Query         psy17052
Match_columns 68
No_of_seqs    111 out of 354
Neff          6.0 
Searched_HMMs 46136
Date          Fri Aug 16 20:36:08 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17052.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17052hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2189|consensus               99.9 6.5E-25 1.4E-29  170.0   5.5   67    1-67     36-102 (829)
  2 PF01496 V_ATPase_I:  V-type AT  99.3 2.4E-13 5.2E-18  105.0   0.0   66    1-66     11-76  (759)
  3 COG4064 MtrG Tetrahydromethano  73.5     3.5 7.7E-05   24.3   2.2   24   16-39     17-40  (75)
  4 TIGR01149 mtrG N5-methyltetrah  63.0     9.1  0.0002   22.4   2.4   24   16-39     14-37  (70)
  5 PRK01026 tetrahydromethanopter  62.9       9  0.0002   22.8   2.4   24   16-39     17-40  (77)
  6 PF04210 MtrG:  Tetrahydrometha  62.5     8.9 0.00019   22.5   2.3   25   15-39     13-37  (70)
  7 PRK00736 hypothetical protein;  48.6      46 0.00099   18.8   3.8   26   16-41     28-53  (68)
  8 PRK00295 hypothetical protein;  44.9      52  0.0011   18.6   3.6   26   16-41     28-53  (68)
  9 PF10776 DUF2600:  Protein of u  44.7      11 0.00025   27.8   1.0   39    2-40    232-270 (330)
 10 PF07304 SRA1:  Steroid recepto  44.5      25 0.00054   23.0   2.5   22   21-42     65-86  (157)
 11 COG4003 Uncharacterized protei  44.3      24 0.00053   21.6   2.3   22   17-38     38-59  (98)
 12 PF03235 DUF262:  Protein of un  43.0     9.2  0.0002   24.4   0.3   23    8-36     13-35  (221)
 13 PF11239 DUF3040:  Protein of u  42.2      15 0.00032   21.3   1.0   13   19-31      7-19  (82)
 14 PF01517 HDV_ag:  Hepatitis del  41.3      30 0.00065   23.6   2.5   26   15-40     19-44  (194)
 15 PF14182 YgaB:  YgaB-like prote  39.7      26 0.00057   20.9   1.9   21   18-38     21-41  (79)
 16 PF12240 Angiomotin_C:  Angiomo  35.4      41  0.0009   23.4   2.5   24   18-41    133-156 (205)
 17 PF09868 DUF2095:  Uncharacteri  34.9      23  0.0005   22.9   1.2   24   17-41     68-91  (128)
 18 PF06825 HSBP1:  Heat shock fac  34.9      17 0.00038   20.1   0.5   20   19-38     26-45  (54)
 19 cd02641 R3H_Smubp-2_like R3H d  32.1      24 0.00051   19.5   0.8   16    5-20     22-37  (60)
 20 KOG2775|consensus               29.5      77  0.0017   23.9   3.3   31   15-45     83-113 (397)
 21 cd06006 R3H_unknown_2 R3H doma  27.9      27 0.00059   19.5   0.6   12    9-20     25-36  (59)
 22 PF15358 TSKS:  Testis-specific  25.7      94   0.002   24.3   3.2   16   24-39    198-213 (558)
 23 COG1103 Archaea-specific pyrid  25.4      70  0.0015   23.9   2.5   25   17-41    275-299 (382)
 24 TIGR00030 S21p ribosomal prote  24.1      87  0.0019   17.3   2.2   24   20-43      5-28  (58)
 25 PRK00846 hypothetical protein;  23.1 1.7E+02  0.0037   17.2   3.8   26   16-41     36-61  (77)
 26 PRK04406 hypothetical protein;  22.1 1.7E+02  0.0037   16.8   3.8   26   16-41     34-59  (75)
 27 PF14073 Cep57_CLD:  Centrosome  21.0      95  0.0021   21.1   2.3   21   21-41     71-91  (178)
 28 KOG3314|consensus               20.7 1.4E+02  0.0031   20.5   3.1   33   10-43     14-53  (194)
 29 KOG1003|consensus               20.4      91   0.002   21.7   2.1   21   20-40     80-100 (205)
 30 KOG4117|consensus               20.2      92   0.002   18.1   1.8   26   18-43     38-67  (73)

No 1  
>KOG2189|consensus
Probab=99.91  E-value=6.5e-25  Score=170.02  Aligned_cols=67  Identities=73%  Similarity=1.150  Sum_probs=64.1

Q ss_pred             CCCCCCCCCCcchhhhhhhhcchHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCCcchHHHHHHhhc
Q psy17052          1 MHSNLNPDVNAFQRKFVNEVRRCDEMERKLRYLEKEIKKDGIPMMDVGESPEAPQPREMIDLEASLM   67 (68)
Q Consensus         1 ~FrDLN~~v~~fqR~f~~~irRcde~er~lr~l~~~i~k~~i~~~~~~~~~~~p~~~~id~l~~~l~   67 (68)
                      ||||||++|++|||+||+||||||||||+|||+++||.|++++++..++.|++|++++|++++++++
T Consensus        36 qFrDLN~~v~afQR~fv~evrRcdemeRklrfl~~ei~k~~i~~~~~~~~~~~p~~~~i~dle~~l~  102 (829)
T KOG2189|consen   36 QFRDLNPDVSAFQRKFVNEVRRCDEMERKLRFLESEIKKAGIPLPDLDESPPAPPPREIIDLEEQLE  102 (829)
T ss_pred             EeeeCCCccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCccccCCCCCchHHHHHHHHHH
Confidence            7999999999999999999999999999999999999999999988778888999999999999875


No 2  
>PF01496 V_ATPase_I:  V-type ATPase 116kDa subunit family  ;  InterPro: IPR002490 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   The V-ATPases (or V1V0-ATPase) and A-ATPases (or A1A0-ATPase) are each composed of two linked complexes: the V1 or A1 complex contains the catalytic core that hydrolyses/synthesizes ATP, and the V0 or A0 complex that forms the membrane-spanning pore. The V- and A-ATPases both contain rotary motors, one that drives proton translocation across the membrane and one that drives ATP synthesis/hydrolysis [, , ]. The V- and A-ATPases more closely resemble one another in subunit structure than they do the F-ATPases, although the function of A-ATPases is closer to that of F-ATPases.  This entry represents the 116kDa subunit (or subunit a) and subunit I found in the V0 or A0 complex of V- or A-ATPases, respectively. The 116kDa subunit is a transmembrane glycoprotein required for the assembly and proton transport activity of the ATPase complex. Several isoforms of the 116kDa subunit exist, providing a potential role in the differential targeting and regulation of the V-ATPase for specific organelles []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015991 ATP hydrolysis coupled proton transport, 0033177 proton-transporting two-sector ATPase complex, proton-transporting domain; PDB: 2RPW_X 2NVJ_A 2JTW_A 3RRK_A.
Probab=99.32  E-value=2.4e-13  Score=105.04  Aligned_cols=66  Identities=62%  Similarity=1.009  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCcchhhhhhhhcchHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCCcchHHHHHHhh
Q psy17052          1 MHSNLNPDVNAFQRKFVNEVRRCDEMERKLRYLEKEIKKDGIPMMDVGESPEAPQPREMIDLEASL   66 (68)
Q Consensus         1 ~FrDLN~~v~~fqR~f~~~irRcde~er~lr~l~~~i~k~~i~~~~~~~~~~~p~~~~id~l~~~l   66 (68)
                      ||+|||+++++|||+|+++++|||||+|+|++++++|.|.++.++.....+..+.+..+++++..+
T Consensus        11 qF~Dln~~~~~fqr~f~~ev~r~de~erkL~~le~~I~k~~~~~~~~~~~~~~~~~~~i~~le~~l   76 (759)
T PF01496_consen   11 QFRDLNEDVSAFQRKFVNEVRRCDEMERKLRFLEEEIKKLKIPLPEKNDKPDAPKPKEIDELEEEL   76 (759)
T ss_dssp             ------------------------------------------------------------------
T ss_pred             EEEECccchhHHHHHhhhccccHHHHHHHHHHHHHHHHHhcCcccccccccccchhhHHHHHHHHH
Confidence            899999999999999999999999999999999999999998877544444445555555555443


No 3  
>COG4064 MtrG Tetrahydromethanopterin S-methyltransferase, subunit G [Coenzyme metabolism]
Probab=73.53  E-value=3.5  Score=24.32  Aligned_cols=24  Identities=29%  Similarity=0.555  Sum_probs=19.6

Q ss_pred             hhhhhcchHHHHHHHHHHHHHHHh
Q psy17052         16 FVNEVRRCDEMERKLRYLEKEIKK   39 (68)
Q Consensus        16 f~~~irRcde~er~lr~l~~~i~k   39 (68)
                      |-.=-+|+|++|+|+.|..++...
T Consensus        17 fne~~kRLdeieekvef~~~Ev~Q   40 (75)
T COG4064          17 FNEIHKRLDEIEEKVEFVNGEVYQ   40 (75)
T ss_pred             HHHHHHHHHHHHHHHHhhHHHHHH
Confidence            444458999999999999998864


No 4  
>TIGR01149 mtrG N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G. coenzyme M methyltransferase subunit G in methanogenic archaea. This methyltranfersae is membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme methyl-coenzyme M reductase.
Probab=63.02  E-value=9.1  Score=22.41  Aligned_cols=24  Identities=29%  Similarity=0.639  Sum_probs=21.0

Q ss_pred             hhhhhcchHHHHHHHHHHHHHHHh
Q psy17052         16 FVNEVRRCDEMERKLRYLEKEIKK   39 (68)
Q Consensus        16 f~~~irRcde~er~lr~l~~~i~k   39 (68)
                      |..=.+|+|++|.|+.|..+|+..
T Consensus        14 ~~~i~~rLd~iEeKVEf~~~E~~Q   37 (70)
T TIGR01149        14 FNEVMKRLDEIEEKVEFVNGEVAQ   37 (70)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            566678999999999999999874


No 5  
>PRK01026 tetrahydromethanopterin S-methyltransferase subunit G; Provisional
Probab=62.90  E-value=9  Score=22.82  Aligned_cols=24  Identities=33%  Similarity=0.531  Sum_probs=21.4

Q ss_pred             hhhhhcchHHHHHHHHHHHHHHHh
Q psy17052         16 FVNEVRRCDEMERKLRYLEKEIKK   39 (68)
Q Consensus        16 f~~~irRcde~er~lr~l~~~i~k   39 (68)
                      |..=.+|+|++|.|+.|-.+|+..
T Consensus        17 ~~~i~~rLD~iEeKVEftn~Ei~Q   40 (77)
T PRK01026         17 FKEIQKRLDEIEEKVEFTNAEIFQ   40 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            667789999999999999999874


No 6  
>PF04210 MtrG:  Tetrahydromethanopterin S-methyltransferase, subunit G ;  InterPro: IPR005866  This model describes the N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit G in methanogenic archaea. This methyltranferase is a membrane-associated enzyme complex that uses methyl-transfer reaction to drive a sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of a methyl group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme methyl-coenzyme M reductase.; GO: 0030269 tetrahydromethanopterin S-methyltransferase activity, 0015948 methanogenesis, 0016021 integral to membrane
Probab=62.52  E-value=8.9  Score=22.47  Aligned_cols=25  Identities=32%  Similarity=0.590  Sum_probs=21.5

Q ss_pred             hhhhhhcchHHHHHHHHHHHHHHHh
Q psy17052         15 KFVNEVRRCDEMERKLRYLEKEIKK   39 (68)
Q Consensus        15 ~f~~~irRcde~er~lr~l~~~i~k   39 (68)
                      -|..=.+|+|++|.|+.|..+|+..
T Consensus        13 ~~~~i~~rLd~iEeKvEf~~~Ei~Q   37 (70)
T PF04210_consen   13 DFNEIMKRLDEIEEKVEFTNAEIAQ   37 (70)
T ss_pred             HHHHHHHHHHHHHHHHHhHHHHHHH
Confidence            3666678999999999999999874


No 7  
>PRK00736 hypothetical protein; Provisional
Probab=48.57  E-value=46  Score=18.83  Aligned_cols=26  Identities=15%  Similarity=0.268  Sum_probs=21.1

Q ss_pred             hhhhhcchHHHHHHHHHHHHHHHhcC
Q psy17052         16 FVNEVRRCDEMERKLRYLEKEIKKDG   41 (68)
Q Consensus        16 f~~~irRcde~er~lr~l~~~i~k~~   41 (68)
                      -+.+-+.++.+.++|+.|...+...+
T Consensus        28 v~~Qq~~i~~L~~ql~~L~~rl~~~~   53 (68)
T PRK00736         28 LAEQWKTVEQMRKKLDALTERFLSLE   53 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            35667888999999999999987643


No 8  
>PRK00295 hypothetical protein; Provisional
Probab=44.92  E-value=52  Score=18.61  Aligned_cols=26  Identities=15%  Similarity=0.183  Sum_probs=20.6

Q ss_pred             hhhhhcchHHHHHHHHHHHHHHHhcC
Q psy17052         16 FVNEVRRCDEMERKLRYLEKEIKKDG   41 (68)
Q Consensus        16 f~~~irRcde~er~lr~l~~~i~k~~   41 (68)
                      -+.+-+.++.+.++++.+...+...+
T Consensus        28 v~~Qq~~I~~L~~ql~~L~~rl~~~~   53 (68)
T PRK00295         28 LVEQQRVIERLQLQMAALIKRQEEMV   53 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            35566778999999999999887643


No 9  
>PF10776 DUF2600:  Protein of unknown function (DUF2600);  InterPro: IPR019712 This is a bacterial family of proteins. Some members in the family are annotated as YtpB, however no function is currently known.
Probab=44.65  E-value=11  Score=27.76  Aligned_cols=39  Identities=21%  Similarity=0.261  Sum_probs=36.2

Q ss_pred             CCCCCCCCCcchhhhhhhhcchHHHHHHHHHHHHHHHhc
Q psy17052          2 HSNLNPDVNAFQRKFVNEVRRCDEMERKLRYLEKEIKKD   40 (68)
Q Consensus         2 FrDLN~~v~~fqR~f~~~irRcde~er~lr~l~~~i~k~   40 (68)
                      |+|++.|...-+..|+.+=.--++++.+|.+|.++-.+.
T Consensus       232 ~IDq~EDr~~GdLNFv~YY~~~~~~~~Rl~~f~~~A~~~  270 (330)
T PF10776_consen  232 FIDQEEDREGGDLNFVFYYPDEEEMEERLKYFVEKALEQ  270 (330)
T ss_pred             HhhhHhHhcCCCceeeeeCCCHHHHHHHHHHHHHHHHHH
Confidence            789999999999999999999999999999999988774


No 10 
>PF07304 SRA1:  Steroid receptor RNA activator (SRA1);  InterPro: IPR009917 This entry consists of several hypothetical mammalian steroid receptor RNA activator proteins. The SRA-RNAs encode stable proteins that are widely expressed and upregulated in breast cancer cell lines. SRA-RNA is a steroid receptor co-activator which acts as a functional RNA. This domain is also found at the C terminus of Sec31, a component of the coat protein complex II (COPII, which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). COPII has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. ; PDB: 2YRU_A.
Probab=44.47  E-value=25  Score=22.95  Aligned_cols=22  Identities=23%  Similarity=0.492  Sum_probs=17.8

Q ss_pred             cchHHHHHHHHHHHHHHHhcCC
Q psy17052         21 RRCDEMERKLRYLEKEIKKDGI   42 (68)
Q Consensus        21 rRcde~er~lr~l~~~i~k~~i   42 (68)
                      |.|++++|+|..|...+....+
T Consensus        65 r~~~D~~KRL~iLfd~ln~g~L   86 (157)
T PF07304_consen   65 RVVDDIEKRLNILFDHLNNGKL   86 (157)
T ss_dssp             HHHHHHHHHHHHHHHHHHHT-S
T ss_pred             hHHHHHHHHHHHHHHHHhcCCC
Confidence            3489999999999999986443


No 11 
>COG4003 Uncharacterized protein conserved in archaea [Function unknown]
Probab=44.31  E-value=24  Score=21.64  Aligned_cols=22  Identities=32%  Similarity=0.505  Sum_probs=16.3

Q ss_pred             hhhhcchHHHHHHHHHHHHHHH
Q psy17052         17 VNEVRRCDEMERKLRYLEKEIK   38 (68)
Q Consensus        17 ~~~irRcde~er~lr~l~~~i~   38 (68)
                      ...++|||-.|-.|..|+=.-+
T Consensus        38 ~D~L~rCdT~EEAlEii~yleK   59 (98)
T COG4003          38 IDFLRRCDTEEEALEIINYLEK   59 (98)
T ss_pred             HHHHHHhCcHHHHHHHHHHHHH
Confidence            6778999998888876654333


No 12 
>PF03235 DUF262:  Protein of unknown function DUF262;  InterPro: IPR004919 This entry is found in prokaryotic proteins of unknown function.
Probab=43.00  E-value=9.2  Score=24.44  Aligned_cols=23  Identities=13%  Similarity=0.263  Sum_probs=14.7

Q ss_pred             CCCcchhhhhhhhcchHHHHHHHHHHHHH
Q psy17052          8 DVNAFQRKFVNEVRRCDEMERKLRYLEKE   36 (68)
Q Consensus         8 ~v~~fqR~f~~~irRcde~er~lr~l~~~   36 (68)
                      .+|.|||.|+=.-.      ....++.+.
T Consensus        13 ~iP~yQR~yvW~~~------~~~~Li~si   35 (221)
T PF03235_consen   13 VIPDYQRDYVWDEE------QIEELIDSI   35 (221)
T ss_pred             cCCCCCCCCccCHH------HHHHHHHHH
Confidence            57899999984333      344455555


No 13 
>PF11239 DUF3040:  Protein of unknown function (DUF3040);  InterPro: IPR021401  Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. 
Probab=42.16  E-value=15  Score=21.29  Aligned_cols=13  Identities=62%  Similarity=0.956  Sum_probs=8.3

Q ss_pred             hhcchHHHHHHHH
Q psy17052         19 EVRRCDEMERKLR   31 (68)
Q Consensus        19 ~irRcde~er~lr   31 (68)
                      |=|+++||||.|+
T Consensus         7 E~r~L~eiEr~L~   19 (82)
T PF11239_consen    7 EQRRLEEIERQLR   19 (82)
T ss_pred             HHHHHHHHHHHHH
Confidence            4466777777663


No 14 
>PF01517 HDV_ag:  Hepatitis delta virus delta antigen;  InterPro: IPR002506 The Hepatitis delta virus (HDV) encodes a single protein, the hepatitis delta antigen (HDAg). The central region of this protein has been shown to bind RNA []. Several interactions are also mediated by a coiled-coil region at the N terminus of the protein [].; GO: 0003723 RNA binding, 0042025 host cell nucleus; PDB: 1A92_D 1BY0_A.
Probab=41.25  E-value=30  Score=23.62  Aligned_cols=26  Identities=38%  Similarity=0.613  Sum_probs=23.7

Q ss_pred             hhhhhhcchHHHHHHHHHHHHHHHhc
Q psy17052         15 KFVNEVRRCDEMERKLRYLEKEIKKD   40 (68)
Q Consensus        15 ~f~~~irRcde~er~lr~l~~~i~k~   40 (68)
                      .||+.-++.+++||.||-...-|+|.
T Consensus        19 ~wv~~rk~~eeler~lrk~~k~ikkl   44 (194)
T PF01517_consen   19 QWVSGRKKAEELERDLRKAKKKIKKL   44 (194)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            48999999999999999999999884


No 15 
>PF14182 YgaB:  YgaB-like protein
Probab=39.68  E-value=26  Score=20.92  Aligned_cols=21  Identities=43%  Similarity=0.884  Sum_probs=16.1

Q ss_pred             hhhcchHHHHHHHHHHHHHHH
Q psy17052         18 NEVRRCDEMERKLRYLEKEIK   38 (68)
Q Consensus        18 ~~irRcde~er~lr~l~~~i~   38 (68)
                      +++-||.++|+.|.-++.+-.
T Consensus        21 sElERCqeIE~eL~~l~~ea~   41 (79)
T PF14182_consen   21 SELERCQEIEKELKELEREAE   41 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHHHh
Confidence            578899999998877765543


No 16 
>PF12240 Angiomotin_C:  Angiomotin C terminal;  InterPro: IPR024646 This domain represents the C-terminal region of angiomotin. Angiomotin regulates the action of angiogenesis-inhibitor angiostatin []. The C-terminal region of angiomotin appears to be involved in directing the protein chemotactically [].
Probab=35.38  E-value=41  Score=23.39  Aligned_cols=24  Identities=29%  Similarity=0.616  Sum_probs=20.0

Q ss_pred             hhhcchHHHHHHHHHHHHHHHhcC
Q psy17052         18 NEVRRCDEMERKLRYLEKEIKKDG   41 (68)
Q Consensus        18 ~~irRcde~er~lr~l~~~i~k~~   41 (68)
                      ..-+||-|||-+|+-|+.+|..-+
T Consensus       133 ~a~~K~qemE~RIK~LhaqI~EKD  156 (205)
T PF12240_consen  133 MANRKCQEMENRIKALHAQIAEKD  156 (205)
T ss_pred             HhhhhHHHHHHHHHHHHHHHHHHH
Confidence            345899999999999999998543


No 17 
>PF09868 DUF2095:  Uncharacterized protein conserved in archaea (DUF2095);  InterPro: IPR018662  This domain, found in various hypothetical prokaryotic proteins, has no known function. 
Probab=34.94  E-value=23  Score=22.86  Aligned_cols=24  Identities=29%  Similarity=0.613  Sum_probs=17.0

Q ss_pred             hhhhcchHHHHHHHHHHHHHHHhcC
Q psy17052         17 VNEVRRCDEMERKLRYLEKEIKKDG   41 (68)
Q Consensus        17 ~~~irRcde~er~lr~l~~~i~k~~   41 (68)
                      +..||||+..|-.|..|. -|.|+|
T Consensus        68 iD~lrRC~T~EEALEVIn-ylek~G   91 (128)
T PF09868_consen   68 IDYLRRCKTDEEALEVIN-YLEKRG   91 (128)
T ss_pred             HHHHHHhCcHHHHHHHHH-HHHHhC
Confidence            778999999888776553 444444


No 18 
>PF06825 HSBP1:  Heat shock factor binding protein 1;  InterPro: IPR009643 Heat shock factor binding protein 1 (HSBP1) appears to be a negative regulator of the heat shock response [].; PDB: 3CI9_A.
Probab=34.86  E-value=17  Score=20.08  Aligned_cols=20  Identities=40%  Similarity=0.523  Sum_probs=15.9

Q ss_pred             hhcchHHHHHHHHHHHHHHH
Q psy17052         19 EVRRCDEMERKLRYLEKEIK   38 (68)
Q Consensus        19 ~irRcde~er~lr~l~~~i~   38 (68)
                      =+.|.|+|.++|.-|+.-|.
T Consensus        26 I~~riDeM~~RIDdLE~si~   45 (54)
T PF06825_consen   26 ILGRIDEMSSRIDDLEKSIA   45 (54)
T ss_dssp             HHHHHHHHHHHHHCCHHHH-
T ss_pred             HHHHHHHHHhhHHHHHHHHH
Confidence            36789999999988887775


No 19 
>cd02641 R3H_Smubp-2_like R3H domain of Smubp-2_like proteins.  Smubp-2_like proteins also contain a helicase_like and an AN1-like Zinc finger domain and have been shown to bind single-stranded DNA. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA.
Probab=32.14  E-value=24  Score=19.49  Aligned_cols=16  Identities=25%  Similarity=0.582  Sum_probs=11.0

Q ss_pred             CCCCCCcchhhhhhhh
Q psy17052          5 LNPDVNAFQRKFVNEV   20 (68)
Q Consensus         5 LN~~v~~fqR~f~~~i   20 (68)
                      +-|+++++||.++.++
T Consensus        22 F~p~ls~~eR~~vH~l   37 (60)
T cd02641          22 FPPTLSSHDRLLVHEL   37 (60)
T ss_pred             CCCCCCHHHHHHHHHH
Confidence            3456778888777655


No 20 
>KOG2775|consensus
Probab=29.52  E-value=77  Score=23.87  Aligned_cols=31  Identities=29%  Similarity=0.531  Sum_probs=26.0

Q ss_pred             hhhhhhcchHHHHHHHHHHHHHHHhcCCCCC
Q psy17052         15 KFVNEVRRCDEMERKLRYLEKEIKKDGIPMM   45 (68)
Q Consensus        15 ~f~~~irRcde~er~lr~l~~~i~k~~i~~~   45 (68)
                      .-.+.+||..|..|+.|+-.+-+.|.|+.+.
T Consensus        83 ~i~~d~rraAE~HRqvR~yv~s~ikPGmtm~  113 (397)
T KOG2775|consen   83 DIYQDLRRAAEAHRQVRKYVQSIIKPGMTMI  113 (397)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccCcccHH
Confidence            3578899999999999999988888887643


No 21 
>cd06006 R3H_unknown_2 R3H domain of a group of fungal proteins with unknown function. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA  or ssRNA in a sequence-specific manner.
Probab=27.85  E-value=27  Score=19.45  Aligned_cols=12  Identities=33%  Similarity=0.636  Sum_probs=7.3

Q ss_pred             CCcchhhhhhhh
Q psy17052          9 VNAFQRKFVNEV   20 (68)
Q Consensus         9 v~~fqR~f~~~i   20 (68)
                      .+++||.|+.++
T Consensus        25 M~~~~R~~vHdl   36 (59)
T cd06006          25 MRSPQRAFIHEL   36 (59)
T ss_pred             CCHHHHHHHHHH
Confidence            355677776654


No 22 
>PF15358 TSKS:  Testis-specific serine kinase substrate
Probab=25.72  E-value=94  Score=24.33  Aligned_cols=16  Identities=38%  Similarity=0.773  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHh
Q psy17052         24 DEMERKLRYLEKEIKK   39 (68)
Q Consensus        24 de~er~lr~l~~~i~k   39 (68)
                      .-+|.|||||+.+++-
T Consensus       198 ~~LEekLr~lq~qLqd  213 (558)
T PF15358_consen  198 ALLEEKLRYLQQQLQD  213 (558)
T ss_pred             HHHHHHHHHHHHHhcc
Confidence            3478899999999974


No 23 
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only]
Probab=25.41  E-value=70  Score=23.91  Aligned_cols=25  Identities=40%  Similarity=0.579  Sum_probs=22.7

Q ss_pred             hhhhcchHHHHHHHHHHHHHHHhcC
Q psy17052         17 VNEVRRCDEMERKLRYLEKEIKKDG   41 (68)
Q Consensus        17 ~~~irRcde~er~lr~l~~~i~k~~   41 (68)
                      +..|||-|+=-++.|||.++|.|-+
T Consensus       275 ~eRVkrWdeEv~kaR~fv~elEkig  299 (382)
T COG1103         275 VERVKRWDEEVEKARWFVAELEKIG  299 (382)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            5679999999999999999999976


No 24 
>TIGR00030 S21p ribosomal protein S21. This model describes bacterial ribosomal protein S21 and most mitochondrial and chloroplast equivalents.
Probab=24.09  E-value=87  Score=17.26  Aligned_cols=24  Identities=25%  Similarity=0.614  Sum_probs=19.4

Q ss_pred             hcchHHHHHHHHHHHHHHHhcCCC
Q psy17052         20 VRRCDEMERKLRYLEKEIKKDGIP   43 (68)
Q Consensus        20 irRcde~er~lr~l~~~i~k~~i~   43 (68)
                      |+--|.+|+-|+-|...+.+.||.
T Consensus         5 V~~~e~ie~alrrfkr~~~~~gil   28 (58)
T TIGR00030         5 VKEGESIDSALRRFKRKLEKEGIL   28 (58)
T ss_pred             eCCCCcHHHHHHHHHHHHHHcchH
Confidence            344455999999999999999874


No 25 
>PRK00846 hypothetical protein; Provisional
Probab=23.08  E-value=1.7e+02  Score=17.15  Aligned_cols=26  Identities=12%  Similarity=0.073  Sum_probs=21.8

Q ss_pred             hhhhhcchHHHHHHHHHHHHHHHhcC
Q psy17052         16 FVNEVRRCDEMERKLRYLEKEIKKDG   41 (68)
Q Consensus        16 f~~~irRcde~er~lr~l~~~i~k~~   41 (68)
                      -+.+.+-++.+.++++++...++..+
T Consensus        36 v~~qq~~I~~L~~ql~~L~~rL~~~~   61 (77)
T PRK00846         36 LADARLTGARNAELIRHLLEDLGKVR   61 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            45677889999999999999998754


No 26 
>PRK04406 hypothetical protein; Provisional
Probab=22.10  E-value=1.7e+02  Score=16.82  Aligned_cols=26  Identities=12%  Similarity=0.287  Sum_probs=20.1

Q ss_pred             hhhhhcchHHHHHHHHHHHHHHHhcC
Q psy17052         16 FVNEVRRCDEMERKLRYLEKEIKKDG   41 (68)
Q Consensus        16 f~~~irRcde~er~lr~l~~~i~k~~   41 (68)
                      -+.+-+-++.+.++|+.+...+...+
T Consensus        34 v~~Qq~~I~~L~~ql~~L~~rl~~~~   59 (75)
T PRK04406         34 LSQQQLLITKMQDQMKYVVGKVKNMD   59 (75)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            35566778999999999998887543


No 27 
>PF14073 Cep57_CLD:  Centrosome localisation domain of Cep57
Probab=20.98  E-value=95  Score=21.11  Aligned_cols=21  Identities=29%  Similarity=0.702  Sum_probs=18.3

Q ss_pred             cchHHHHHHHHHHHHHHHhcC
Q psy17052         21 RRCDEMERKLRYLEKEIKKDG   41 (68)
Q Consensus        21 rRcde~er~lr~l~~~i~k~~   41 (68)
                      -||--+|++|.|+...+..+.
T Consensus        71 tRCslLEKQLeyMRkmv~~ae   91 (178)
T PF14073_consen   71 TRCSLLEKQLEYMRKMVESAE   91 (178)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            599999999999999888654


No 28 
>KOG3314|consensus
Probab=20.70  E-value=1.4e+02  Score=20.46  Aligned_cols=33  Identities=24%  Similarity=0.555  Sum_probs=26.5

Q ss_pred             CcchhhhhhhhcchHHHHHH-------HHHHHHHHHhcCCC
Q psy17052         10 NAFQRKFVNEVRRCDEMERK-------LRYLEKEIKKDGIP   43 (68)
Q Consensus        10 ~~fqR~f~~~irRcde~er~-------lr~l~~~i~k~~i~   43 (68)
                      +|-+| |-+++..|.+|-|+       ++||...|.|.|-.
T Consensus        14 npqar-~~ks~~kCq~~~~~~l~~nP~Vkfl~~am~k~~c~   53 (194)
T KOG3314|consen   14 NPQAR-RGKSIDKCQDMIRRSLRTNPIVKFLMEAMEKSGCR   53 (194)
T ss_pred             Cchhh-hhhHHHHHHHHHHHHhccCcHHHHHHHHHHHcCCC
Confidence            45566 88999999999876       57899999998743


No 29 
>KOG1003|consensus
Probab=20.38  E-value=91  Score=21.73  Aligned_cols=21  Identities=33%  Similarity=0.578  Sum_probs=18.5

Q ss_pred             hcchHHHHHHHHHHHHHHHhc
Q psy17052         20 VRRCDEMERKLRYLEKEIKKD   40 (68)
Q Consensus        20 irRcde~er~lr~l~~~i~k~   40 (68)
                      .|.|+++.|+|-++++.+...
T Consensus        80 drK~eEVarkL~iiE~dLE~~  100 (205)
T KOG1003|consen   80 DRKYEEVARKLVIIEGELERA  100 (205)
T ss_pred             HHHHHHHHHHHHHHHhHHHHH
Confidence            478999999999999999864


No 30 
>KOG4117|consensus
Probab=20.20  E-value=92  Score=18.15  Aligned_cols=26  Identities=31%  Similarity=0.558  Sum_probs=18.5

Q ss_pred             hhhcchHHHHHHHHHHHHHHH----hcCCC
Q psy17052         18 NEVRRCDEMERKLRYLEKEIK----KDGIP   43 (68)
Q Consensus        18 ~~irRcde~er~lr~l~~~i~----k~~i~   43 (68)
                      .=|+|.|+|..++.-|+.-|.    .+|+.
T Consensus        38 QII~RiDDM~~riDDLEKnIaDLm~qagvE   67 (73)
T KOG4117|consen   38 QIIGRIDDMSSRIDDLEKNIADLMTQAGVE   67 (73)
T ss_pred             HHHHHHhhhhhhhHHHHHHHHHHHHHcccc
Confidence            347899999988888776544    45554


Done!