BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy17052
(68 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1J5X|A Chain A, Crystal Structure Of Glucosamine-6-Phosphate Deaminase
(Tm0813) From Thermotoga Maritima At 1.8 A Resolution
Length = 342
Score = 26.2 bits (56), Expect = 4.8, Method: Composition-based stats.
Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 3/39 (7%)
Query: 16 FVNEVRRCDEMERKLRYLEKEIKKDGIPMMDVGESPEAP 54
F +V DE E++LR KE++ G +++VGE + P
Sbjct: 265 FXQKVSGXDEQEKRLR---KELESLGATVLEVGEGGDIP 300
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.134 0.381
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,955,659
Number of Sequences: 62578
Number of extensions: 61270
Number of successful extensions: 211
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 209
Number of HSP's gapped (non-prelim): 3
length of query: 68
length of database: 14,973,337
effective HSP length: 38
effective length of query: 30
effective length of database: 12,595,373
effective search space: 377861190
effective search space used: 377861190
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)