Query         psy17048
Match_columns 103
No_of_seqs    100 out of 122
Neff          3.4 
Searched_HMMs 46136
Date          Fri Aug 16 20:30:24 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17048.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17048hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07297 DPM2:  Dolichol phosph 100.0   1E-35 2.2E-40  202.0   8.4   78    2-82      1-78  (78)
  2 KOG3488|consensus              100.0 3.8E-29 8.2E-34  170.7   6.9   77    2-81      3-79  (81)
  3 PF08510 PIG-P:  PIG-P;  InterP  97.3 0.00099 2.1E-08   47.5   6.5   62    7-74      6-69  (126)
  4 KOG2257|consensus               96.9  0.0031 6.7E-08   47.2   5.7   72    7-84     10-83  (135)
  5 PF10510 PIG-S:  Phosphatidylin  87.5    0.28   6E-06   41.9   1.2   40   30-72    468-508 (517)
  6 KOG2459|consensus               64.4     2.2 4.8E-05   38.1   0.0   31   31-64    487-518 (536)
  7 PF00032 Cytochrom_B_C:  Cytoch  61.7      31 0.00067   23.3   5.3   30    3-39     28-57  (102)
  8 PF14150 YesK:  YesK-like prote  54.7      11 0.00024   25.9   2.2   22   42-63     20-41  (81)
  9 PRK06531 yajC preprotein trans  40.6      14 0.00029   26.7   0.9   14   72-85     17-30  (113)
 10 PF07178 TraL:  TraL protein;    40.6      25 0.00053   23.8   2.1   47   44-90     17-65  (95)
 11 PF07811 TadE:  TadE-like prote  40.0      67  0.0015   18.0   3.6   16   49-64      6-21  (43)
 12 PF15102 TMEM154:  TMEM154 prot  39.3      17 0.00036   27.6   1.2   18   49-66     58-75  (146)
 13 PRK13707 conjugal transfer pil  38.1      25 0.00053   24.6   1.8   48   44-91     23-72  (101)
 14 PF14610 DUF4448:  Protein of u  37.9      12 0.00026   27.8   0.2   22   49-70    159-180 (189)
 15 PTZ00046 rifin; Provisional     36.2      17 0.00037   31.0   1.0   43   50-94    315-357 (358)
 16 PF12273 RCR:  Chitin synthesis  34.9      27 0.00058   24.5   1.6   18   64-81     11-28  (130)
 17 PF06305 DUF1049:  Protein of u  34.7      46 0.00099   20.3   2.5   30   44-76     11-40  (68)
 18 KOG4845|consensus               33.9      77  0.0017   28.1   4.5   53   10-64    387-441 (452)
 19 CHL00058 petD cytochrome b6/f   33.2      92   0.002   23.8   4.4   30    3-39     92-121 (160)
 20 PF10215 Ost4:  Oligosaccaryltr  33.1      74  0.0016   18.8   3.1   27   56-82      9-35  (35)
 21 TIGR01477 RIFIN variant surfac  32.9      21 0.00045   30.5   0.9   43   50-94    310-352 (353)
 22 PF08183 SpoV:  Stage V sporula  32.6      28 0.00061   19.7   1.1   22   48-69      2-23  (26)
 23 PF11821 DUF3341:  Protein of u  32.2 2.2E+02  0.0048   21.7   6.3   55   13-76     64-118 (173)
 24 PF11874 DUF3394:  Domain of un  31.9      28  0.0006   27.1   1.4   19   46-65    156-174 (183)
 25 PRK05886 yajC preprotein trans  30.8      29 0.00064   24.9   1.3   15   71-85     18-32  (109)
 26 PRK05113 electron transport co  30.1      65  0.0014   24.4   3.1   32   57-88      5-36  (191)
 27 PF07787 DUF1625:  Protein of u  29.1 2.7E+02  0.0058   21.5   6.5   30    4-33    186-216 (248)
 28 PF12606 RELT:  Tumour necrosis  26.9      48   0.001   20.9   1.6   27   60-86      6-32  (50)
 29 PF01102 Glycophorin_A:  Glycop  26.7      91   0.002   22.7   3.3   40   44-86     60-100 (122)
 30 TIGR03794 NHPM_micro_HlyD NHPM  26.3      63  0.0014   26.4   2.6   27   34-64      8-34  (421)
 31 PF06522 B12D:  NADH-ubiquinone  25.3   1E+02  0.0022   20.1   3.0   23   53-75      6-28  (73)
 32 TIGR01156 cytb6/f_IV cytochrom  25.2 1.5E+02  0.0033   22.6   4.3   30    3-39     92-121 (159)
 33 PF09604 Potass_KdpF:  F subuni  24.4 1.2E+02  0.0026   16.6   2.8   21   59-79      4-24  (25)
 34 PF15048 OSTbeta:  Organic solu  24.3      97  0.0021   23.1   3.1   27   58-84     41-67  (125)
 35 COG3671 Predicted membrane pro  24.2      42 0.00091   25.1   1.1   29   62-91     39-67  (125)
 36 PF06027 DUF914:  Eukaryotic pr  24.1   3E+02  0.0065   22.9   6.2   25    5-29    230-254 (334)
 37 PF05328 CybS:  CybS;  InterPro  23.7 2.8E+02  0.0061   20.1   5.4   35   43-77     84-118 (132)
 38 PRK13476 cytochrome b6-f compl  23.6 1.9E+02  0.0041   22.1   4.6   29    4-39     93-121 (160)
 39 cd00290 cytochrome_b_C Cytochr  23.4 2.2E+02  0.0047   20.6   4.8   27    3-36     79-105 (147)
 40 PF10211 Ax_dynein_light:  Axon  22.7      31 0.00066   26.2   0.2    9   43-51      7-15  (189)
 41 PF01299 Lamp:  Lysosome-associ  21.9      97  0.0021   24.6   2.9   27   51-77    270-297 (306)
 42 PF15330 SIT:  SHP2-interacting  21.5 1.2E+02  0.0027   21.4   3.0   32   53-84      2-34  (107)
 43 PRK14741 spoVM stage V sporula  21.3      41  0.0009   19.0   0.5   22   48-69      2-23  (26)
 44 COG3763 Uncharacterized protei  20.5      72  0.0016   21.8   1.6   30   58-87      8-37  (71)
 45 PF12072 DUF3552:  Domain of un  20.3 1.1E+02  0.0023   23.1   2.7   20   58-77      4-23  (201)

No 1  
>PF07297 DPM2:  Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2);  InterPro: IPR009914 This family consists of several eukaryotic dolichol phosphate-mannose biosynthesis regulatory (DPM2) proteins. Biosynthesis of glycosylphosphatidylinositol and N-glycan precursor is dependent upon a mannosyl donor, dolichol phosphate-mannose (DPM). DPM2, an 84 amino acid membrane protein expressed in the endoplasmic reticulum (ER), makes a complex with DPM1 that is essential for the ER localisation and stable expression of DPM1. Moreover, DPM2 enhances binding of dolichol phosphate, a substrate of DPM synthase. Biosynthesis of DPM in mammalian cells is regulated by DPM2 [].; GO: 0009059 macromolecule biosynthetic process, 0030176 integral to endoplasmic reticulum membrane
Probab=100.00  E-value=1e-35  Score=202.04  Aligned_cols=78  Identities=33%  Similarity=0.603  Sum_probs=75.8

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHhhcccccCCccccccccccCChhhHHHHHHHHHHHHHHHHHHHHhhhhhhcCCcc
Q psy17048          2 LEDSTIGKLILAFTCICFLYYTLWVFATPFIEPDTAILDIRYYFPPIQYALIIPCALISGLIGCLYAFTCTFYITAYTKI   81 (103)
Q Consensus         2 ~~Dr~vG~~lL~~~~~iF~YYtvWv~vlPFvd~D~~i~~~~~lFpPr~yAi~lP~~lllv~l~~vg~Fig~~lI~~~~k~   81 (103)
                      ++||++|++|+++++++|+|||+|++++||+|+||++|   ++||||||||++|+++++++++++|+|+|++|++|+||+
T Consensus         1 ~~Dr~vG~~~l~~a~~vF~YYt~WvlllPFvd~d~~i~---~~F~Pr~yAi~lP~~lll~~~~~vg~f~g~vmik~~~kk   77 (78)
T PF07297_consen    1 MSDRLVGLLMLAVALSVFTYYTIWVLLLPFVDEDHPIH---SFFPPREYAIILPIFLLLLGLSGVGTFLGYVMIKSKKKK   77 (78)
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCchHH---HcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Confidence            48999999999999999999999999999999999999   999999999999999999999999999999999999986


Q ss_pred             c
Q psy17048         82 W   82 (103)
Q Consensus        82 ~   82 (103)
                      +
T Consensus        78 ~   78 (78)
T PF07297_consen   78 A   78 (78)
T ss_pred             C
Confidence            4


No 2  
>KOG3488|consensus
Probab=99.96  E-value=3.8e-29  Score=170.68  Aligned_cols=77  Identities=29%  Similarity=0.502  Sum_probs=75.0

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHhhcccccCCccccccccccCChhhHHHHHHHHHHHHHHHHHHHHhhhhhhcCCcc
Q psy17048          2 LEDSTIGKLILAFTCICFLYYTLWVFATPFIEPDTAILDIRYYFPPIQYALIIPCALISGLIGCLYAFTCTFYITAYTKI   81 (103)
Q Consensus         2 ~~Dr~vG~~lL~~~~~iF~YYtvWv~vlPFvd~D~~i~~~~~lFpPr~yAi~lP~~lllv~l~~vg~Fig~~lI~~~~k~   81 (103)
                      +.||.+|+.+..+++++|+|||+||+++||+|++|.+|   +||.||+|||.+|+..++.+++.+|+|++++|++++||+
T Consensus         3 ~~d~~vgl~lv~iSl~iFtYYT~WViilPFvDs~hiih---KyFLpr~yAi~iPvaagl~ll~lig~Fis~vMlKskkKK   79 (81)
T KOG3488|consen    3 GTDQVVGLMLVYISLAIFTYYTIWVIILPFVDSMHIIH---KYFLPREYAITIPVAAGLFLLCLIGTFISLVMLKSKKKK   79 (81)
T ss_pred             chhhhhhHHHHHHHHHHHHHHHHHHhhhcccchhHHHH---HHhcChhHHhhhHHHHHHHHHHHHHHHHHHHhhhccccc
Confidence            68999999999999999999999999999999999999   999999999999999999999999999999999998765


No 3  
>PF08510 PIG-P:  PIG-P;  InterPro: IPR013717 PIG-P (phosphatidylinositol N-acetylglucosaminyltransferase subunit P) is an enzyme involved in GPI anchor biosynthesis []. 
Probab=97.31  E-value=0.00099  Score=47.47  Aligned_cols=62  Identities=24%  Similarity=0.538  Sum_probs=44.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhccc--ccCCccccccccccCChhhHHHHHHHHHHHHHHHHHHHHhhhh
Q psy17048          7 IGKLILAFTCICFLYYTLWVFATPF--IEPDTAILDIRYYFPPIQYALIIPCALISGLIGCLYAFTCTFY   74 (103)
Q Consensus         7 vG~~lL~~~~~iF~YYtvWv~vlPF--vd~D~~i~~~~~lFpPr~yAi~lP~~lllv~l~~vg~Fig~~l   74 (103)
                      =|+..-+.+.++|+=|.+|.+ +|=  .+. --+    .++|.|.||+.+|+.+++..+....+..++-+
T Consensus         6 YGFv~~i~s~~~~~lyl~Wa~-lP~~~L~~-lgi----ty~P~kyWAlaiP~~~l~~~l~~~~~y~~~N~   69 (126)
T PF08510_consen    6 YGFVLYILSTVAFVLYLLWAF-LPDEWLHS-LGI----TYYPDKYWALAIPSWLLMAMLFTYVGYPAYNL   69 (126)
T ss_pred             eehHHHHHHHHHHHHHHHHHh-cCHHHHHh-cCc----cccCcchHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            378888899999999999995 442  222 112    59999999999999998855554444444433


No 4  
>KOG2257|consensus
Probab=96.86  E-value=0.0031  Score=47.21  Aligned_cols=72  Identities=21%  Similarity=0.406  Sum_probs=56.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhcc--cccCCccccccccccCChhhHHHHHHHHHHHHHHHHHHHHhhhhhhcCCcccee
Q psy17048          7 IGKLILAFTCICFLYYTLWVFATP--FIEPDTAILDIRYYFPPIQYALIIPCALISGLIGCLYAFTCTFYITAYTKIWCE   84 (103)
Q Consensus         7 vG~~lL~~~~~iF~YYtvWv~vlP--Fvd~D~~i~~~~~lFpPr~yAi~lP~~lllv~l~~vg~Fig~~lI~~~~k~~~~   84 (103)
                      -|+.+-..+.+.|+=|.+|.+ +|  +.+. -.++    ++|+|-||+.+|..+++..+...-..+|+=.....|+.++-
T Consensus        10 YgF~~yiv~~~~~ViylIWai-~P~~~l~~-~gi~----y~Psk~WalAip~~l~v~~l~~~v~ll~~N~e~tt~pl~Sl   83 (135)
T KOG2257|consen   10 YGFVLYIVSWTLFVIYLIWAI-TPVPILES-LGIT----YYPSKYWALAIPTYLLVAVLLAYVFLLGYNFESTTKPLDSL   83 (135)
T ss_pred             hhhHHHHHHHHHHHHHHHhhc-ccHHHHhh-cCce----eehHHHHHHHHHHHHHHHHHHHHHHHHhcCccccCCCCcch
Confidence            478888899999999999995 44  3322 2366    99999999999999999888877777777776666665553


No 5  
>PF10510 PIG-S:  Phosphatidylinositol-glycan biosynthesis class S protein;  InterPro: IPR019540 Phosphatidylinositol-glycan biosynthesis class S protein (PIG-S) is one of several key, core components of the glycosylphosphatidylinositol (GPI) trans-amidase complex that mediates GPI anchoring in the endoplasmic reticulum. Anchoring occurs when a protein's C-terminal GPI attachment signal peptide is replaced with a pre-assembled GPI []. Mammalian GPI transamidase consists of at least five components: Gaa1, Gpi8, PIG-S, PIG-T, and PIG-U, all five of which are required for its function. It is possible that Gaa1, Gpi8, PIG-S, and PIG-T form a tightly associated core that is only weakly associated with PIG-U. The exact function of PIG-S is unclear []. 
Probab=87.48  E-value=0.28  Score=41.90  Aligned_cols=40  Identities=23%  Similarity=0.288  Sum_probs=30.2

Q ss_pred             ccccCCccccccccccC-ChhhHHHHHHHHHHHHHHHHHHHHhh
Q psy17048         30 PFIEPDTAILDIRYYFP-PIQYALIIPCALISGLIGCLYAFTCT   72 (103)
Q Consensus        30 PFvd~D~~i~~~~~lFp-Pr~yAi~lP~~lllv~l~~vg~Fig~   72 (103)
                      =|+|++-.-+   .||| .++|||++|.++=+..-.++|.+=-+
T Consensus       468 AFfd~sml~~---lyFP~EhK~AVY~PLf~Pi~~pl~~~~~~~~  508 (517)
T PF10510_consen  468 AFFDPSMLQQ---LYFPDEHKYAVYLPLFGPISVPLLLGLLKEL  508 (517)
T ss_pred             HhCCHhhhhh---ccCChhheeEeeehhhHHHHHHHHHHHHHHH
Confidence            3777777667   8999 99999999999777666655554433


No 6  
>KOG2459|consensus
Probab=64.37  E-value=2.2  Score=38.10  Aligned_cols=31  Identities=32%  Similarity=0.490  Sum_probs=23.8

Q ss_pred             cccCCccccccccccC-ChhhHHHHHHHHHHHHHH
Q psy17048         31 FIEPDTAILDIRYYFP-PIQYALIIPCALISGLIG   64 (103)
Q Consensus        31 Fvd~D~~i~~~~~lFp-Pr~yAi~lP~~lllv~l~   64 (103)
                      |+|..---+   .||| .++|||++|.++=++.-.
T Consensus       487 fFdpSll~~---lYFPdEqk~AVYiPLf~PI~vpi  518 (536)
T KOG2459|consen  487 FFDPSLLAQ---LYFPDEQKYAVYIPLFLPIVVPI  518 (536)
T ss_pred             cCCHHHHHH---hhCCchheeEEeehhhhhHHHHH
Confidence            566655566   7999 999999999987665443


No 7  
>PF00032 Cytochrom_B_C:  Cytochrome b(C-terminal)/b6/petD;  InterPro: IPR005798 In the mitochondrion of eukaryotes and in aerobic prokaryotes, cytochrome b is a component of respiratory chain complex III (1.10.2.2 from EC) - also known as the bc1 complex or ubiquinol-cytochrome c reductase. In plant chloroplasts and cyanobacteria, there is a analogous protein, cytochrome b6, a component of the plastoquinone-plastocyanin reductase (1.10.99.1 from EC), also known as the b6f complex. Cytochrome b/b6 [, ] is an integral membrane protein of approximately 400 amino acid residues that probably has 8 transmembrane segments. In plants and cyanobacteria, cytochrome b6 consists of two subunits encoded by the petB and petD genes. The sequence of petB is colinear with the N-terminal part of mitochondrial cytochrome b, while petD corresponds to the C-terminal part. Cytochrome b/b6 non-covalently binds two haem groups, known as b562 and b566. Four conserved histidine residues are postulated to be the ligands of the iron atoms of these two haem groups. Apart from regions around some of the histidine haem ligands, there are a few conserved regions in the sequence of b/b6. The best conserved of these regions includes an invariant P-E-W triplet which lies in the loop that separates the fifth and sixth transmembrane segments. It seems to be important for electron transfer at the ubiquinone redox site - called Qz or Qo (where o stands for outside) - located on the outer side of the membrane. This entry is the C terminus of these proteins.; GO: 0009055 electron carrier activity, 0016491 oxidoreductase activity, 0016020 membrane; PDB: 2E76_B 2D2C_B 1VF5_B 2E74_B 2E75_B 2ZT9_B 2YIU_D 1Q90_D 1ZRT_C 1PPJ_P ....
Probab=61.73  E-value=31  Score=23.30  Aligned_cols=30  Identities=13%  Similarity=0.329  Sum_probs=19.2

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHhhcccccCCcccc
Q psy17048          3 EDSTIGKLILAFTCICFLYYTLWVFATPFIEPDTAIL   39 (103)
Q Consensus         3 ~Dr~vG~~lL~~~~~iF~YYtvWv~vlPFvd~D~~i~   39 (103)
                      .||..|.++...+.++      + +.+|++|.+..-+
T Consensus        28 p~k~~Gv~~~~~~~~~------l-~~lP~ld~~~~~~   57 (102)
T PF00032_consen   28 PNKLGGVIAMGLSILI------L-FLLPFLDRSPVRS   57 (102)
T ss_dssp             SSHHHHHHHHHHHHHH------H-HTHHHHTSCSSSS
T ss_pred             ccccceeeecchhhhh------H-HHHHhhcchhhhh
Confidence            4677787776554432      2 3799999776533


No 8  
>PF14150 YesK:  YesK-like protein
Probab=54.70  E-value=11  Score=25.91  Aligned_cols=22  Identities=36%  Similarity=0.445  Sum_probs=17.7

Q ss_pred             ccccCChhhHHHHHHHHHHHHH
Q psy17048         42 RYYFPPIQYALIIPCALISGLI   63 (103)
Q Consensus        42 ~~lFpPr~yAi~lP~~lllv~l   63 (103)
                      |+-||+|++...+|..+.++.+
T Consensus        20 r~r~p~k~~~~il~~ililis~   41 (81)
T PF14150_consen   20 RKRFPKKQPEIILPLILILISL   41 (81)
T ss_pred             HHhCCCcchhHHHHHHHHHHHH
Confidence            4899999999999976665554


No 9  
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=40.58  E-value=14  Score=26.69  Aligned_cols=14  Identities=21%  Similarity=0.007  Sum_probs=10.4

Q ss_pred             hhhhhcCCccceec
Q psy17048         72 TFYITAYTKIWCEH   85 (103)
Q Consensus        72 ~~lI~~~~k~~~~~   85 (103)
                      |++||+++|..-+|
T Consensus        17 yf~iRPQkKr~Ke~   30 (113)
T PRK06531         17 FFMQRQQKKQAQER   30 (113)
T ss_pred             HheechHHHHHHHH
Confidence            46899998876555


No 10 
>PF07178 TraL:  TraL protein;  InterPro: IPR009838 This entry represents bacterial TraL proteins. TraL is a predicted peripheral membrane protein involved in bacterial sex pilus assembly []. TraL is part of the type IV secretion system for conjugative plasmid transfer []. The exact function of TraL is unknown.; GO: 0000746 conjugation, 0019867 outer membrane
Probab=40.56  E-value=25  Score=23.79  Aligned_cols=47  Identities=17%  Similarity=0.159  Sum_probs=31.8

Q ss_pred             ccCChhhHHHHHHHHHHHHHHH--HHHHHhhhhhhcCCccceecceeeE
Q psy17048         44 YFPPIQYALIIPCALISGLIGC--LYAFTCTFYITAYTKIWCEHHTTFL   90 (103)
Q Consensus        44 lFpPr~yAi~lP~~lllv~l~~--vg~Fig~~lI~~~~k~~~~~~~~~~   90 (103)
                      .++.-|.++.+..+..-+..+.  +|..+|...-...+|-|..++..++
T Consensus        17 ~~~~De~~~~~~~~~~gi~~~~~~~g~i~g~~~~~~~~k~K~~~~~g~l   65 (95)
T PF07178_consen   17 FWPMDEFIPALILFVIGILSGHFLIGLILGIVLWWGYRKFKKGRGRGFL   65 (95)
T ss_pred             eecHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHccCCccHH
Confidence            6677788777776655444444  6777777777777777777776554


No 11 
>PF07811 TadE:  TadE-like protein;  InterPro: IPR012495 The members of this family are similar to a region of the protein product of the bacterial tadE locus (Q9S4A6 from SWISSPROT). In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces []. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria []. All tad loci but TadA have putative transmembrane regions [], and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues. 
Probab=39.99  E-value=67  Score=17.96  Aligned_cols=16  Identities=25%  Similarity=0.393  Sum_probs=12.5

Q ss_pred             hhHHHHHHHHHHHHHH
Q psy17048         49 QYALIIPCALISGLIG   64 (103)
Q Consensus        49 ~yAi~lP~~lllv~l~   64 (103)
                      |+++..|+++++....
T Consensus         6 Efalv~Pvl~~~~~~~   21 (43)
T PF07811_consen    6 EFALVLPVLLLLLFGI   21 (43)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            7899999998666544


No 12 
>PF15102 TMEM154:  TMEM154 protein family
Probab=39.27  E-value=17  Score=27.60  Aligned_cols=18  Identities=22%  Similarity=0.351  Sum_probs=12.5

Q ss_pred             hhHHHHHHHHHHHHHHHH
Q psy17048         49 QYALIIPCALISGLIGCL   66 (103)
Q Consensus        49 ~yAi~lP~~lllv~l~~v   66 (103)
                      -.-|.||.+++++++..+
T Consensus        58 iLmIlIP~VLLvlLLl~v   75 (146)
T PF15102_consen   58 ILMILIPLVLLVLLLLSV   75 (146)
T ss_pred             EEEEeHHHHHHHHHHHHH
Confidence            345789987777766655


No 13 
>PRK13707 conjugal transfer pilus assembly protein TraL; Provisional
Probab=38.10  E-value=25  Score=24.63  Aligned_cols=48  Identities=8%  Similarity=-0.123  Sum_probs=27.8

Q ss_pred             ccCChhhHH-HHHHHHHHH-HHHHHHHHHhhhhhhcCCccceecceeeEE
Q psy17048         44 YFPPIQYAL-IIPCALISG-LIGCLYAFTCTFYITAYTKIWCEHHTTFLI   91 (103)
Q Consensus        44 lFpPr~yAi-~lP~~lllv-~l~~vg~Fig~~lI~~~~k~~~~~~~~~~~   91 (103)
                      .+|..|-.+ .+|...++. +-.++|..+|...-...||.|..+|..++.
T Consensus        23 ~~~~DE~~~~~~~~~~Gi~~~~~l~g~i~g~~~~~~~r~lK~g~g~~~l~   72 (101)
T PRK13707         23 GLPLDELIPAAICIGWGITTSKYLFGIIAAVLVWFGIRKLKKGRGSSWLR   72 (101)
T ss_pred             eeeHHHHHHHHHHHHHHHHHchHHHHHHHHHHHHHHHHHHHcCCChhHHH
Confidence            556555553 344332222 223567777777777777777777776653


No 14 
>PF14610 DUF4448:  Protein of unknown function (DUF4448)
Probab=37.95  E-value=12  Score=27.81  Aligned_cols=22  Identities=14%  Similarity=0.137  Sum_probs=17.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Q psy17048         49 QYALIIPCALISGLIGCLYAFT   70 (103)
Q Consensus        49 ~yAi~lP~~lllv~l~~vg~Fi   70 (103)
                      .-||.+|++++++++++.+.+.
T Consensus       159 ~laI~lPvvv~~~~~~~~~~~~  180 (189)
T PF14610_consen  159 ALAIALPVVVVVLALIMYGFFF  180 (189)
T ss_pred             eEEEEccHHHHHHHHHHHhhhe
Confidence            6789999999887777665543


No 15 
>PTZ00046 rifin; Provisional
Probab=36.18  E-value=17  Score=31.00  Aligned_cols=43  Identities=14%  Similarity=0.101  Sum_probs=30.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhhhcCCccceecceeeEEeee
Q psy17048         50 YALIIPCALISGLIGCLYAFTCTFYITAYTKIWCEHHTTFLILLN   94 (103)
Q Consensus        50 yAi~lP~~lllv~l~~vg~Fig~~lI~~~~k~~~~~~~~~~~~~~   94 (103)
                      -||...+++.++.+..  ..+-|+.+|=.||+++++...+.=|||
T Consensus       315 taIiaSiiAIvVIVLI--MvIIYLILRYRRKKKMkKKLQYiKLL~  357 (358)
T PTZ00046        315 TAIIASIVAIVVIVLI--MVIIYLILRYRRKKKMKKKLQYIKLLE  357 (358)
T ss_pred             HHHHHHHHHHHHHHHH--HHHHHHHHHhhhcchhHHHHHHHHHhc
Confidence            4566666665555442  367799999999999998877666655


No 16 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=34.93  E-value=27  Score=24.53  Aligned_cols=18  Identities=6%  Similarity=-0.038  Sum_probs=7.4

Q ss_pred             HHHHHHHhhhhhhcCCcc
Q psy17048         64 GCLYAFTCTFYITAYTKI   81 (103)
Q Consensus        64 ~~vg~Fig~~lI~~~~k~   81 (103)
                      +++..|++...++..|+.
T Consensus        11 ~i~l~~~~~~~~~rRR~r   28 (130)
T PF12273_consen   11 AILLFLFLFYCHNRRRRR   28 (130)
T ss_pred             HHHHHHHHHHHHHHHHhh
Confidence            333334444444444433


No 17 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=34.66  E-value=46  Score=20.33  Aligned_cols=30  Identities=13%  Similarity=-0.043  Sum_probs=21.2

Q ss_pred             ccCChhhHHHHHHHHHHHHHHHHHHHHhhhhhh
Q psy17048         44 YFPPIQYALIIPCALISGLIGCLYAFTCTFYIT   76 (103)
Q Consensus        44 lFpPr~yAi~lP~~lllv~l~~vg~Fig~~lI~   76 (103)
                      +|+-+..   +|..+.+++..++|..+|.++-.
T Consensus        11 ~~~~~~~---~pl~l~il~~f~~G~llg~l~~~   40 (68)
T PF06305_consen   11 FLFGQFP---LPLGLLILIAFLLGALLGWLLSL   40 (68)
T ss_pred             EEeeecc---chHHHHHHHHHHHHHHHHHHHHH
Confidence            5554333   78888888888888888876543


No 18 
>KOG4845|consensus
Probab=33.88  E-value=77  Score=28.10  Aligned_cols=53  Identities=17%  Similarity=0.311  Sum_probs=39.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhcccccCCccccccccccC--ChhhHHHHHHHHHHHHHH
Q psy17048         10 LILAFTCICFLYYTLWVFATPFIEPDTAILDIRYYFP--PIQYALIIPCALISGLIG   64 (103)
Q Consensus        10 ~lL~~~~~iF~YYtvWv~vlPFvd~D~~i~~~~~lFp--Pr~yAi~lP~~lllv~l~   64 (103)
                      .+.++..++=.+|+.|.+-.-  ....-.|+..++++  +||+.+.+|-++.+.+++
T Consensus       387 ~l~~i~milta~YsL~l~t~~--~~Gkl~~~~nsf~~s~~Re~~Lmi~~l~pl~~l~  441 (452)
T KOG4845|consen  387 VLIAIGMILTAAYSLYLYTSS--QMGKLYHNFNSFSDSFSRELVLMIYHLLPLSLLG  441 (452)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH--HhccccccccccCCCCCchhhhHHHHHHHHHhhe
Confidence            445566677789999996333  33344567778999  999999999998887765


No 19 
>CHL00058 petD cytochrome b6/f complex subunit IV
Probab=33.21  E-value=92  Score=23.80  Aligned_cols=30  Identities=20%  Similarity=0.337  Sum_probs=18.6

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHhhcccccCCcccc
Q psy17048          3 EDSTIGKLILAFTCICFLYYTLWVFATPFIEPDTAIL   39 (103)
Q Consensus         3 ~Dr~vG~~lL~~~~~iF~YYtvWv~vlPFvd~D~~i~   39 (103)
                      .+|+.|.+.++.+.       +..+++||+|.-++.|
T Consensus        92 P~Kl~Gv~~m~~~~-------~~L~~lP~l~~~~~~~  121 (160)
T CHL00058         92 PNKLLGVLLMASVP-------AGLLTVPFLENVNKFQ  121 (160)
T ss_pred             ccchhHHHHHHHHH-------HHHHHHHHHhcccccc
Confidence            35667766554433       2445799999855555


No 20 
>PF10215 Ost4:  Oligosaccaryltransferase  ;  InterPro: IPR018943  Ost4 is a very short, approximately 30 residues, enzyme found from fungi to vertebrates. It is a member of the ER oligosaccaryltansferase complex, 2.4.1.119 from EC, that catalyses the asparagine-linked glycosylation of proteins. It appears to be an integral membrane protein that mediates the en bloc transfer of a pre-assembled high-mannose oligosaccharide onto asparagine residues of nascent polypeptides as they enter the lumen of the rough endoplasmic reticulum. ; PDB: 1RKL_A 2LAT_A.
Probab=33.11  E-value=74  Score=18.80  Aligned_cols=27  Identities=4%  Similarity=-0.144  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHhhhhhhcCCccc
Q psy17048         56 CALISGLIGCLYAFTCTFYITAYTKIW   82 (103)
Q Consensus        56 ~~lllv~l~~vg~Fig~~lI~~~~k~~   82 (103)
                      .++...|++....-+.||.+.++.|.|
T Consensus         9 ~lan~lG~~~~~LIVlYH~v~~n~~~~   35 (35)
T PF10215_consen    9 TLANFLGVAAMVLIVLYHFVEVNAKDK   35 (35)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCH-TT-
T ss_pred             HHHHHHHHHHHHHHHHHHHhhcccCCC
Confidence            345556667777778899999987754


No 21 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=32.86  E-value=21  Score=30.48  Aligned_cols=43  Identities=14%  Similarity=0.083  Sum_probs=30.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhhhcCCccceecceeeEEeee
Q psy17048         50 YALIIPCALISGLIGCLYAFTCTFYITAYTKIWCEHHTTFLILLN   94 (103)
Q Consensus        50 yAi~lP~~lllv~l~~vg~Fig~~lI~~~~k~~~~~~~~~~~~~~   94 (103)
                      -||...+++.++.+..  ..+-|+.+|=.||+++++...+.-|||
T Consensus       310 t~IiaSiIAIvvIVLI--MvIIYLILRYRRKKKMkKKLQYiKLL~  352 (353)
T TIGR01477       310 TPIIASIIAILIIVLI--MVIIYLILRYRRKKKMKKKLQYIKLLN  352 (353)
T ss_pred             HHHHHHHHHHHHHHHH--HHHHHHHHHhhhcchhHHHHHHHHHhc
Confidence            3555555555554442  367799999999999998877666665


No 22 
>PF08183 SpoV:  Stage V sporulation protein family;  InterPro: IPR012609 This family consists of the stage V sporulation (SpoV) proteins of Bacillus subtilis which includes SpoVM. SpoVM is an small, 26 residue-long protein that is produced in the mother cell chamber of the sporangium during the process of sporulation in B. subtilis. SpoVM forms an amphipathic alpha-helix and is recruited to the polar septum shortly after the sporangium undergoes asymmetric division. The function of SpoVM depends on proper subcellular localisation [].
Probab=32.58  E-value=28  Score=19.69  Aligned_cols=22  Identities=23%  Similarity=0.333  Sum_probs=15.1

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHH
Q psy17048         48 IQYALIIPCALISGLIGCLYAF   69 (103)
Q Consensus        48 r~yAi~lP~~lllv~l~~vg~F   69 (103)
                      +.|+|.+|=+++-+.=.++++|
T Consensus         2 KfYtIKLpkf~Gg~v~~~L~sf   23 (26)
T PF08183_consen    2 KFYTIKLPKFLGGVVRALLFSF   23 (26)
T ss_pred             CceeeechHHHhHHHHHHHHHH
Confidence            4689999988876554545444


No 23 
>PF11821 DUF3341:  Protein of unknown function (DUF3341);  InterPro: IPR021776  This family of proteins are functionally uncharacterised. This family is found in bacteria. Proteins in this family are about 170 amino acids in length. 
Probab=32.20  E-value=2.2e+02  Score=21.68  Aligned_cols=55  Identities=18%  Similarity=0.189  Sum_probs=38.6

Q ss_pred             HHHHHHHHHHHHHHhhcccccCCccccccccccCChhhHHHHHHHHHHHHHHHHHHHHhhhhhh
Q psy17048         13 AFTCICFLYYTLWVFATPFIEPDTAILDIRYYFPPIQYALIIPCALISGLIGCLYAFTCTFYIT   76 (103)
Q Consensus        13 ~~~~~iF~YYtvWv~vlPFvd~D~~i~~~~~lFpPr~yAi~lP~~lllv~l~~vg~Fig~~lI~   76 (103)
                      +++.....|||.++ =-|..-...|.+   ++ |    |.+.+.+=+.++++.+++++|++..+
T Consensus        64 ~~~~~~l~~~t~~~-dyP~~iGGKP~~---S~-P----afipi~FEltVL~aa~~~~~g~l~~~  118 (173)
T PF11821_consen   64 FATAFLLQWYTNAV-DYPLNIGGKPLF---SW-P----AFIPITFELTVLFAALGTVLGMLILN  118 (173)
T ss_pred             HHHHHHHHHHHHhc-ccceecCCCCCC---CC-c----ccchHHHHHHHHHHHHHHHHHHHHHc
Confidence            34556677888877 479999888877   44 2    23344455777888889999888654


No 24 
>PF11874 DUF3394:  Domain of unknown function (DUF3394);  InterPro: IPR021814  This domain is functionally uncharacterised. This domain is found in bacteria. This presumed domain is about 190 amino acids in length. This domain is found associated with PF06808 from PFAM. 
Probab=31.90  E-value=28  Score=27.07  Aligned_cols=19  Identities=37%  Similarity=0.856  Sum_probs=14.4

Q ss_pred             CChhhHHHHHHHHHHHHHHH
Q psy17048         46 PPIQYALIIPCALISGLIGC   65 (103)
Q Consensus        46 pPr~yAi~lP~~lllv~l~~   65 (103)
                      ||.+| +++|+++++.++..
T Consensus       156 p~ke~-~yiPAlLLL~lv~~  174 (183)
T PF11874_consen  156 PPKEW-VYIPALLLLGLVAW  174 (183)
T ss_pred             CCcce-EeHHHHHHHHHHHH
Confidence            45566 99999998877653


No 25 
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=30.84  E-value=29  Score=24.86  Aligned_cols=15  Identities=13%  Similarity=-0.082  Sum_probs=10.1

Q ss_pred             hhhhhhcCCccceec
Q psy17048         71 CTFYITAYTKIWCEH   85 (103)
Q Consensus        71 g~~lI~~~~k~~~~~   85 (103)
                      -+++||+++|..-+|
T Consensus        18 yF~~iRPQkKr~K~~   32 (109)
T PRK05886         18 MYFASRRQRKAMQAT   32 (109)
T ss_pred             HHHHccHHHHHHHHH
Confidence            367799997765443


No 26 
>PRK05113 electron transport complex protein RnfB; Provisional
Probab=30.05  E-value=65  Score=24.35  Aligned_cols=32  Identities=9%  Similarity=-0.076  Sum_probs=25.9

Q ss_pred             HHHHHHHHHHHHHHhhhhhhcCCccceeccee
Q psy17048         57 ALISGLIGCLYAFTCTFYITAYTKIWCEHHTT   88 (103)
Q Consensus        57 ~lllv~l~~vg~Fig~~lI~~~~k~~~~~~~~   88 (103)
                      +.-++.++++|..+|+++--++|+-+.|+..+
T Consensus         5 ~~~~~~~~~lg~~~g~~l~~a~~~~~ve~dp~   36 (191)
T PRK05113          5 WIAVAALSLLALVFGAILGFASRRFKVEGDPI   36 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCccccCCCh
Confidence            44556677788999999999999999888765


No 27 
>PF07787 DUF1625:  Protein of unknown function (DUF1625);  InterPro: IPR012430 Sequences making up this family are derived from hypothetical proteins expressed by both prokaryotic and eukaryotic species. The region in question is approximately 250 residues long. 
Probab=29.11  E-value=2.7e+02  Score=21.47  Aligned_cols=30  Identities=13%  Similarity=0.114  Sum_probs=20.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHh-hccccc
Q psy17048          4 DSTIGKLILAFTCICFLYYTLWVF-ATPFIE   33 (103)
Q Consensus         4 Dr~vG~~lL~~~~~iF~YYtvWv~-vlPFvd   33 (103)
                      -|.+|.+++.+++.+..-..-++. ..|++.
T Consensus       186 lR~~G~llmf~G~~~~~~~l~~l~~~~P~lg  216 (248)
T PF07787_consen  186 LRFIGWLLMFIGFFLLFSPLYTLVDWIPLLG  216 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhceee
Confidence            378999999888776665544443 566654


No 28 
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=26.92  E-value=48  Score=20.90  Aligned_cols=27  Identities=11%  Similarity=-0.122  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHhhhhhhcCCccceecc
Q psy17048         60 SGLIGCLYAFTCTFYITAYTKIWCEHH   86 (103)
Q Consensus        60 lv~l~~vg~Fig~~lI~~~~k~~~~~~   86 (103)
                      ++.+-++..-+|....+-+||..++|-
T Consensus         6 iV~i~iv~~lLg~~I~~~~K~ygYkht   32 (50)
T PF12606_consen    6 IVSIFIVMGLLGLSICTTLKAYGYKHT   32 (50)
T ss_pred             HHHHHHHHHHHHHHHHHHhhccccccc
Confidence            344444444555555666677666543


No 29 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=26.66  E-value=91  Score=22.72  Aligned_cols=40  Identities=10%  Similarity=-0.049  Sum_probs=19.2

Q ss_pred             ccC-ChhhHHHHHHHHHHHHHHHHHHHHhhhhhhcCCccceecc
Q psy17048         44 YFP-PIQYALIIPCALISGLIGCLYAFTCTFYITAYTKIWCEHH   86 (103)
Q Consensus        44 lFp-Pr~yAi~lP~~lllv~l~~vg~Fig~~lI~~~~k~~~~~~   86 (103)
                      =|. |---.|++=++++++|   +..++.|.+-|..||....-+
T Consensus        60 ~fs~~~i~~Ii~gv~aGvIg---~Illi~y~irR~~Kk~~~~~~  100 (122)
T PF01102_consen   60 RFSEPAIIGIIFGVMAGVIG---IILLISYCIRRLRKKSSSDVQ  100 (122)
T ss_dssp             SSS-TCHHHHHHHHHHHHHH---HHHHHHHHHHHHS--------
T ss_pred             CccccceeehhHHHHHHHHH---HHHHHHHHHHHHhccCCCCCC
Confidence            455 5445555555555555   345777777777777655444


No 30 
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein. Members of this protein family are homologs of the HlyD membrane fusion protein of type I secretion systems. Their occurrence in prokaryotic genomes is associated with the occurrence of a novel class of microcin (small bacteriocins) with a propeptide region related to nitrile hydratase. We designate the class of bacteriocin as Nitrile Hydratase Propeptide Microcin, or NHPM. This family, therefore, is designated as NHPM bacteriocin system secretion protein. Some but not all NHPM-class putative microcins belong to the TOMM (thiazole/oxazole modified microcin) class as assessed by the presence of the scaffolding protein and/or cyclodehydratase in the same gene clusters.
Probab=26.25  E-value=63  Score=26.44  Aligned_cols=27  Identities=11%  Similarity=0.071  Sum_probs=18.5

Q ss_pred             CCccccccccccCChhhHHHHHHHHHHHHHH
Q psy17048         34 PDTAILDIRYYFPPIQYALIIPCALISGLIG   64 (103)
Q Consensus        34 ~D~~i~~~~~lFpPr~yAi~lP~~lllv~l~   64 (103)
                      -||.+.    ..+|+.|.+.+-++++++++.
T Consensus         8 ~~~~~~----~~~p~~~~~~~~~~~~~~~~l   34 (421)
T TIGR03794         8 LDQLVQ----VVSPRSWLALAALGVIVVAAL   34 (421)
T ss_pred             Hhhhhe----eccHHHHHHHHHHHHHHHHHH
Confidence            466666    889999998877744444333


No 31 
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=25.29  E-value=1e+02  Score=20.09  Aligned_cols=23  Identities=17%  Similarity=0.122  Sum_probs=15.9

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhh
Q psy17048         53 IIPCALISGLIGCLYAFTCTFYI   75 (103)
Q Consensus        53 ~lP~~lllv~l~~vg~Fig~~lI   75 (103)
                      .+|+++.+.+-++.+++.++..+
T Consensus         6 l~PL~~~vg~a~~~a~~~~~r~l   28 (73)
T PF06522_consen    6 LYPLFVIVGVAVGGATFYLYRLL   28 (73)
T ss_pred             ccchHHHHHHHHHHHHHHHHHHH
Confidence            46888777777777777766655


No 32 
>TIGR01156 cytb6/f_IV cytochrome b6/f complex subunit IV. This model describes the subunit IV of the cytochrome b6/f complex. The cyt b6/f complex is central to the functions of the oxygenic phosynthetic electron transport in cyanobacteria and its equivalents in algae and higher plants. Energetically, on the redox scale the cytb6/f complex is placed below the other components - Q(A); Q(B) of the photosystem II in the Z-scheme, along the pathway of the electron transport. The complex is made of the following subunits: cytochrome f; cytochrome b6; Rieske 2Fe-2S; and subunits IV; V; VI; VII. Subunit IV is one of the principal subunits for the binding of the redox prosthetic groups. Each monomer of the complex contains a molecule of chlorophyll a and beta-carotene.
Probab=25.24  E-value=1.5e+02  Score=22.60  Aligned_cols=30  Identities=23%  Similarity=0.356  Sum_probs=17.8

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHhhcccccCCcccc
Q psy17048          3 EDSTIGKLILAFTCICFLYYTLWVFATPFIEPDTAIL   39 (103)
Q Consensus         3 ~Dr~vG~~lL~~~~~iF~YYtvWv~vlPFvd~D~~i~   39 (103)
                      .++..|.+++..+.       +-.+++||+|..++.+
T Consensus        92 P~kl~Gvl~m~~~i-------~~L~llPfld~~~~~~  121 (159)
T TIGR01156        92 PNKLLGVLLMAAVP-------AGLLTVPFIENVNKFQ  121 (159)
T ss_pred             cchHHHHHHHHHHH-------HHHHHHHHHhcccccc
Confidence            35666655554222       2345799999866544


No 33 
>PF09604 Potass_KdpF:  F subunit of K+-transporting ATPase (Potass_KdpF);  InterPro: IPR011726 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents the F subunit (KdpF) of a P-type K+-translocating ATPase (Kdp). KdpF is a very small integral membrane peptide. The kdpABC operon of Escherichia coli codes for the high affinity K+-translocating Kdp complex []. KdpF is found upstream of the KdpA subunit (IPR004623 from INTERPRO). Because of its very small size and highly hydrophobic character, it is sometimes missed in genome annotation. More information about this protein can be found at Protein of the Month: ATP Synthases [].
Probab=24.42  E-value=1.2e+02  Score=16.64  Aligned_cols=21  Identities=5%  Similarity=-0.036  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHhhhhhhcCC
Q psy17048         59 ISGLIGCLYAFTCTFYITAYT   79 (103)
Q Consensus        59 llv~l~~vg~Fig~~lI~~~~   79 (103)
                      +.+...++..++.+.++++.|
T Consensus         4 ~~~v~~~L~~YL~~aLl~PEr   24 (25)
T PF09604_consen    4 GGIVAVALFVYLFYALLRPER   24 (25)
T ss_pred             HHHHHHHHHHHHHHHHhCccc
Confidence            334444567788899998854


No 34 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=24.25  E-value=97  Score=23.08  Aligned_cols=27  Identities=15%  Similarity=-0.044  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHhhhhhhcCCcccee
Q psy17048         58 LISGLIGCLYAFTCTFYITAYTKIWCE   84 (103)
Q Consensus        58 lllv~l~~vg~Fig~~lI~~~~k~~~~   84 (103)
                      .+...+.++|.|+.-.=|.+|||.|..
T Consensus        41 ~Ls~vvlvi~~~LLgrsi~ANRnrK~~   67 (125)
T PF15048_consen   41 ALSFVVLVISFFLLGRSIQANRNRKMQ   67 (125)
T ss_pred             HHHHHHHHHHHHHHHHHhHhccccccc
Confidence            344445556667766677787776654


No 35 
>COG3671 Predicted membrane protein [Function unknown]
Probab=24.15  E-value=42  Score=25.10  Aligned_cols=29  Identities=14%  Similarity=0.064  Sum_probs=19.4

Q ss_pred             HHHHHHHHHhhhhhhcCCccceecceeeEE
Q psy17048         62 LIGCLYAFTCTFYITAYTKIWCEHHTTFLI   91 (103)
Q Consensus        62 ~l~~vg~Fig~~lI~~~~k~~~~~~~~~~~   91 (103)
                      ....+|.+.+|+=.. +.++..++|++|+|
T Consensus        39 it~lvgvi~AYv~rd-~~~~~~~SHy~f~i   67 (125)
T COG3671          39 ITPLVGVIFAYVNRD-KADSIAASHYEFLI   67 (125)
T ss_pred             HHHHHHHHHHhcccc-cccchHHHHHHHHH
Confidence            444566666665433 67778889998875


No 36 
>PF06027 DUF914:  Eukaryotic protein of unknown function (DUF914);  InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function. Some of the sequences in this family are annotated as putative membrane proteins.
Probab=24.14  E-value=3e+02  Score=22.86  Aligned_cols=25  Identities=24%  Similarity=0.470  Sum_probs=18.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhc
Q psy17048          5 STIGKLILAFTCICFLYYTLWVFAT   29 (103)
Q Consensus         5 r~vG~~lL~~~~~iF~YYtvWv~vl   29 (103)
                      ..++..++..+...|.+|+.+-+++
T Consensus       230 ~~~~~~~v~~~~~lf~~y~l~p~~l  254 (334)
T PF06027_consen  230 SQVIGLLVGYALCLFLFYSLVPIVL  254 (334)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            3445566777889999999887654


No 37 
>PF05328 CybS:  CybS;  InterPro: IPR007992 This family consists of several eukaryotic succinate dehydrogenase [ubiquinone] cytochrome B small subunit, mitochondrial precursor (CybS) proteins. SDHD encodes the small subunit (cybS) of cytochrome b in succinate-ubiquinone oxidoreductase (mitochondrial complex II). Mitochondrial complex II is involved in the Krebs cycle and in the aerobic electron transport chain. It contains four proteins. The catalytic core consists of a flavoprotein and an iron-sulphur protein; these proteins are anchored to the mitochondrial inner membrane by the large subunit of cytochrome b (cybL) and cybS, which together comprise the haem-protein cytochrome b. Mutations in the SDHD gene can lead to hereditary paraganglioma, characterised by the development of benign, vascularised tumours in the head and neck [].; GO: 0005506 iron ion binding, 0020037 heme binding, 0006099 tricarboxylic acid cycle, 0005740 mitochondrial envelope, 0016021 integral to membrane; PDB: 3AE7_D 3AEB_D 3AEC_D 3AE6_D 3AE4_D 3AE3_D 3AEG_D 3SFD_D 3AE9_D 1ZOY_D ....
Probab=23.70  E-value=2.8e+02  Score=20.09  Aligned_cols=35  Identities=14%  Similarity=0.264  Sum_probs=18.8

Q ss_pred             cccCChhhHHHHHHHHHHHHHHHHHHHHhhhhhhc
Q psy17048         43 YYFPPIQYALIIPCALISGLIGCLYAFTCTFYITA   77 (103)
Q Consensus        43 ~lFpPr~yAi~lP~~lllv~l~~vg~Fig~~lI~~   77 (103)
                      +|+|+|.+...-+..-.....+.+.++.|...+..
T Consensus        84 DYip~~v~~~~~~~a~~~l~~~s~~~l~Gl~~~~~  118 (132)
T PF05328_consen   84 DYIPKRVFGKLHKLAMWLLYAGSALTLAGLYYFNT  118 (132)
T ss_dssp             HHS-----SHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhccccccchHHHHHHHHHHHHHHHHHHHheEEEe
Confidence            89999999966666655555555666666555544


No 38 
>PRK13476 cytochrome b6-f complex subunit IV; Provisional
Probab=23.61  E-value=1.9e+02  Score=22.12  Aligned_cols=29  Identities=21%  Similarity=0.315  Sum_probs=16.7

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhcccccCCcccc
Q psy17048          4 DSTIGKLILAFTCICFLYYTLWVFATPFIEPDTAIL   39 (103)
Q Consensus         4 Dr~vG~~lL~~~~~iF~YYtvWv~vlPFvd~D~~i~   39 (103)
                      ++..|.+.++.+.       +-.+++||+|..++.+
T Consensus        93 ~kl~Gvl~~~~~~-------~~L~~lPfld~~~~~~  121 (160)
T PRK13476         93 NKLLGIALQTLIP-------LGLMLVPFIENVNKFQ  121 (160)
T ss_pred             chHHHHHHHHHHH-------HHHHHHHHhccccccc
Confidence            5666655443222       2344799999766545


No 39 
>cd00290 cytochrome_b_C Cytochrome b(C-terminus)/b6/petD:  Cytochrome b is a subunit of cytochrome bc1, an 11-subunit mitochondrial respiratory enzyme. Cytochrome b spans the mitochondrial membrane with 8 transmembrane helices (A-H) in eukaryotes. In plants and cyanobacteria, cytochrome b6 is analogous to eukaryote cytochrome b, containing two chains: helices A-D are encoded by the petB gene and helices E-H are encoded by the petD gene in these organisms.  Cytochrome b/b6 contains two bound hemes and two ubiquinol/ubiquinone binding sites.  The C-terminal domain is involved in forming the ubiquinol/ubiquinone binding sites, but not the heme binding sites.  The N-terminal portion of cytochrome b, which contains both heme binding sites,  is described in a separate CD.
Probab=23.44  E-value=2.2e+02  Score=20.56  Aligned_cols=27  Identities=26%  Similarity=0.572  Sum_probs=17.0

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHhhcccccCCc
Q psy17048          3 EDSTIGKLILAFTCICFLYYTLWVFATPFIEPDT   36 (103)
Q Consensus         3 ~Dr~vG~~lL~~~~~iF~YYtvWv~vlPFvd~D~   36 (103)
                      .||..|.+++..+..+       .+++||+|...
T Consensus        79 p~k~~Gv~~~~~~i~~-------l~~lP~~~~~~  105 (147)
T cd00290          79 PNKLLGVLAMAASILS-------LFLVPFLENSN  105 (147)
T ss_pred             ccchHHHHHHHHHHHH-------HHHHHHHhcCC
Confidence            4677786666444332       34789998764


No 40 
>PF10211 Ax_dynein_light:  Axonemal dynein light chain;  InterPro: IPR019347  Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility. Eukaryotic cilia and flagella are complex organelles consisting of a core structure, the axoneme, which is composed of nine microtubule doublets forming a cylinder that surrounds a pair of central singlet microtubules. This ultra-structural arrangement seems to be one of the most stable micro-tubular assemblies known and is responsible for the flagellar and ciliary movement of a large number of organisms ranging from protozoan to mammals. This light chain interacts directly with the N-terminal half of the heavy chains []. 
Probab=22.73  E-value=31  Score=26.20  Aligned_cols=9  Identities=22%  Similarity=0.667  Sum_probs=8.0

Q ss_pred             cccCChhhH
Q psy17048         43 YYFPPIQYA   51 (103)
Q Consensus        43 ~lFpPr~yA   51 (103)
                      ++||||+|.
T Consensus         7 ~i~ppr~~~   15 (189)
T PF10211_consen    7 SILPPREWE   15 (189)
T ss_pred             hhCCchhhh
Confidence            899999985


No 41 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=21.87  E-value=97  Score=24.62  Aligned_cols=27  Identities=15%  Similarity=0.169  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHH-hhhhhhc
Q psy17048         51 ALIIPCALISGLIGCLYAFT-CTFYITA   77 (103)
Q Consensus        51 Ai~lP~~lllv~l~~vg~Fi-g~~lI~~   77 (103)
                      -.++|++.|+.+.+++-.-+ +|+.-|.
T Consensus       270 ~~~vPIaVG~~La~lvlivLiaYli~Rr  297 (306)
T PF01299_consen  270 SDLVPIAVGAALAGLVLIVLIAYLIGRR  297 (306)
T ss_pred             cchHHHHHHHHHHHHHHHHHHhheeEec
Confidence            68999998887766555544 4544444


No 42 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=21.45  E-value=1.2e+02  Score=21.40  Aligned_cols=32  Identities=9%  Similarity=-0.198  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHH-HHHHHhhhhhhcCCcccee
Q psy17048         53 IIPCALISGLIGC-LYAFTCTFYITAYTKIWCE   84 (103)
Q Consensus        53 ~lP~~lllv~l~~-vg~Fig~~lI~~~~k~~~~   84 (103)
                      .+|+++.++++.. +...+.+.|-+.++|....
T Consensus         2 ~Ll~il~llLll~l~asl~~wr~~~rq~k~~~~   34 (107)
T PF15330_consen    2 LLLGILALLLLLSLAASLLAWRMKQRQKKAGQY   34 (107)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhhhccccCC
Confidence            4677766664444 4445556666666655444


No 43 
>PRK14741 spoVM stage V sporulation protein M; Provisional
Probab=21.26  E-value=41  Score=18.97  Aligned_cols=22  Identities=23%  Similarity=0.187  Sum_probs=17.1

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHH
Q psy17048         48 IQYALIIPCALISGLIGCLYAF   69 (103)
Q Consensus        48 r~yAi~lP~~lllv~l~~vg~F   69 (103)
                      +.|.|.+|-+++-..=+++++|
T Consensus         2 kfytiklpkflgg~vra~l~~f   23 (26)
T PRK14741          2 KFYTIKLPKFLGGIVRAMLGSF   23 (26)
T ss_pred             ceEEEeccHHHHHHHHHHHHHh
Confidence            3578889998887777777776


No 44 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.53  E-value=72  Score=21.75  Aligned_cols=30  Identities=13%  Similarity=-0.101  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHhhhhhhcCCccceecce
Q psy17048         58 LISGLIGCLYAFTCTFYITAYTKIWCEHHT   87 (103)
Q Consensus        58 lllv~l~~vg~Fig~~lI~~~~k~~~~~~~   87 (103)
                      +++++...+|.+.|++.-|.+-|+.-++|.
T Consensus         8 l~ivl~ll~G~~~G~fiark~~~k~lk~NP   37 (71)
T COG3763           8 LLIVLALLAGLIGGFFIARKQMKKQLKDNP   37 (71)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhCC
Confidence            444555557778888777766665555543


No 45 
>PF12072 DUF3552:  Domain of unknown function (DUF3552);  InterPro: IPR022711  This presumed domain is functionally uncharacterised. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with PF00013 from PFAM, PF01966 from PFAM. This domain has a single completely conserved residue A that may be functionally important. ; GO: 0008663 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
Probab=20.28  E-value=1.1e+02  Score=23.13  Aligned_cols=20  Identities=5%  Similarity=-0.257  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHhhhhhhc
Q psy17048         58 LISGLIGCLYAFTCTFYITA   77 (103)
Q Consensus        58 lllv~l~~vg~Fig~~lI~~   77 (103)
                      +.+++..++|.++||++-+.
T Consensus         4 i~~i~~~~vG~~~G~~~~~~   23 (201)
T PF12072_consen    4 IIAIVALIVGIGIGYLVRKK   23 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            34455556788888877554


Done!