766543 3444


No 47 
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=27.50  E-value=1.2e+02  Score=24.54  Aligned_cols=19  Identities=11%  Similarity=0.317  Sum_probs=16.2

Q ss_pred             CCCCccEEEEEcCeecceE
Q psy16971        236 GHVGWGISWYINGLLIPEI  254 (383)
Q Consensus       236 g~~~~g~awyiN~~l~Pel  254 (383)
                      |.|..-|.||-||+.++..
T Consensus        11 skP~a~i~W~k~~~~l~~~   29 (80)
T cd05885          11 SKPAATLRWYRDRKELKGV   29 (80)
T ss_pred             ccCCCeEEEEECCEECCCC
Confidence            5688899999999998764


No 48 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=26.66  E-value=79  Score=25.40  Aligned_cols=18  Identities=28%  Similarity=0.314  Sum_probs=15.6

Q ss_pred             cCCCCccEEEEEcCeecc
Q psy16971        235 TGHVGWGISWYINGLLIP  252 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~P  252 (383)
                      +|.|-+.|.||-||.++.
T Consensus        29 ~G~P~P~i~W~k~g~~l~   46 (94)
T cd05848          29 RGNPVPTYRWLRNGTEID   46 (94)
T ss_pred             eecCCCEEEEEECCeECc
Confidence            478889999999999874


No 49 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=26.66  E-value=43  Score=25.67  Aligned_cols=19  Identities=32%  Similarity=0.382  Sum_probs=15.6

Q ss_pred             cCCCCccEEEEEcCeecce
Q psy16971        235 TGHVGWGISWYINGLLIPE  253 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~Pe  253 (383)
                      +|.|.+-+.||.|+..+|+
T Consensus        11 ~g~P~p~v~W~~~~~~~~~   29 (78)
T cd05743          11 TGVPTPIINWRLNWGHVPD   29 (78)
T ss_pred             EEecCCEEEEEECCeECCC
Confidence            4778889999999987763


No 50 
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=26.04  E-value=54  Score=24.78  Aligned_cols=17  Identities=24%  Similarity=0.395  Sum_probs=13.7

Q ss_pred             CCCCccEEEEEcCeecc
Q psy16971        236 GHVGWGISWYINGLLIP  252 (383)
Q Consensus       236 g~~~~g~awyiN~~l~P  252 (383)
                      +.|...+.||.||+.++
T Consensus        10 ~~p~~~~~W~~~g~~i~   26 (76)
T cd05895          10 EYPSLRFKWFKNGKEIG   26 (76)
T ss_pred             CCCCCceEEEECCcccc
Confidence            45677899999999874


No 51 
>PF07711 RabGGT_insert:  Rab geranylgeranyl transferase alpha-subunit, insert domain ;  InterPro: IPR009087 Rab geranylgeranyltransferase (RabGGT) catalyses the transfer of geranylgeranyl groups to the C-terminal cysteine residues of Rab proteins, Ras-related small GTPases that function in intracellular vesicular transport []. RabGGT is only able to prenylate Rab when it is complexed to the Rab escort protein (REP), after which REP remains bound to the prenylated Rab and delivers it to its target membrane. RabGGT is a member of the protein prenyltransferase family (IPR008940 from INTERPRO), all of which are heterodimers consisting of alpha and beta subunits. RabGGT is distinct from other members of the prenyltransferase family because of the presence of an Ig-like insert domain in the alpha subunit that is folded into an eight-stranded sandwich between two helices in the helical domain.; GO: 0004663 Rab geranylgeranyltransferase activity, 0008270 zinc ion binding; PDB: 1DCE_C 1LTX_A.
Probab=24.97  E-value=53  Score=28.40  Aligned_cols=41  Identities=15%  Similarity=0.231  Sum_probs=24.2

Q ss_pred             eEEEeeEEECCEEEEEEEccCCCCCCCCccccCCCcEEEEE
Q psy16971         69 VRLLNAALVNGYSIVTYQRPLRSHDILDHDIYTNQSQAIIW  109 (383)
Q Consensus        69 i~Lvsg~r~nGvT~V~FrRpL~T~D~~D~~I~~~~t~~VIW  109 (383)
                      |.-+..+|+.+-.+|.|+|||...-.....+.-+.++.|=|
T Consensus         3 irCl~VSr~e~~l~V~FSrPv~v~~~~LlL~~D~~Pl~VeW   43 (102)
T PF07711_consen    3 IRCLHVSRDEACLTVAFSRPVNVGSETLLLFVDGSPLTVEW   43 (102)
T ss_dssp             EEEEEEETTTTEEEEEEEEEE-STTB-EEEEESSSEE----
T ss_pred             EEEEEEecccCeEEEEecceeeeeeeeEEEEEcCCceEEEe
Confidence            55677788899999999999999222223232246667777


No 52 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=24.38  E-value=53  Score=25.67  Aligned_cols=18  Identities=22%  Similarity=0.423  Sum_probs=15.3

Q ss_pred             cCCCCccEEEEEcCeecc
Q psy16971        235 TGHVGWGISWYINGLLIP  252 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~P  252 (383)
                      +|.|.+.+.|+.||..++
T Consensus        24 ~g~p~p~v~W~k~g~~~~   41 (85)
T cd05728          24 SGNPRPAYRWLKNGQPLA   41 (85)
T ss_pred             eEeCCCEEEEEECCEECC
Confidence            467888999999999875


No 53 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=24.27  E-value=51  Score=25.62  Aligned_cols=19  Identities=16%  Similarity=0.186  Sum_probs=16.5

Q ss_pred             ccCCCCccEEEEEcCeecc
Q psy16971        234 ITGHVGWGISWYINGLLIP  252 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~P  252 (383)
                      ++|.|-+-|.||-||.+++
T Consensus         7 v~G~P~P~v~W~k~~~~l~   25 (75)
T cd05893           7 VSGVPHPQIFWKKENESLT   25 (75)
T ss_pred             EeEecCCEEEEEECCEECC
Confidence            4689999999999999874


No 54 
>PRK10965 multicopper oxidase; Provisional
Probab=23.80  E-value=77  Score=34.18  Aligned_cols=49  Identities=20%  Similarity=0.298  Sum_probs=32.2

Q ss_pred             cEEEEEcCeecceEEEEeCCeEEEE-EEcCCCCCC-CC--CcCCeEEecCCCCCc
Q psy16971        241 GISWYINGLLIPEINVVRGKTYTFI-VEGGLDPNT-PA--KYHPFYITDDSVGGY  291 (383)
Q Consensus       241 g~awyiN~~l~Pel~v~RG~tYtF~-VegG~dp~~-~~--~yHP~yItd~~~GG~  291 (383)
                      |-..-|||+.-|.+.|+ |.+|.|+ |.+++...- -.  --|+|+|--. .||+
T Consensus       212 gd~~lVNG~~~p~~~v~-~~~~RlRliNas~~r~~~l~~~dg~~~~vIa~-DG~~  264 (523)
T PRK10965        212 GDTLLTNGAIYPQHAAP-RGWLRLRLLNGCNARSLNLATSDGRPLYVIAS-DGGL  264 (523)
T ss_pred             CCeEEECCcccceeecC-CCEEEEEEEeccCCceEEEEEcCCceEEEEEe-CCCc
Confidence            34678999999999886 5699995 456654321 11  1389887665 3555


No 55 
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=23.78  E-value=63  Score=25.94  Aligned_cols=18  Identities=22%  Similarity=0.287  Sum_probs=15.2

Q ss_pred             cCCCCccEEEEEcCeecc
Q psy16971        235 TGHVGWGISWYINGLLIP  252 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~P  252 (383)
                      +|.|.+-|.||.||..++
T Consensus        29 ~g~P~p~i~W~~~g~~l~   46 (94)
T cd05850          29 RASPPATYRWKMNGTEIK   46 (94)
T ss_pred             eeCCCCEEEEEECCEECc
Confidence            467888999999999874


No 56 
>cd02178 GH16_beta_agarase Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant.  This domain adopts a curved  beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
Probab=23.50  E-value=1e+02  Score=29.69  Aligned_cols=11  Identities=45%  Similarity=1.084  Sum_probs=9.7

Q ss_pred             cEEEEEcCeec
Q psy16971        241 GISWYINGLLI  251 (383)
Q Consensus       241 g~awyiN~~l~  251 (383)
                      +|.|||+|+++
T Consensus       193 ~i~fyvDG~~~  203 (258)
T cd02178         193 TIRFYIDGVLV  203 (258)
T ss_pred             eEEEEECCEEE
Confidence            68999999975


No 57 
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=22.78  E-value=1.4e+02  Score=19.99  Aligned_cols=16  Identities=25%  Similarity=0.482  Sum_probs=12.7

Q ss_pred             CCCccEEEEEcCeecc
Q psy16971        237 HVGWGISWYINGLLIP  252 (383)
Q Consensus       237 ~~~~g~awyiN~~l~P  252 (383)
                      .+...+.||-|+..++
T Consensus        14 ~~~~~v~W~~~~~~~~   29 (63)
T smart00408       14 DPVPNITWLKDGKPLP   29 (63)
T ss_pred             CCCCeEEEEECCEECC
Confidence            3556789999998876


No 58 
>PRK10965 multicopper oxidase; Provisional
Probab=22.72  E-value=77  Score=34.21  Aligned_cols=39  Identities=28%  Similarity=0.384  Sum_probs=29.4

Q ss_pred             EEEEEcCee----cceEEEEeCCeEEEEEEcCCCCCCCCCcCCeEEe
Q psy16971        242 ISWYINGLL----IPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYIT  284 (383)
Q Consensus       242 ~awyiN~~l----~Pel~v~RG~tYtF~VegG~dp~~~~~yHP~yIt  284 (383)
                      .+|.|||+.    .|++.|++|.+..+.|..-.+.    .-|||=|-
T Consensus       412 ~~~~ING~~~~~~~~~~~~~~G~~e~w~i~N~~~~----~~Hp~HlH  454 (523)
T PRK10965        412 HANKINGKAFDMNKPMFAAKKGQYERWVISGVGDM----MLHPFHIH  454 (523)
T ss_pred             ccccCCCeECCCCCcceecCCCCEEEEEEEeCCCC----CccCeEEe
Confidence            357999996    5779999999999988654321    23999764


No 59 
>smart00758 PA14 domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins.
Probab=22.61  E-value=1.8e+02  Score=24.48  Aligned_cols=15  Identities=27%  Similarity=0.481  Sum_probs=10.1

Q ss_pred             EEEEeCCeEEEEEEc
Q psy16971        254 INVVRGKTYTFIVEG  268 (383)
Q Consensus       254 l~v~RG~tYtF~Veg  268 (383)
                      |.|+-|+.|.|.|+-
T Consensus        96 v~l~~g~~~~i~v~y  110 (136)
T smart00758       96 LYLLAGGTYPIRIEY  110 (136)
T ss_pred             EEEeCCcEEEEEEEE
Confidence            666667777776654


No 60 
>KOG3954|consensus
Probab=22.15  E-value=61  Score=32.81  Aligned_cols=44  Identities=25%  Similarity=0.215  Sum_probs=29.9

Q ss_pred             CCCcEEEEeecCCCC-CCCCccccEEEEEEeCC-CCceEEEEeeee
Q psy16971          2 EFGEYMSFGLSGDPL-RNQMIGADVVVAWIDQE-TLNGYAVDYYLT   45 (383)
Q Consensus         2 ~e~~YmAFG~S~~~~-~~~M~GADVVVa~vD~~-~G~~~a~Dyyit   45 (383)
                      ..+-|||+|+||.-. -.+|..+-|+||--.+. .--..+.||=|.
T Consensus       274 APeLYiAvGisGAIQHLAGmKDSKvIvAINkDpdAPIFqvAD~Glv  319 (336)
T KOG3954|consen  274 APELYIAVGISGAIQHLAGMKDSKVIVAINKDPDAPIFQVADYGLV  319 (336)
T ss_pred             ccceEEEEeccHHHHHhhcCccceEEEEecCCCCCCceeeecccch
Confidence            346799999998753 37899999999864332 223445565443


No 61 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=22.05  E-value=57  Score=26.97  Aligned_cols=19  Identities=16%  Similarity=0.135  Sum_probs=16.1

Q ss_pred             cCCCCccEEEEEcCeecce
Q psy16971        235 TGHVGWGISWYINGLLIPE  253 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~Pe  253 (383)
                      .|.|.+.+.||-||+.+++
T Consensus        28 ~g~P~P~v~W~kdg~~l~~   46 (101)
T cd05859          28 EAYPPPQIRWLKDNRTLIE   46 (101)
T ss_pred             EEeCCCceEEEECCEECcC
Confidence            4788889999999998763


No 62 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=21.88  E-value=64  Score=25.27  Aligned_cols=20  Identities=20%  Similarity=0.393  Sum_probs=17.3

Q ss_pred             ccCCCCccEEEEEcCeecce
Q psy16971        234 ITGHVGWGISWYINGLLIPE  253 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~Pe  253 (383)
                      ++|+|.+.+.||=||..+++
T Consensus         7 v~g~P~P~v~W~kdg~~l~~   26 (72)
T cd07702           7 VKAFPAPEVIWLKDGLPAAE   26 (72)
T ss_pred             EEEcCCCeEEEEECCEECCC
Confidence            56899999999999998765


No 63 
>PF12000 Glyco_trans_4_3:  Gkycosyl transferase family 4 group;  InterPro: IPR022623  This presumed domain is functionally uncharacterised and found in bacteria. This region is about 170 amino acids in length and is found N-terminal to PF00534 from PFAM. There is a single completely conserved residue G that may be functionally important. 
Probab=21.75  E-value=36  Score=31.56  Aligned_cols=36  Identities=19%  Similarity=0.562  Sum_probs=26.0

Q ss_pred             ccCCCCccEEEEEcCeecceEEEEeCCeEEEEEEcCC
Q psy16971        234 ITGHVGWGISWYINGLLIPEINVVRGKTYTFIVEGGL  270 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~Pel~v~RG~tYtF~VegG~  270 (383)
                      |-||+|||-++++.+.. |+..+-==--|=|.-+|++
T Consensus        70 I~~H~GWGe~Lflkdv~-P~a~li~Y~E~~y~~~g~d  105 (171)
T PF12000_consen   70 IIAHPGWGETLFLKDVF-PDAPLIGYFEFYYRASGAD  105 (171)
T ss_pred             EEEcCCcchhhhHHHhC-CCCcEEEEEEEEecCCCCc
Confidence            67999999999999987 6655543344555666655


No 64 
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=21.56  E-value=74  Score=23.95  Aligned_cols=17  Identities=35%  Similarity=0.472  Sum_probs=14.3

Q ss_pred             ccCCCCccEEEEEcCee
Q psy16971        234 ITGHVGWGISWYINGLL  250 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l  250 (383)
                      .+|.|.+.+.||-||..
T Consensus         7 ~~G~P~P~v~W~k~~~~   23 (75)
T cd05763           7 ATGHPTPQIAWQKDGGT   23 (75)
T ss_pred             cccccCCEEEEEeCCCc
Confidence            46889999999999863


No 65 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=20.90  E-value=80  Score=26.20  Aligned_cols=18  Identities=22%  Similarity=0.388  Sum_probs=15.6

Q ss_pred             cCCCCccEEEEEcCeecc
Q psy16971        235 TGHVGWGISWYINGLLIP  252 (383)
Q Consensus       235 Tg~~~~g~awyiN~~l~P  252 (383)
                      .|.|.+-+.|+.||.+++
T Consensus        33 ~G~P~p~i~W~k~g~~l~   50 (109)
T cd05773          33 QGVPRVQFRWAKNGVPLD   50 (109)
T ss_pred             cccCCCEEEEEECCEECC
Confidence            478889999999999874


No 66 
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=20.59  E-value=76  Score=23.89  Aligned_cols=18  Identities=28%  Similarity=0.388  Sum_probs=15.3

Q ss_pred             ccCCCCccEEEEEcCeec
Q psy16971        234 ITGHVGWGISWYINGLLI  251 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~  251 (383)
                      .+|.|.+.+.||-||+.+
T Consensus         7 v~g~P~p~v~W~k~~~~l   24 (76)
T cd05736           7 AEGIPLPRLTWLKNGMDI   24 (76)
T ss_pred             eeecCCCEEEEEECCEEC
Confidence            357899999999999875


No 67 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=20.51  E-value=1.9e+02  Score=22.30  Aligned_cols=18  Identities=22%  Similarity=0.340  Sum_probs=15.3

Q ss_pred             ccCCCCccEEEEEcCeec
Q psy16971        234 ITGHVGWGISWYINGLLI  251 (383)
Q Consensus       234 iTg~~~~g~awyiN~~l~  251 (383)
                      ..|.|.+.+.||-||..+
T Consensus         7 ~~G~P~P~v~W~k~g~~~   24 (77)
T cd05875           7 AKGNPVPTFQWTRNGKFF   24 (77)
T ss_pred             ccccCCCEEEEEECCEEc
Confidence            358899999999999865


No 68 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=20.31  E-value=2.5e+02  Score=20.83  Aligned_cols=17  Identities=24%  Similarity=0.419  Sum_probs=13.1

Q ss_pred             CCCCccEEEEEcCeecc
Q psy16971        236 GHVGWGISWYINGLLIP  252 (383)
Q Consensus       236 g~~~~g~awyiN~~l~P  252 (383)
                      |.|...+.||-||..+.
T Consensus        20 ~~p~~~v~W~k~~~~~~   36 (85)
T cd05729          20 GNPRPTITWLKDGKPFK   36 (85)
T ss_pred             CCCCCeEEEEECCEECc
Confidence            45677899999988753


No 69 
>PF12480 DUF3699:  Protein of unknown function (DUF3699) ;  InterPro: IPR022168  This domain family is found in eukaryotes, and is approximately 80 amino acids in length. 
Probab=20.16  E-value=87  Score=25.46  Aligned_cols=29  Identities=28%  Similarity=0.471  Sum_probs=26.2

Q ss_pred             ccceeeeecCCCCeeEEEcCCCCCCCeeE
Q psy16971        346 QRTLSLICDHGEPGVIQWTPDANTPDTVY  374 (383)
Q Consensus       346 ~rtL~l~C~~g~p~~l~wtp~~~tPd~vY  374 (383)
                      +++|+++|-.|-+-.|.-+++.+.|++++
T Consensus        26 ~~~l~lk~~t~r~~yl~L~~~~~~~~~~F   54 (77)
T PF12480_consen   26 KQQLKLKLVTGRPFYLQLCAPADKPETLF   54 (77)
T ss_pred             ccEEEEEEccCCEEEEEEeCcccCcchhH
Confidence            57899999999999999999999998864


Done!