Diaphorina citri psyllid: psy17048


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MLEDSTIGKLILAFTCICFLYYTLWVFATPFIEPDTAILDIRYYFPPIQYALIIPCALISGLIGCLYAFTCTFYITAYTKIWCEHHTTFLILLNDAYLSVLLP
cccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHEEEEEEEccccccccccEEEEEEEEccEEccccc
***DSTIGKLILAFTCICFLYYTLWVFATPFIEPDTAILDIRYYFPPIQYALIIPCALISGLIGCLYAFTCTFYITAYTKIWCEHHTTFLILLNDAYLSVLLP
xxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEDSTIGKLILAFTCICFLYYTLWVFATPFIEPDTAILDIRYYFPPIQYALIIPCALISGLIGCLYAFTCTFYITAYTKIWCEHHTTFLILLNDAYLSVLLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0019348 [BP]dolichol metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0016093, GO:0009987, GO:0044237, GO:0006066, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0006720, GO:0044255, GO:1901615
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0006506 [BP]GPI anchor biosynthetic processprobableGO:0006650, GO:0044249, GO:0042157, GO:0034645, GO:0042158, GO:0044255, GO:0006629, GO:0044267, GO:0044710, GO:0044260, GO:0008150, GO:0071704, GO:0006505, GO:0045017, GO:0046467, GO:0006664, GO:0006644, GO:0006643, GO:1901576, GO:0009987, GO:0009247, GO:0006464, GO:0009058, GO:0036211, GO:0046488, GO:0008152, GO:0006661, GO:0046486, GO:0090407, GO:0008610, GO:0006497, GO:0044238, GO:0008654, GO:1901137, GO:1901135, GO:0043412, GO:0044237, GO:0043170, GO:0019538, GO:0006796, GO:0009059, GO:0006793, GO:0019637, GO:0046474
GO:0033185 [CC]dolichol-phosphate-mannose synthase complexprobableGO:0043234, GO:0031501, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004582 [MF]dolichyl-phosphate beta-D-mannosyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0000030
GO:0030234 [MF]enzyme regulator activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted