BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy17024
(132 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3PGW|Z Chain Z, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|W Chain W, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
Length = 126
Score = 146 bits (368), Expect = 4e-36, Method: Compositional matrix adjust.
Identities = 61/83 (73%), Positives = 75/83 (90%)
Query: 1 MSIGIPIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGKVKPMAN 60
MSIG+PIK+LHEAEGHI+TCET G+++RGKL+EAEDNMNC M+++TVT+RDG+V +
Sbjct: 1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQ 60
Query: 61 IYIRGSKIRFLILPDMLKNAPMF 83
+YIRGSKIRFLILPDMLKNAPM
Sbjct: 61 VYIRGSKIRFLILPDMLKNAPML 83
>pdb|3CW1|D Chain D, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|S Chain S, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|T Chain T, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|U Chain U, Crystal Structure Of Human Spliceosomal U1 Snrnp
Length = 126
Score = 144 bits (362), Expect = 2e-35, Method: Compositional matrix adjust.
Identities = 60/83 (72%), Positives = 74/83 (89%)
Query: 1 MSIGIPIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGKVKPMAN 60
MSIG+PIK+LHEAEGHI+TCET G+++RGKL+EAEDNMNC M+++TVT+RDG+V +
Sbjct: 1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQ 60
Query: 61 IYIRGSKIRFLILPDMLKNAPMF 83
+YIRG KIRFLILPDMLKNAPM
Sbjct: 61 VYIRGCKIRFLILPDMLKNAPML 83
>pdb|1D3B|A Chain A, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|C Chain C, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|E Chain E, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|G Chain G, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|I Chain I, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|K Chain K, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
Length = 75
Score = 127 bits (320), Expect = 1e-30, Method: Compositional matrix adjust.
Identities = 53/75 (70%), Positives = 67/75 (89%)
Query: 1 MSIGIPIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGKVKPMAN 60
MSIG+PIK+LHEAEGHI+TCET G+++RGKL+EAEDNMNC M+++TVT+RDG+V +
Sbjct: 1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQ 60
Query: 61 IYIRGSKIRFLILPD 75
+YIRG KIRFLILPD
Sbjct: 61 VYIRGCKIRFLILPD 75
>pdb|4EMH|A Chain A, Crystal Structure Of Splsm4
pdb|4EMH|B Chain B, Crystal Structure Of Splsm4
pdb|4EMH|C Chain C, Crystal Structure Of Splsm4
pdb|4EMH|D Chain D, Crystal Structure Of Splsm4
pdb|4EMH|E Chain E, Crystal Structure Of Splsm4
pdb|4EMH|F Chain F, Crystal Structure Of Splsm4
pdb|4EMH|G Chain G, Crystal Structure Of Splsm4
pdb|4EMH|H Chain H, Crystal Structure Of Splsm4
pdb|4EMH|I Chain I, Crystal Structure Of Splsm4
pdb|4EMH|J Chain J, Crystal Structure Of Splsm4
pdb|4EMH|K Chain K, Crystal Structure Of Splsm4
pdb|4EMH|L Chain L, Crystal Structure Of Splsm4
pdb|4EMH|M Chain M, Crystal Structure Of Splsm4
pdb|4EMH|N Chain N, Crystal Structure Of Splsm4
pdb|4EMH|O Chain O, Crystal Structure Of Splsm4
pdb|4EMH|P Chain P, Crystal Structure Of Splsm4
pdb|4EMH|Q Chain Q, Crystal Structure Of Splsm4
pdb|4EMH|R Chain R, Crystal Structure Of Splsm4
pdb|4EMH|T Chain T, Crystal Structure Of Splsm4
pdb|4EMH|U Chain U, Crystal Structure Of Splsm4
pdb|4EMH|V Chain V, Crystal Structure Of Splsm4
pdb|4EMH|W Chain W, Crystal Structure Of Splsm4
pdb|4EMH|X Chain X, Crystal Structure Of Splsm4
pdb|4EMH|Y Chain Y, Crystal Structure Of Splsm4
Length = 105
Score = 43.5 bits (101), Expect = 3e-05, Method: Compositional matrix adjust.
Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
Query: 5 IPIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDG-KVKPMANIYI 63
+P+ LL+ +G I E NG+ F G L ++ N + +V T DG K + YI
Sbjct: 16 LPLTLLNATQGRPILVELKNGETFNGHLENCDNYXNLTLREVIRTXPDGDKFFRLPECYI 75
Query: 64 RGSKIRFLILPD 75
RG+ I++L + D
Sbjct: 76 RGNNIKYLRIQD 87
>pdb|1B34|A Chain A, Crystal Structure Of The D1d2 Sub-Complex From The Human
Snrnp Core Domain
pdb|3CW1|B Chain B, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|M Chain M, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|N Chain N, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|O Chain O, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|X Chain X, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|U Chain U, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|A Chain A, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|A Chain A, Macromolecular Machine 6
pdb|4F7U|C Chain C, Macromolecular Machine 6
pdb|1VU2|A Chain A, The 8s Snrnp Assembly Intermediate
pdb|1VU2|I Chain I, The 8s Snrnp Assembly Intermediate
pdb|1VU2|Q Chain Q, The 8s Snrnp Assembly Intermediate
pdb|1VU2|Y Chain Y, The 8s Snrnp Assembly Intermediate
pdb|1VU2|GG Chain g, The 8s Snrnp Assembly Intermediate
pdb|1VU2|OO Chain o, The 8s Snrnp Assembly Intermediate
pdb|1VU2|WW Chain w, The 8s Snrnp Assembly Intermediate
pdb|1VU3|A Chain A, The 8s Snrnp Assembly Intermediate
pdb|1VU3|I Chain I, The 8s Snrnp Assembly Intermediate
pdb|1VU3|Q Chain Q, The 8s Snrnp Assembly Intermediate
pdb|1VU3|Y Chain Y, The 8s Snrnp Assembly Intermediate
pdb|1VU3|GG Chain g, The 8s Snrnp Assembly Intermediate
pdb|1VU3|OO Chain o, The 8s Snrnp Assembly Intermediate
pdb|4F77|I Chain I, The 8s Snrnp Assembly Intermediate
pdb|4F77|A Chain A, The 8s Snrnp Assembly Intermediate
pdb|4F77|Q Chain Q, The 8s Snrnp Assembly Intermediate
pdb|4F77|Y Chain Y, The 8s Snrnp Assembly Intermediate
pdb|4F77|GG Chain g, The 8s Snrnp Assembly Intermediate
pdb|4F77|OO Chain o, The 8s Snrnp Assembly Intermediate
pdb|4F77|WW Chain w, The 8s Snrnp Assembly Intermediate
Length = 119
Score = 42.0 bits (97), Expect = 1e-04, Method: Compositional matrix adjust.
Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
Query: 7 IKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGKVKPMANIYIRGS 66
+KL HE +T E NG G + + +MN + V +T ++ + + + IRG+
Sbjct: 8 MKLSHET----VTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGN 63
Query: 67 KIRFLILPDML 77
IR+ ILPD L
Sbjct: 64 NIRYFILPDSL 74
>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
Length = 81
Score = 30.4 bits (67), Expect = 0.29, Method: Compositional matrix adjust.
Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
Query: 8 KLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGKVKPMANIYIRGSK 67
K+L E+ +++ + RG L + +MN ++D DG K + I IRG
Sbjct: 12 KVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTIVIRGDN 71
Query: 68 IRFLILP 74
+ LI P
Sbjct: 72 V-ILISP 77
>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
Length = 75
Score = 30.0 bits (66), Expect = 0.40, Method: Compositional matrix adjust.
Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
Query: 6 PIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGK-VKPMANIYIR 64
P+ ++H + + G FRG+L+ + ++N +AD + +DG+ VK I IR
Sbjct: 5 PLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEM-IQDGEVVKRYGKIVIR 63
Query: 65 GSKI 68
G +
Sbjct: 64 GDNV 67
>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
Length = 77
Score = 29.6 bits (65), Expect = 0.45, Method: Compositional matrix adjust.
Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
Query: 6 PIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGK-VKPMANIYIR 64
P+ ++H + + G FRG+L+ + ++N +AD + +DG+ VK I IR
Sbjct: 7 PLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEM-IQDGEVVKRYGKIVIR 65
Query: 65 GSKI 68
G +
Sbjct: 66 GDNV 69
>pdb|3AIX|B Chain B, Crystal Structure Of Pcna2-Pcna3 Complex From Sulfolobus
Tokodaii (I222)
pdb|3AIZ|A Chain A, Crystal Structure Of Pcna2-Pcna3 Complex From Sulfolobus
Tokodaii (P21212)
pdb|3AIZ|B Chain B, Crystal Structure Of Pcna2-Pcna3 Complex From Sulfolobus
Tokodaii (P21212)
Length = 248
Score = 26.6 bits (57), Expect = 4.3, Method: Compositional matrix adjust.
Identities = 12/24 (50%), Positives = 15/24 (62%)
Query: 44 ADVTVTFRDGKVKPMANIYIRGSK 67
A + VT RD K +NIYI+G K
Sbjct: 96 AGLKVTVRDEKTGTRSNIYIKGEK 119
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human
Plasminogen
pdb|4DUR|B Chain B, The X-Ray Crystal Structure Of Full-Length Type Ii Human
Plasminogen
pdb|4DUU|A Chain A, The X-Ray Crystal Structure Of Full-Length Type I Human
Plasminogen
pdb|4A5T|S Chain S, Structural Basis For The Conformational Modulation
Length = 791
Score = 25.8 bits (55), Expect = 7.4, Method: Composition-based stats.
Identities = 9/33 (27%), Positives = 20/33 (60%)
Query: 9 LLHEAEGHIITCETTNGDLFRGKLVEAEDNMNC 41
+L E + ++ C+T NG +RG + + ++ + C
Sbjct: 73 VLFEKKVYLSECKTGNGKNYRGTMSKTKNGITC 105
>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From
Archaeoglobus Fulgidus At 1.95a Resolution
Length = 77
Score = 25.4 bits (54), Expect = 9.0, Method: Compositional matrix adjust.
Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 2/72 (2%)
Query: 5 IPIKLLHEAEGHIITCETTNGD-LFRGKLVEAEDNMNCAMADVTVTFRDGKVKPMANIYI 63
+P +++ G II E + GKL +D MN + + + KV+ + I +
Sbjct: 5 LPNQMVKSMVGKIIRVEMKGEENQLVGKLEGVDDYMNLYLTNAMECKGEEKVRSLGEIVL 64
Query: 64 RGSKIRFLILPD 75
RG+ + LI P
Sbjct: 65 RGNNV-VLIQPQ 75
>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
Length = 77
Score = 25.4 bits (54), Expect = 9.0, Method: Compositional matrix adjust.
Identities = 15/66 (22%), Positives = 29/66 (43%)
Query: 6 PIKLLHEAEGHIITCETTNGDLFRGKLVEAEDNMNCAMADVTVTFRDGKVKPMANIYIRG 65
P+ +L+ + + G FRG L + +MN + D V+ + ++ IRG
Sbjct: 5 PLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRG 64
Query: 66 SKIRFL 71
+ F+
Sbjct: 65 DTVVFV 70
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.140 0.408
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,453,661
Number of Sequences: 62578
Number of extensions: 80888
Number of successful extensions: 251
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 238
Number of HSP's gapped (non-prelim): 14
length of query: 132
length of database: 14,973,337
effective HSP length: 88
effective length of query: 44
effective length of database: 9,466,473
effective search space: 416524812
effective search space used: 416524812
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 46 (22.3 bits)