Query         psy17035
Match_columns 60
No_of_seqs    111 out of 1130
Neff          10.0
Searched_HMMs 46136
Date          Fri Aug 16 20:09:06 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17035.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17035hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PHA03234 DNA packaging protein  99.6 1.1E-16 2.3E-21   90.8   0.5   59    2-60    245-309 (338)
  2 PHA03235 DNA packaging protein  99.5 4.7E-15   1E-19   85.9   0.5   59    2-60    252-316 (409)
  3 PHA02834 chemokine receptor-li  99.5 5.1E-15 1.1E-19   83.3   0.2   59    2-60    237-302 (323)
  4 PHA02638 CC chemokine receptor  99.5 1.1E-14 2.3E-19   84.6   0.5   59    2-60    321-390 (417)
  5 KOG4219|consensus               99.5 9.3E-15   2E-19   84.2   0.0   58    2-59    269-327 (423)
  6 PHA03087 G protein-coupled che  99.2 1.3E-12 2.8E-17   73.6   0.5   59    2-60    252-316 (335)
  7 KOG4220|consensus               99.2 2.9E-13 6.2E-18   78.7  -4.0   55    2-59    425-479 (503)
  8 PF00001 7tm_1:  7 transmembran  98.8 1.8E-09   4E-14   57.5   1.9   48    2-50    210-257 (257)
  9 KOG2087|consensus               97.8 2.7E-07   6E-12   53.2  -4.8   54    4-59    245-298 (363)
 10 PF10324 7TM_GPCR_Srw:  Serpent  97.3 9.6E-05 2.1E-09   41.7   1.0   58    2-59    250-309 (318)
 11 PF11970 Git3_C:  G protein-cou  96.1  0.0035 7.6E-08   29.2   1.2   55    2-58     20-75  (76)
 12 PF10320 7TM_GPCR_Srsx:  Serpen  96.0  0.0042   9E-08   34.6   1.4   58    2-60    195-252 (257)
 13 PF05462 Dicty_CAR:  Slime mold  90.8    0.11 2.4E-06   30.0   0.8   52    2-58    210-261 (303)
 14 PF02101 Ocular_alb:  Ocular al  87.7    0.31 6.8E-06   29.3   1.1   18    2-19    252-269 (405)
 15 PF10323 7TM_GPCR_Srv:  Serpent  73.9     4.5 9.7E-05   23.0   2.5   27   34-60    250-276 (283)
 16 PF10327 7TM_GPCR_Sri:  Serpent  71.7     2.4 5.3E-05   24.4   1.1   50    6-59    252-301 (303)
 17 PF10321 7TM_GPCR_Srt:  Serpent  67.8    0.82 1.8E-05   26.6  -1.3   27   33-59    273-299 (313)
 18 PF10317 7TM_GPCR_Srd:  Serpent  62.7     5.2 0.00011   22.7   1.3   28   33-60    262-289 (292)
 19 PF05296 TAS2R:  Mammalian tast  60.6     3.1 6.7E-05   24.0   0.1   29   32-60    266-294 (303)
 20 PF10326 7TM_GPCR_Str:  Serpent  54.8     1.8 3.8E-05   24.6  -1.4   26   35-60    280-305 (307)
 21 PF10328 7TM_GPCR_Srx:  Serpent  44.3     8.8 0.00019   21.5   0.3   19   41-59    249-267 (274)
 22 cd00930 Cyt_c_Oxidase_VIII Cyt  32.8      38 0.00083   14.1   1.3   26   34-59     16-42  (43)
 23 PF10260 SAYSvFN:  Uncharacteri  32.2      23  0.0005   16.4   0.6   12   48-59     45-56  (71)
 24 KOG1735|consensus               30.3      27 0.00058   18.5   0.7   12    2-13     87-98  (146)
 25 PF02285 COX8:  Cytochrome oxid  28.5      44 0.00096   14.0   1.1   25   35-59     17-42  (44)
 26 PF11036 YqgB:  Virulence promo  25.5      24 0.00052   14.5   0.0   10   46-55     18-27  (43)
 27 PF10319 7TM_GPCR_Srj:  Serpent  25.3   1E+02  0.0022   18.4   2.5   19   42-60    291-309 (310)

No 1  
>PHA03234 DNA packaging protein UL33; Provisional
Probab=99.61  E-value=1.1e-16  Score=90.85  Aligned_cols=59  Identities=14%  Similarity=0.192  Sum_probs=44.1

Q ss_pred             EEEeehhHHHHHHHHHHHcc---cCcc---hhHHHHHHHHHHHhchhhchhhhhhhhccCCccCC
Q psy17035          2 AFVLCWSPYIVFDLLQVYGY---IPRT---QNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~---~~~~---~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      +|++||+||++..+++....   ....   ........++..++++|||+||+||++.+++||++
T Consensus       245 vF~iCWlPy~iv~l~~~~~~~~~~~~c~~~~~~~~~~~v~~~La~~nsclNPiIY~f~~~~FR~~  309 (338)
T PHA03234        245 SFLCIQIPNIAILICEIAFLYIANNSCFGLAQREILQIIIRLMPEIHCFSNPLVYAFTGGDFRLR  309 (338)
T ss_pred             HHHHHHhHHHHHHHHHHHHHhcccCcchHHHHHHHHHHHHHHHHHhhhhhhHHHHHHhhHHHHHH
Confidence            58999999999887654321   1111   12234456788999999999999999999999963


No 2  
>PHA03235 DNA packaging protein UL33; Provisional
Probab=99.49  E-value=4.7e-15  Score=85.92  Aligned_cols=59  Identities=24%  Similarity=0.430  Sum_probs=44.0

Q ss_pred             EEEeehhHHHHHHHHHHHccc--C-c---chhHHHHHHHHHHHhchhhchhhhhhhhccCCccCC
Q psy17035          2 AFVLCWSPYIVFDLLQVYGYI--P-R---TQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~~--~-~---~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      +|++||+||+++.++..+...  + +   .........+...++++||++||+||++++++||++
T Consensus       252 ~F~iCWlPy~v~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~La~~ns~lNPiIY~~~~~~FRk~  316 (409)
T PHA03235        252 SFLCLQTPFVAIMIFDSYATLIWPSDCEHINLRDAVSTLSRLVPNLHCLLNPILYAFLGNDFLKR  316 (409)
T ss_pred             HHHHHHhHHHHHHHHHHHHHhcCCCCchhhhHHHHHHHHHHHHHHHHHhHhHHHHHHhhHHHHHH
Confidence            588999999999887654211  1 1   111224456778899999999999999999999973


No 3  
>PHA02834 chemokine receptor-like protein; Provisional
Probab=99.48  E-value=5.1e-15  Score=83.34  Aligned_cols=59  Identities=14%  Similarity=0.310  Sum_probs=43.5

Q ss_pred             EEEeehhHHHHHHHHHHHcccC----cc---hhHHHHHHHHHHHhchhhchhhhhhhhccCCccCC
Q psy17035          2 AFVLCWSPYIVFDLLQVYGYIP----RT---QNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~~~----~~---~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      +|++||+|+++..++..+.+..    +.   ........++..++++||++||+||++.+++||++
T Consensus       237 ~F~icWlPy~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~ns~iNPiIY~~~~~~fR~~  302 (323)
T PHA02834        237 FTVVFWVPFNIVLFINSLQSVGLIDIGCYHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFKKV  302 (323)
T ss_pred             HHHHHHhhHHHHHHHHHHHHhcCCCccchHHHHHHHHHHHHHHHHHhhccccHHHHHHhcHHHHHH
Confidence            5789999999998876553211    11   11122345778899999999999999999999973


No 4  
>PHA02638 CC chemokine receptor-like protein; Provisional
Probab=99.46  E-value=1.1e-14  Score=84.61  Aligned_cols=59  Identities=15%  Similarity=0.272  Sum_probs=44.9

Q ss_pred             EEEeehhHHHHHHHHHHHccc---------Cc--chhHHHHHHHHHHHhchhhchhhhhhhhccCCccCC
Q psy17035          2 AFVLCWSPYIVFDLLQVYGYI---------PR--TQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~~---------~~--~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      +|++||+|+.+..++..+...         ..  .........++..++++|||+||++|++++++||++
T Consensus       321 ~f~lcW~Py~i~~ll~~~~~~~~~~~~~~~~~c~~~~l~~~~~vt~~la~~~sclNPiIY~f~~~~FR~~  390 (417)
T PHA02638        321 CSLICWIPLNIVILFATMYSFKGFNSIISEHICGFIKLGYAMMLAEAISLTHCCINPLIYTLIGENFRMH  390 (417)
T ss_pred             HHHHHHhhHHHHHHHHHHHHhhccccccccccccHHHHHHHHHHHHHHHHHHHhhhHHHHHHhCHHHHHH
Confidence            578999999999888765311         01  112234456788999999999999999999999973


No 5  
>KOG4219|consensus
Probab=99.45  E-value=9.3e-15  Score=84.17  Aligned_cols=58  Identities=29%  Similarity=0.509  Sum_probs=47.5

Q ss_pred             EEEeehhHHHHHHHHHHHccc-CcchhHHHHHHHHHHHhchhhchhhhhhhhccCCccC
Q psy17035          2 AFVLCWSPYIVFDLLQVYGYI-PRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNN   59 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~   59 (60)
                      .|.+||+|+++..++....+. .........+....+++.+|+|+||+||++.|++||.
T Consensus       269 ~FaicWlPyh~y~il~~~~~~i~~~k~i~~vyl~~~WLaMSst~yNPiIY~~lN~Rfr~  327 (423)
T KOG4219|consen  269 IFAICWLPYHIYFILNATNPEINRKKFIQQVYLAIYWLAMSSTCYNPIIYCFLNKRFRG  327 (423)
T ss_pred             HHHHhccChhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhccHhhhhhHHHHHH
Confidence            589999999999998875432 2234455667778999999999999999999999985


No 6  
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional
Probab=99.25  E-value=1.3e-12  Score=73.57  Aligned_cols=59  Identities=17%  Similarity=0.299  Sum_probs=43.1

Q ss_pred             EEEeehhHHHHHHHHHHHc---ccCc---chhHHHHHHHHHHHhchhhchhhhhhhhccCCccCC
Q psy17035          2 AFVLCWSPYIVFDLLQVYG---YIPR---TQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~---~~~~---~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      +|++||.|+.+..++....   ..+.   .........+...++.+|+++||+||++++++||++
T Consensus       252 ~f~i~w~P~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~ns~~NPiIY~~~~~~fr~~  316 (335)
T PHA03087        252 LFVIFWLPFNVSVFVYSLHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKH  316 (335)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhccCCCCcHHHHHHHHHHHHHHHHHHHHhhhhhHHHHcCHHHHHH
Confidence            4789999999987765431   1111   122334456778899999999999999999999963


No 7  
>KOG4220|consensus
Probab=99.19  E-value=2.9e-13  Score=78.70  Aligned_cols=55  Identities=25%  Similarity=0.414  Sum_probs=46.8

Q ss_pred             EEEeehhHHHHHHHHHHHcccCcchhHHHHHHHHHHHhchhhchhhhhhhhccCCccC
Q psy17035          2 AFVLCWSPYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNN   59 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~   59 (60)
                      .|+++|+||.++.++..+..   ......++.+..++.|+||-+||++|++.|+.||+
T Consensus       425 AFIiTWtPYNImVlv~tFC~---~CiP~tlW~~gYwLCYINSTiNP~CYALCNatFrk  479 (503)
T KOG4220|consen  425 AFILTWTPYNIMVLVNTFCK---NCIPETLWTFGYWLCYINSTINPLCYALCNATFRK  479 (503)
T ss_pred             HHHHHcccceeeeehHhhcc---cccchhHhhhhhheeeecccccHHHHHHHhHHHHH
Confidence            58899999999999998743   23345667778899999999999999999999986


No 8  
>PF00001 7tm_1:  7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature;  InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The rhodopsin-like GPCRs themselves represent a widespread protein family that includes hormone, neurotransmitter and light receptors, all of which transduce extracellular signals through interaction with guanine nucleotide-binding (G) proteins. Although their activating ligands vary widely in structure and character, the amino acid sequences of the receptors are very similar and are believed to adopt a common structural framework comprising 7 transmembrane (TM) helices [, , ].; GO: 0007186 G-protein coupled receptor protein signaling pathway, 0016021 integral to membrane; PDB: 2KI9_A 3QAK_A 2YDV_A 3VGA_A 3PWH_A 3RFM_A 3EML_A 3VG9_A 3REY_A 3UZA_A ....
Probab=98.83  E-value=1.8e-09  Score=57.49  Aligned_cols=48  Identities=40%  Similarity=0.663  Sum_probs=39.3

Q ss_pred             EEEeehhHHHHHHHHHHHcccCcchhHHHHHHHHHHHhchhhchhhhhh
Q psy17035          2 AFVLCWSPYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIY   50 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~nP~iy   50 (60)
                      +|++||+|+.+..++....+.... .......++.+++++|+++||++|
T Consensus       210 ~f~~~~~P~~i~~~~~~~~~~~~~-~~~~~~~~~~~l~~~~s~~nP~iY  257 (257)
T PF00001_consen  210 VFLLCWLPYFILSLLSVFSPSSSL-ISSILFYISYFLAFLNSCLNPIIY  257 (257)
T ss_dssp             HHHHHHHHHHHHHHHHHHSSTSTC-SHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccccCCceeHHHHHHHHcCccch-hhHHHHHHHHHHHHHHHhhCcEEC
Confidence            478999999999998887654422 455667788899999999999998


No 9  
>KOG2087|consensus
Probab=97.81  E-value=2.7e-07  Score=53.23  Aligned_cols=54  Identities=26%  Similarity=0.490  Sum_probs=37.7

Q ss_pred             EeehhHHHHHHHHHHHcccCcchhHHHHHHHHHHHhchhhchhhhhhhhccCCccC
Q psy17035          4 VLCWSPYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNN   59 (60)
Q Consensus         4 ~~~w~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~   59 (60)
                      .+||.|...+.+....+..-...  .....+...+.-.|||+||+.|++.++.||+
T Consensus       245 ~icw~Pi~f~~~~al~~~~li~~--~~sk~llv~flPlns~~NP~LYa~fT~~fk~  298 (363)
T KOG2087|consen  245 CICWCPIAFFKFSALIGVELISV--SYSKWLLVFFLPLNSCLNPFLYAFFTPVFKE  298 (363)
T ss_pred             ccccCchheeeeHHhcCCcccCh--hhceeEEEEEEEcccccCchhHHHcCHHHHH
Confidence            58999999988877654211111  1111223456678999999999999999986


No 10 
>PF10324 7TM_GPCR_Srw:  Serpentine type 7TM GPCR chemoreceptor Srw;  InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class w (Srw), which is a solo family amongst the superfamilies of chemoreceptors. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz []. 
Probab=97.30  E-value=9.6e-05  Score=41.72  Aligned_cols=58  Identities=17%  Similarity=0.221  Sum_probs=43.1

Q ss_pred             EEEeehhHHHHHHHHHHHcc-cC-cchhHHHHHHHHHHHhchhhchhhhhhhhccCCccC
Q psy17035          2 AFVLCWSPYIVFDLLQVYGY-IP-RTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNN   59 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~-~~-~~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~   59 (60)
                      .|+++=+|..+..+++.... .. ..........+...+...|++.|++||.++|.|||+
T Consensus       250 ~f~i~e~p~gi~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~h~~ic~~mSsqYR~  309 (318)
T PF10324_consen  250 SFLISELPQGIIFLLESFFEEDSGLIFIIIQLSIIFNILITINSSIHFFICCFMSSQYRK  309 (318)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhcchhHHHHHHHHHHHHHHHHHhhhHHHhhhhhhHHHHH
Confidence            35667788888888877522 11 122334555677889999999999999999999997


No 11 
>PF11970 Git3_C:  G protein-coupled glucose receptor regulating Gpa2 C-term;  InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor. Git3 is one of six proteins required for glucose-triggered adenylate cyclase activation, and is a G protein-coupled receptor responsible for the activation of adenylate cyclase through Gpa2 - heterotrimeric G protein alpha subunit, part of the glucose-detection pathway. Git3 contains seven predicted transmembrane domains, a third cytoplasmic loop and a cytoplasmic tail []. This family is the conserved C-terminal domain of the member proteins. 
Probab=96.06  E-value=0.0035  Score=29.22  Aligned_cols=55  Identities=7%  Similarity=0.248  Sum_probs=36.6

Q ss_pred             EEEeehh-HHHHHHHHHHHcccCcchhHHHHHHHHHHHhchhhchhhhhhhhccCCcc
Q psy17035          2 AFVLCWS-PYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNN   58 (60)
Q Consensus         2 ~f~~~w~-P~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr   58 (60)
                      +|+++|+ |+..-.+-...+.  ...+...+..+...+..+|+.+|-++|.+.-|.-|
T Consensus        20 ~Yi~lwlfP~~~~~~~~~~~~--~~~p~~~l~~i~~~~~~~~G~VD~lvf~~~erpw~   75 (76)
T PF11970_consen   20 VYIVLWLFPFAAHRMQYMYEI--GHGPSFWLFCIAGFMQPSQGFVDCLVFTLRERPWR   75 (76)
T ss_pred             HHHHHHHHHHHHHHHHHHhcc--CCCCchHHHHHHHHHHHccCHHHhhheeeecccCC
Confidence            4678898 8776555444221  22333445566778889999999999998766544


No 12 
>PF10320 7TM_GPCR_Srsx:  Serpentine type 7TM GPCR chemoreceptor Srsx;  InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class sx (Srsx), which is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. 
Probab=95.98  E-value=0.0042  Score=34.59  Aligned_cols=58  Identities=7%  Similarity=0.142  Sum_probs=37.6

Q ss_pred             EEEeehhHHHHHHHHHHHcccCcchhHHHHHHHHHHHhchhhchhhhhhhhccCCccCC
Q psy17035          2 AFVLCWSPYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      .|+..|.=-.+...+....+.+ ............++...|.+.|-.+|.+.|+|||++
T Consensus       195 i~i~~w~~s~~~~~v~~~~~~~-~~~~~~i~~~~~i~v~~~~s~~ffV~~~~S~EYR~a  252 (257)
T PF10320_consen  195 IFIFSWFLSQIINTVSLALGLD-GETIAIIQMYAGIFVNISYSQNFFVYYWRSSEYRKA  252 (257)
T ss_pred             eeeHHHHHHHHHHHHHHHhCCc-HHHHHHHHHHHHHHHHHHHHHHheEEEEcCHHHHHH
Confidence            4556666555555444332211 222333444567889999999999999999999974


No 13 
>PF05462 Dicty_CAR:  Slime mold cyclic AMP receptor
Probab=90.83  E-value=0.11  Score=29.96  Aligned_cols=52  Identities=21%  Similarity=0.406  Sum_probs=35.0

Q ss_pred             EEEeehhHHHHHHHHHHHcccCcchhHHHHHHHHHHHhchhhchhhhhhhhccCCcc
Q psy17035          2 AFVLCWSPYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNN   58 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr   58 (60)
                      +|++||+|-.+-.+.+..+..+   .....++  ..++-+....|.++|...++..+
T Consensus       210 ifiicw~fa~INRI~~~~~~~~---~~l~~Lh--~~~s~lqGf~nsivy~~n~~~~~  261 (303)
T PF05462_consen  210 IFIICWIFATINRIYNFIGKNP---FWLSVLH--VGFSPLQGFFNSIVYGYNNSLMW  261 (303)
T ss_pred             HHHHHHHHHHHHHHHHHhcCCc---hHHHHHH--HHHHHHHHHHHHHHHHhCCHHHH
Confidence            5788999998888888765322   2222222  34666778889999998877533


No 14 
>PF02101 Ocular_alb:  Ocular albinism type 1 protein;  InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes. A novel transcript from the OA1 critical region is expressed in high levels in RNA samples from retina and from melanoma and encodes a potential integral membrane protein []. This protein is of unknown function but is known to bind heterotrimeric G proteins.; GO: 0016020 membrane
Probab=87.72  E-value=0.31  Score=29.30  Aligned_cols=18  Identities=39%  Similarity=0.942  Sum_probs=14.2

Q ss_pred             EEEeehhHHHHHHHHHHH
Q psy17035          2 AFVLCWSPYIVFDLLQVY   19 (60)
Q Consensus         2 ~f~~~w~P~~~~~~~~~~   19 (60)
                      +|.+||+|..+-.++-.+
T Consensus       252 VF~iCWlpNIINg~LL~~  269 (405)
T PF02101_consen  252 VFYICWLPNIINGSLLFY  269 (405)
T ss_pred             HHHHHhhhhhHhHHHHHH
Confidence            688999999988775543


No 15 
>PF10323 7TM_GPCR_Srv:  Serpentine type 7TM GPCR chemoreceptor Srv;  InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  This entry represents serpentine receptor class v (Srv) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. 
Probab=73.92  E-value=4.5  Score=23.03  Aligned_cols=27  Identities=26%  Similarity=0.288  Sum_probs=21.5

Q ss_pred             HHHHHhchhhchhhhhhhhccCCccCC
Q psy17035         34 LIQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus        34 ~~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      ..-.+.-..|.+||+.--..||+.||+
T Consensus       250 ~y~~~~~~~s~inP~~LLi~n~~lr~~  276 (283)
T PF10323_consen  250 FYPILNGLLSFINPWMLLIFNKDLRKQ  276 (283)
T ss_pred             HHHHHHHHHHhhhhHHhhhccHHHHHH
Confidence            444566677889999999999999873


No 16 
>PF10327 7TM_GPCR_Sri:  Serpentine type 7TM GPCR chemoreceptor Sri;  InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents Sri, which is part of the Str superfamily of chemoreceptors.
Probab=71.69  E-value=2.4  Score=24.40  Aligned_cols=50  Identities=14%  Similarity=0.339  Sum_probs=32.5

Q ss_pred             ehhHHHHHHHHHHHcccCcchhHHHHHHHHHHHhchhhchhhhhhhhccCCccC
Q psy17035          6 CWSPYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNN   59 (60)
Q Consensus         6 ~w~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~nP~iy~~~~~~fr~   59 (60)
                      |-+|-.+...+...+.    ...+.+-..+.....++|.+|-++-.+.++.||+
T Consensus       252 ~~~P~~~~~~~~~~~~----~~~q~i~~~~~~~f~~HS~~n~ivli~t~ppYR~  301 (303)
T PF10327_consen  252 CILPPFIFVVVVIFEF----EDAQVISEICLAIFSSHSSVNMIVLIITTPPYRK  301 (303)
T ss_pred             HHHHHHHhhhhheecC----CCcHHHHHHHHHHHHHhhHhhheeeeEcCcchhh
Confidence            3456555544443322    1223344455567788899999999999999997


No 17 
>PF10321 7TM_GPCR_Srt:  Serpentine type 7TM GPCR chemoreceptor Srt;  InterPro: IPR019425  Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type []. Srt is a member of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. 
Probab=67.83  E-value=0.82  Score=26.61  Aligned_cols=27  Identities=26%  Similarity=0.262  Sum_probs=21.8

Q ss_pred             HHHHHHhchhhchhhhhhhhccCCccC
Q psy17035         33 TLIQSLAPLNSAANPIIYCIFRTGNNN   59 (60)
Q Consensus        33 ~~~~~l~~~ns~~nP~iy~~~~~~fr~   59 (60)
                      .+.+..=-.++..+|+||-.+||..|+
T Consensus       273 ~~~~~~Wql~~g~~~iIYl~lNrtIR~  299 (313)
T PF10321_consen  273 IIGQISWQLSHGCPPIIYLTLNRTIRN  299 (313)
T ss_pred             HHHHHHHhccCCccceEEEEECHHHHH
Confidence            344566677888999999999999886


No 18 
>PF10317 7TM_GPCR_Srd:  Serpentine type 7TM GPCR chemoreceptor Srd;  InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents the chemoreceptor Srd []. 
Probab=62.67  E-value=5.2  Score=22.74  Aligned_cols=28  Identities=29%  Similarity=0.301  Sum_probs=20.9

Q ss_pred             HHHHHHhchhhchhhhhhhhccCCccCC
Q psy17035         33 TLIQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus        33 ~~~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      .....++..-+.+||++....-+-+|++
T Consensus       262 ~~~~~~~~~~~~~~P~itl~fv~PYR~~  289 (292)
T PF10317_consen  262 YLIFMLASLPPLIDPLITLYFVRPYRKA  289 (292)
T ss_pred             HHHHHHHHHHHHhchHhheeeeHhHHHH
Confidence            3444567777889999998888888863


No 19 
>PF05296 TAS2R:  Mammalian taste receptor protein (TAS2R);  InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs). TAS2Rs are G protein-coupled receptors expressed in subsets of taste receptor cells of the tongue and palate epithelia and are organised in the genome in clusters. The proteins are genetically linked to loci that influence bitter perception in mice and humans [].; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway, 0050909 sensory perception of taste, 0016021 integral to membrane
Probab=60.56  E-value=3.1  Score=23.99  Aligned_cols=29  Identities=10%  Similarity=0.054  Sum_probs=24.1

Q ss_pred             HHHHHHHhchhhchhhhhhhhccCCccCC
Q psy17035         32 ATLIQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus        32 ~~~~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      ..+...+....++.+|++-.+.|++.|++
T Consensus       266 ~~~~~~i~~~yps~hs~iLIlgn~KLr~~  294 (303)
T PF05296_consen  266 FWVCEIIIALYPSGHSIILILGNPKLRQA  294 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcCchHHHHH
Confidence            34566788889999999999999999874


No 20 
>PF10326 7TM_GPCR_Str:  Serpentine type 7TM GPCR chemoreceptor Str;  InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class r (Str) from the Str superfamily [, ]. Almost a quarter (22.5%) of str and srj family genes and pseudogenes in C. elegans appear to have been newly formed by gene duplications since the species split []. 
Probab=54.83  E-value=1.8  Score=24.59  Aligned_cols=26  Identities=19%  Similarity=0.224  Sum_probs=21.6

Q ss_pred             HHHHhchhhchhhhhhhhccCCccCC
Q psy17035         35 IQSLAPLNSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus        35 ~~~l~~~ns~~nP~iy~~~~~~fr~~   60 (60)
                      .......-+++||++-.+.-||+|++
T Consensus       280 ~~~~~~~yP~iDpl~~i~~ik~yR~~  305 (307)
T PF10326_consen  280 ISILISLYPAIDPLPVIFIIKDYRKA  305 (307)
T ss_pred             hhhhEEEEeehhhheeeEeeHHHHHh
Confidence            34567778899999999999999985


No 21 
>PF10328 7TM_GPCR_Srx:  Serpentine type 7TM GPCR chemoreceptor Srx;  InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class x (Srx) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. 
Probab=44.32  E-value=8.8  Score=21.50  Aligned_cols=19  Identities=26%  Similarity=0.322  Sum_probs=15.7

Q ss_pred             hhhchhhhhhhhccCCccC
Q psy17035         41 LNSAANPIIYCIFRTGNNN   59 (60)
Q Consensus        41 ~ns~~nP~iy~~~~~~fr~   59 (60)
                      ..-+.|++|+...|+|.|+
T Consensus       249 ~~h~~DG~i~l~fN~~~r~  267 (274)
T PF10328_consen  249 LVHALDGLIMLIFNSEIRR  267 (274)
T ss_pred             HHHHhcceeEeEEcHHHHH
Confidence            3345799999999999986


No 22 
>cd00930 Cyt_c_Oxidase_VIII Cytochrome oxidase c subunit VIII.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit VIII is the smallest of the nuclear-encoded subunits. It exists in muscle-specific and non-muscle-specific isoforms that are differently expressed in different species, suggesting species-specific regulation of energy metabolism.
Probab=32.81  E-value=38  Score=14.09  Aligned_cols=26  Identities=8%  Similarity=-0.012  Sum_probs=13.7

Q ss_pred             HHHHHhchhhchhhhhhhhcc-CCccC
Q psy17035         34 LIQSLAPLNSAANPIIYCIFR-TGNNN   59 (60)
Q Consensus        34 ~~~~l~~~ns~~nP~iy~~~~-~~fr~   59 (60)
                      +..+..++-+++=|--|.+.+ ++||+
T Consensus        16 aigl~~~f~~~L~p~gWVLshL~~YKk   42 (43)
T cd00930          16 AIGLSVFFTTFLLPAGWVLSHLENYKK   42 (43)
T ss_pred             HHHHHHHHHHHHhhHHHHHHHHHHhcc
Confidence            334444555555665566555 55554


No 23 
>PF10260 SAYSvFN:  Uncharacterized conserved domain (SAYSvFN);  InterPro: IPR019387  This domain of approximately 75 residues contains a highly conserved SATSv/iFN motif. The function is unknown but the domain is conserved from plants to humans. 
Probab=32.18  E-value=23  Score=16.38  Aligned_cols=12  Identities=25%  Similarity=0.606  Sum_probs=8.6

Q ss_pred             hhhhhccCCccC
Q psy17035         48 IIYCIFRTGNNN   59 (60)
Q Consensus        48 ~iy~~~~~~fr~   59 (60)
                      =-|..+|+++|+
T Consensus        45 SAYSVFN~~~~~   56 (71)
T PF10260_consen   45 SAYSVFNKGCER   56 (71)
T ss_pred             cchhhhCCCccc
Confidence            357888888775


No 24 
>KOG1735|consensus
Probab=30.31  E-value=27  Score=18.47  Aligned_cols=12  Identities=33%  Similarity=0.736  Sum_probs=9.1

Q ss_pred             EEEeehhHHHHH
Q psy17035          2 AFVLCWSPYIVF   13 (60)
Q Consensus         2 ~f~~~w~P~~~~   13 (60)
                      +|+++|.|...-
T Consensus        87 i~f~~wsPd~a~   98 (146)
T KOG1735|consen   87 IFFIAWSPDTAP   98 (146)
T ss_pred             EEEEEECCCccc
Confidence            578999988653


No 25 
>PF02285 COX8:  Cytochrome oxidase c subunit VIII;  InterPro: IPR003205 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits.This family is composed of cytochrome c oxidase subunit VIII. ; GO: 0004129 cytochrome-c oxidase activity; PDB: 3AG3_Z 3ABM_M 1OCC_Z 3ASO_Z 3AG2_Z 3ABL_M 3AG4_M 3AG1_M 3ASN_M 1OCZ_M ....
Probab=28.52  E-value=44  Score=13.97  Aligned_cols=25  Identities=8%  Similarity=0.033  Sum_probs=12.3

Q ss_pred             HHHHhchhhchhhhhhhhcc-CCccC
Q psy17035         35 IQSLAPLNSAANPIIYCIFR-TGNNN   59 (60)
Q Consensus        35 ~~~l~~~ns~~nP~iy~~~~-~~fr~   59 (60)
                      ..+..++-+++=|--|.+.+ ++||+
T Consensus        17 igltv~f~~~L~PagWVLshL~~YKk   42 (44)
T PF02285_consen   17 IGLTVCFVTFLGPAGWVLSHLESYKK   42 (44)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTHHHHHT
T ss_pred             HHHHHHHHHHHhhHHHHHHHHHHhhc
Confidence            33444455555565555544 44443


No 26 
>PF11036 YqgB:  Virulence promoting factor;  InterPro: IPR020196 The yqgB and yqfZ genes are associated with the genomes of bacteria with distinct pathogenic properties and consequently fall into the category of being virulence genes []. However, yqgB and yqfZ genes are not true virulence factors but instead are probably lifestyle determinant genes where the gene products act in concert, enabling the bacteria to cope with its suboptimal physical environment and thus facilitating host colonization [].
Probab=25.54  E-value=24  Score=14.55  Aligned_cols=10  Identities=30%  Similarity=0.803  Sum_probs=6.5

Q ss_pred             hhhhhhhccC
Q psy17035         46 NPIIYCIFRT   55 (60)
Q Consensus        46 nP~iy~~~~~   55 (60)
                      ||.+|++.++
T Consensus        18 ~~~vyGLLS~   27 (43)
T PF11036_consen   18 NPAVYGLLSQ   27 (43)
T ss_pred             CchhhhhHhh
Confidence            6667776653


No 27 
>PF10319 7TM_GPCR_Srj:  Serpentine type 7TM GPCR chemoreceptor Srj;  InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  This entry represents serpentine receptor class j (Srj) from the Str superfamily [, ]. The Srj family is designated as the out-group based on its location in preliminary phylogenetic analyses of the entire superfamily []. 
Probab=25.31  E-value=1e+02  Score=18.43  Aligned_cols=19  Identities=16%  Similarity=0.176  Sum_probs=15.7

Q ss_pred             hhchhhhhhhhccCCccCC
Q psy17035         42 NSAANPIIYCIFRTGNNNR   60 (60)
Q Consensus        42 ns~~nP~iy~~~~~~fr~~   60 (60)
                      =+.+||+.-.+.-+.+|++
T Consensus       291 FPf~DPlAii~~lP~~R~r  309 (310)
T PF10319_consen  291 FPFLDPLAIILCLPAFRNR  309 (310)
T ss_pred             ccccCchHhheecHHhhcc
Confidence            3688999888888888875


Done!