Query         psy1698
Match_columns 258
No_of_seqs    19 out of 21
Neff          3.4 
Searched_HMMs 29240
Date          Fri Aug 16 18:37:47 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1698.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/1698hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2nzc_A Hypothetical protein; s   2.7 3.3E+02   0.011   20.6   0.1   13  241-253    37-49  (86)
  2 2wzp_R Lactococcal phage P2 OR   2.2   5E+02   0.017   23.6   0.5   19    2-25    279-297 (375)
  3 1jgn_B PAIP2, polyadenylate-bi   1.5 1.9E+03   0.063   13.3   2.3   14   67-80      8-21  (26)
  4 3ro2_B Peptide of nuclear mito   1.4 1.2E+03    0.04   14.4   1.1    8    1-8       6-13  (28)
  5 2wpv_B Ubiquitin-like protein    1.2 1.2E+03    0.04   16.8   0.9   10    4-13     42-51  (59)
  6 3lri_A Protein (insulin-like g   1.1 1.1E+03   0.036   17.8   0.4    9  250-258    54-66  (83)
  7 3bbn_M Ribosomal protein S13;    1.0 1.7E+03   0.058   18.2   1.3   30  220-249   104-133 (145)
  8 3bod_A Neurexin-1-alpha; neure   0.9 1.3E+03   0.044   17.8   0.4    7  251-257   141-147 (178)
  9 1zko_A Glycine cleavage system   0.9 1.2E+03   0.042   18.3   0.3   12   16-27     11-22  (136)
 10 1rh7_A Relmbeta, resistin-like   0.9 1.2E+03   0.041   17.7   0.1    9  250-258    39-47  (81)

No 1  
>2nzc_A Hypothetical protein; sturctural genomics, TM1266, structural genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.95A {Thermotoga maritima} SCOP: d.58.18.14
Probab=2.72  E-value=3.3e+02  Score=20.60  Aligned_cols=13  Identities=38%  Similarity=0.861  Sum_probs=10.2

Q ss_pred             cccCCccccccee
Q psy1698         241 LRMGLPARRRGIT  253 (258)
Q Consensus       241 ~r~~~~~~~~~~~  253 (258)
                      -|||+|-+.+++-
T Consensus        37 gRmGiP~~~~~~~   49 (86)
T 2nzc_A           37 LRVGYPVREENMA   49 (86)
T ss_dssp             EEEEEEEGGGTEE
T ss_pred             EEcCCCcCcCCce
Confidence            4899998887764


No 2  
>2wzp_R Lactococcal phage P2 ORF16; baseplate, viral protein; 2.60A {Lactococcus phage P2} PDB: 2x53_Y 2x54_Y 2x5a_Y
Probab=2.17  E-value=5e+02  Score=23.65  Aligned_cols=19  Identities=47%  Similarity=0.718  Sum_probs=14.5

Q ss_pred             CCCCCCCceeccCCCCCCcccccC
Q psy1698           2 GSGQDLPTLRTGSGQGLPTLRTGS   25 (258)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~tlr~~~   25 (258)
                      |.|.|||.+|+.+     ||-|..
T Consensus       279 gdgtdlpdvrtak-----tlfydr  297 (375)
T 2wzp_R          279 GDGTDLPDVRTAK-----TLFYDR  297 (375)
T ss_dssp             SCSTTSCSSCCEE-----EEEECC
T ss_pred             CCCCCCccceehh-----heeecc
Confidence            7899999999864     566644


No 3  
>1jgn_B PAIP2, polyadenylate-binding protein-interacting protein 2; all-helical domain, protein-peptide complex, RNA binding protein; NMR {Homo sapiens}
Probab=1.46  E-value=1.9e+03  Score=13.26  Aligned_cols=14  Identities=14%  Similarity=0.368  Sum_probs=5.9

Q ss_pred             CCCCCCCCCccCCC
Q psy1698          67 TGSGQGLPTLRTGS   80 (258)
Q Consensus        67 ~~s~~~~~tlR~g~   80 (258)
                      |.-++-+|-++||+
T Consensus         8 p~akef~pgvkygn   21 (26)
T 1jgn_B            8 PNAKEFVPGVKYGN   21 (26)
T ss_dssp             TTCCCCCTTSCTTC
T ss_pred             cchhhcCCCceecc
Confidence            33344444444443


No 4  
>3ro2_B Peptide of nuclear mitotic apparatus protein 1; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Homo sapiens}
Probab=1.45  E-value=1.2e+03  Score=14.42  Aligned_cols=8  Identities=63%  Similarity=0.941  Sum_probs=4.2

Q ss_pred             CCCCCCCC
Q psy1698           1 MGSGQDLP    8 (258)
Q Consensus         1 ~~~~~~~~    8 (258)
                      ||.-||-|
T Consensus         6 mgtcqdep   13 (28)
T 3ro2_B            6 MGTCQDEP   13 (28)
T ss_dssp             CCSCCCCC
T ss_pred             eccccCCc
Confidence            45555554


No 5  
>2wpv_B Ubiquitin-like protein MDY2; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_B
Probab=1.24  E-value=1.2e+03  Score=16.78  Aligned_cols=10  Identities=50%  Similarity=0.740  Sum_probs=6.0

Q ss_pred             CCCCCceecc
Q psy1698           4 GQDLPTLRTG   13 (258)
Q Consensus         4 ~~~~~~~~~~   13 (258)
                      |--||.|+|-
T Consensus        42 gVaLppLkYK   51 (59)
T 2wpv_B           42 GVPLPTLKYK   51 (59)
T ss_dssp             CSCCCCCSSC
T ss_pred             cccccccccc
Confidence            5556666664


No 6  
>3lri_A Protein (insulin-like growth factor I); protein structure, distance geometry; NMR {Homo sapiens} SCOP: g.1.1.1
Probab=1.11  E-value=1.1e+03  Score=17.77  Aligned_cols=9  Identities=44%  Similarity=1.077  Sum_probs=5.9

Q ss_pred             ccee----eeccC
Q psy1698         250 RGIT----FTGCT  258 (258)
Q Consensus       250 ~~~~----~~~~~  258 (258)
                      |||.    |-.|+
T Consensus        54 rGIVdECC~~~Cs   66 (83)
T 3lri_A           54 TGIVDECCFRSCD   66 (83)
T ss_dssp             TCTTHHHHHTTCC
T ss_pred             CCchHHhCCCCCC
Confidence            6887    55554


No 7  
>3bbn_M Ribosomal protein S13; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}
Probab=0.98  E-value=1.7e+03  Score=18.22  Aligned_cols=30  Identities=17%  Similarity=0.151  Sum_probs=23.2

Q ss_pred             ccCcccccCCccCCCccCCCccccCCcccc
Q psy1698         220 RMGSEQDLSTLRTGSEQDLPTLRMGLPARR  249 (258)
Q Consensus       220 R~~~e~~~~tLr~~~eh~~~t~r~~~~~~~  249 (258)
                      |.+..+|++-|+.-..++-=--+.|+|.|-
T Consensus       104 Rr~v~~nIkRL~~I~~YRGlRH~~GLPVRG  133 (145)
T 3bbn_M          104 KRFNRVAIERLKEIRCYRGIRHKLGLPVRG  133 (145)
T ss_dssp             CCCCSTTTHHHHCCCCSCCTTTTTTCCSSS
T ss_pred             HHHHHHHHHHHhhhceEeeeecccCCcCCC
Confidence            566677888888777777777788999874


No 8  
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A*
Probab=0.94  E-value=1.3e+03  Score=17.81  Aligned_cols=7  Identities=43%  Similarity=0.762  Sum_probs=5.4

Q ss_pred             ceeeecc
Q psy1698         251 GITFTGC  257 (258)
Q Consensus       251 ~~~~~~~  257 (258)
                      +.-|.||
T Consensus       141 ~~~F~GC  147 (178)
T 3bod_A          141 GQPFQGQ  147 (178)
T ss_dssp             SCBCCEE
T ss_pred             CCCCEEE
Confidence            4669999


No 9  
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A
Probab=0.94  E-value=1.2e+03  Score=18.34  Aligned_cols=12  Identities=8%  Similarity=0.041  Sum_probs=5.8

Q ss_pred             CCCCcccccCCc
Q psy1698          16 QGLPTLRTGSEQ   27 (258)
Q Consensus        16 ~~~~tlr~~~~~   27 (258)
                      |-|..|+|+++|
T Consensus        11 ~~~~~~~yt~~H   22 (136)
T 1zko_A           11 HHLKMKKYTKTH   22 (136)
T ss_dssp             CCCEEEEECTTS
T ss_pred             cccccceeCCCC
Confidence            344445555554


No 10 
>1rh7_A Relmbeta, resistin-like beta; hormone, glucose uptake, resistin/FIZZ family, structural genomics, PSI, protein structure initiative; HET: P6G; 3.11A {Mus musculus} SCOP: g.77.1.1
Probab=0.92  E-value=1.2e+03  Score=17.68  Aligned_cols=9  Identities=44%  Similarity=1.102  Sum_probs=0.0

Q ss_pred             cceeeeccC
Q psy1698         250 RGITFTGCT  258 (258)
Q Consensus       250 ~~~~~~~~~  258 (258)
                      .|+..|||+
T Consensus        39 ~G~~vtgCa   47 (81)
T 1rh7_A           39 AGMVVTGCA   47 (81)
T ss_dssp             TTCEEEEEE
T ss_pred             CccEeeecc


Done!