Diaphorina citri psyllid: psy16


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MMVDFTNNLMCWETLTGFKWMGTKTYDLEQEGKHVLLAFEEAIGFMDGTHVLDKDGVTAAVRMAELVAYLDSQGKDLHQLLADVYDK
cccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcc
**VDFTNNLMCWETLTGFKWMGTKTYDLEQEGKHVLLAFEEAIGFMDGTHVLDKDGVTAAVRMAELVAYLDSQGKDLHQLLADVYD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVDFTNNLMCWETLTGFKWMGTKTYDLEQEGKHVLLAFEEAIGFMDGTHVLDKDGVTAAVRMAELVAYLDSQGKDLHQLLADVYDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucose 1,6-bisphosphate synthase Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. Also synthesizes ribose 1,5-bisphosphate. Has only low phosphopentomutase and phosphoglucomutase activities.confidentQ6PCE3
Glucose 1,6-bisphosphate synthase Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. Also synthesizes ribose 1,5-bisphosphate. Has only low phosphopentomutase and phosphoglucomutase activities.confidentQ5R979
Glucose 1,6-bisphosphate synthase Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. Also synthesizes ribose 1,5-bisphosphate. Has only low phosphopentomutase and phosphoglucomutase activities.confidentQ8CAA7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0047933 [MF]glucose-1,6-bisphosphate synthase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0006006 [BP]glucose metabolic processprobableGO:0044238, GO:0005975, GO:0005996, GO:0019318, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0008973 [MF]phosphopentomutase activityprobableGO:0016866, GO:0003824, GO:0003674, GO:0016853, GO:0016868

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KFI, chain A
Confidence level:very confident
Coverage over the Query: 3-86
View the alignment between query and template
View the model in PyMOL