Diaphorina citri psyllid: psy16995


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MNFWGRLDSLWFAVTDLFLTNLFYYPKQVALMDKYFKYPGYQSRPPMVDMLRNISMTFLEHDISIGVPQALTPNMLFTGGMHIKHAKPLPPDLDKYMSDAPHGVIFFSFGTNVRFANMPPYVLNAFVESFSKIKQKILWKTDVEVEVPPNVLVRNWFPQADILET
ccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccHHHHHcccEEEEEcccccccccccccccEEEEccccccccccccHHHHHHHHccccCEEEEEcccccccccccHHHHHHHHHHHHccccEEEEEccccccccccEEEEccccccHHccc
MNFWGRLDSLWFAVTDLFLTNLFYYPKQVALMDKYFKYPGYQSRPPMVDMLRNISMTFLEHDISIGVPQALTPNMLFTGGMHIKHAKPLPPDLDKYMSDAPHGVIFFSFGTNVRFANMPPYVLNAFVESFSKIKQKILWKTDVEVEVPPNVLVRNWFPQADILE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFWGRLDSLWFAVTDLFLTNLFYYPKQVALMDKYFKYPGYQSRPPMVDMLRNISMTFLEHDISIGVPQALTPNMLFTGGMHIKHAKPLPPDLDKYMSDAPHGVIFFSFGTNVRFANMPPYVLNAFVESFSKIKQKILWKTDVEVEVPPNVLVRNWFPQADILET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001972 [MF]retinoic acid bindingprobableGO:0043168, GO:0031406, GO:0019840, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0033293, GO:0005501
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006805 [BP]xenobiotic metabolic processprobableGO:0051716, GO:0008152, GO:0050896, GO:0009987, GO:0044763, GO:0009410, GO:0044237, GO:0071466, GO:0008150, GO:0070887, GO:0042221, GO:0044699
GO:0052695 [BP]cellular glucuronidationprobableGO:0019585, GO:0044238, GO:0044710, GO:0005975, GO:0006082, GO:0005996, GO:0009987, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0006063, GO:0008152, GO:0044723, GO:0043436, GO:0044237, GO:0044281
GO:0051552 [BP]flavone metabolic processprobableGO:0044710, GO:0042440, GO:0009812, GO:0071704, GO:0008150, GO:0008152
GO:0015020 [MF]glucuronosyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008194
GO:0065007 [BP]biological regulationprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O6L, chain A
Confidence level:very confident
Coverage over the Query: 86-165
View the alignment between query and template
View the model in PyMOL
Template: 1IIR, chain A
Confidence level:confident
Coverage over the Query: 26-164
View the alignment between query and template
View the model in PyMOL