Diaphorina citri psyllid: psy16971

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380---
MEFGEYMSFGLSGDPLRNQMIGADVVVAWIDQETLNGYAVDYYLTDKSQCAGGRGSCPDYRIQDNTESVRLLNAALVNGYSIVTYQRPLRSHDILDHDIYTNQSQAIIWAIGPLNSKQEVSFHSVFPKKNILFNFGRTPYWNCPIPEGETGTPNHGEYSDESSGANTKVQEVLGYWVIVSVAVEPARSKSPPTPAPAPRDEAWEIPPIQCNEPDDGVLYAQMGPTGGKRGYPAITGHVGWGISWYINGLLIPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITDDSVGGYQHKTPEEKEKVRIFAGAKRDKFGNVVPTGVGRLCNWTPDPEQPPADEFVSFGAYQRTLSLICDHGEPGVIQWTPDANTPDTVYYQTPEPSKF
cccccEEEEEEcccccccccccccEEEEEEEcccccEEEEEEEcccccccccccccccccccccccccEEEEEEEEEccEEEEEEEccccccccccccccccccEEEEEEccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccEEEEcccEEEEEcccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccCCccEEEEEEccEEEEEEEcccccccccccccEEEEccccccccccccccccEEEEEEccccccccccCCcccccccccccccccccccccccHHHHcccEEEECcccccEEEEEccccccccEEEEcccccccc
*EFGEYMSFGLSGDPLRNQMIGADVVVAWIDQETLNGYAVDYYLTDKSQCAGGRGSCPDYRIQDNTESVRLLNAALVNGYSIVTYQRPLRSHDILDHDIYTNQSQAIIWAIGPLNSKQEVSFHSVFPKKNILFNFGRTPYWNCPIPEGE*GTPNHGEYSDESSGANTKVQEVLGYWVIVSVAV*****KSPPTPAPAPRDEAWEIPPIQCNEPDDGVLYAQMGPTGGKRGYPAITGHVGWGISWYINGLLIPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITDDSVGGYQHKTPEEKEKVRIFAGAKRDKFGNVVPTGVGRLCNWTPDPEQPPADEFVSFGAYQRTLSLICDHGEPGVIQWTPDANTPDTVYYQTP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFGEYMSFGLSGDPLRNQMIGADVVVAWIDQETLNGYAVDYYLTDKSQCAGGRGSCPDYRIQDNTESVRLLNAALVNGYSIVTYQRPLRSHDILDHDIYTNQSQAIIWAIGPLNSKQEVSFHSVFPKKNILFNFGRTPYWNCPIPEGETGTPNHGEYSDESSGANTKVQEVLGYWVIVSVAVEPARSKSPPTPAPAPRDEAWEIPPIQCNEPDDGVLYAQMGPTGGKRGYPAITGHVGWGISWYINGLLIPEINVVRGKTYTFIVEGGLDPNTPAKYHPFYITDDSVGGYQHKTPEEKEKVRIFAGAKRDKFGNVVPTGVGRLCNWTPDPEQPPADEFVSFGAYQRTLSLICDHGEPGVIQWTPDANTPDTVYYQTPEPSKF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein Skeletor, isoforms B/C Provides structural support to stabilize and organize the microtubule spindle during mitosis (within embryonic somatic cells) and meiosis (within spermatocytes). The role in mitosis regulation depends on the Ran pathway.confidentQ9VGY6
Protein Skeletor, isoforms D/E Provides structural support to stabilize and organize the microtubule spindle during mitosis (within embryonic somatic cells) and meiosis (within spermatocytes). The role in mitosis regulation depends on the Ran pathway.confidentQ9GPJ1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005198 [MF]structural molecule activityprobableGO:0003674
GO:0016363 [CC]nuclear matrixprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0005652 [CC]nuclear laminaprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051225 [BP]spindle assemblyprobableGO:0006996, GO:0022607, GO:0007010, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0044763, GO:0016043, GO:0065003, GO:0007051, GO:0044085, GO:0000226, GO:0044699, GO:0008150, GO:0022402, GO:0009987, GO:0070925, GO:0007049, GO:0007017
GO:0006584 [BP]catecholamine metabolic processprobableGO:0009987, GO:1901564, GO:0009712, GO:0006725, GO:0044237, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0018958, GO:1901360, GO:1901615
GO:0004500 [MF]dopamine beta-monooxygenase activityprobableGO:0004497, GO:0016715, GO:0016705, GO:0003824, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D7B, chain A
Confidence level:confident
Coverage over the Query: 3-138
View the alignment between query and template
View the model in PyMOL