Query         psy17052
Match_columns 68
No_of_seqs    111 out of 354
Neff          6.0 
Searched_HMMs 29240
Date          Fri Aug 16 20:36:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17052.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/17052hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3rrk_A V-type ATPase 116 kDa s  97.0 0.00036 1.2E-08   48.5   2.8   41    1-41     40-83  (357)
  2 1a92_A Delta antigen; leucine   56.3      10 0.00035   20.0   2.5   26   15-40      8-33  (50)
  3 1pyi_A Protein (pyrimidine pat  49.6      31  0.0011   18.9   4.5   24   23-46     50-73  (96)
  4 3vmx_A Voltage-gated hydrogen   42.4      28 0.00094   18.2   2.8   22   21-42     25-46  (48)
  5 3pp5_A BRK1, protein brick1; t  39.7      20 0.00069   20.2   2.2   18   21-38     52-69  (73)
  6 3p8c_E Probable protein brick1  35.3      20 0.00067   20.4   1.7   19   21-39     52-70  (75)
  7 4abx_A DNA repair protein RECN  33.8      26 0.00088   21.8   2.2   23   21-43    122-144 (175)
  8 2yru_A Steroid receptor RNA ac  31.5      38  0.0013   20.3   2.7   22   21-42     35-57  (118)
  9 3ljm_A Coil Ser L9C; de novo d  30.8      43  0.0015   15.6   2.2   18   21-38      8-25  (31)
 10 2akf_A Coronin-1A; coiled coil  27.0      58   0.002   15.4   2.5   20   20-39      1-20  (32)
 11 3ci9_A Heat shock factor-bindi  25.3      13 0.00044   19.4  -0.3   17   20-36     30-46  (48)
 12 2cly_C ATP synthase coupling f  24.6      22 0.00075   20.3   0.6   19    5-23      1-19  (77)
 13 2wh0_Q Pkcev3, protein kinase   24.0      42  0.0014   15.6   1.5   16   51-66      7-22  (31)
 14 3a98_B Engulfment and cell mot  23.0      51  0.0017   21.4   2.2   29   14-46    156-184 (203)

No 1  
>3rrk_A V-type ATPase 116 kDa subunit; alpha beta fold, proton pump, subunit I/A, V-ATPase, proton; HET: NHE; 2.64A {Meiothermus ruber}
Probab=97.02  E-value=0.00036  Score=48.51  Aligned_cols=41  Identities=12%  Similarity=0.021  Sum_probs=37.4

Q ss_pred             CCCCCCCCCCcch--hhhh-hhhcchHHHHHHHHHHHHHHHhcC
Q psy17052          1 MHSNLNPDVNAFQ--RKFV-NEVRRCDEMERKLRYLEKEIKKDG   41 (68)
Q Consensus         1 ~FrDLN~~v~~fq--R~f~-~~irRcde~er~lr~l~~~i~k~~   41 (68)
                      ||+|+|++++.|+  ++|. +++++|+++.++++++.+.+.++.
T Consensus        40 hi~d~~~~~~~~~~l~~~~~~~~~~~~~~~~k~~~~~~~L~~~~   83 (357)
T 3rrk_A           40 HIDPLRPDELGEYRLSPTEEAELKRWEAVVSQAEQSLTVVGLAT   83 (357)
T ss_dssp             EEEEECGGGGGGGCCCHHHHHHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             EEEeccccccccccCCccchHHHhHHHHHHHHHHHHHHHhcccc
Confidence            7899999999999  8877 689999999999999999999764


No 2  
>1a92_A Delta antigen; leucine zipper, coiled-coil, oligomerization; 1.80A {Hepatitis delta virus} SCOP: h.4.6.1 PDB: 1by0_A
Probab=56.26  E-value=10  Score=20.01  Aligned_cols=26  Identities=42%  Similarity=0.654  Sum_probs=22.5

Q ss_pred             hhhhhhcchHHHHHHHHHHHHHHHhc
Q psy17052         15 KFVNEVRRCDEMERKLRYLEKEIKKD   40 (68)
Q Consensus        15 ~f~~~irRcde~er~lr~l~~~i~k~   40 (68)
                      .||+.=|+.+++||.||-....|+|-
T Consensus         8 qWv~~Rkk~eeler~lrk~kk~iKkl   33 (50)
T 1a92_A            8 QWVSGRKKLEELERDLRKLKKKIKKL   33 (50)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            46778899999999999999999873


No 3  
>1pyi_A Protein (pyrimidine pathway regulator 1); protein-DNA complex, transcription/DNA complex, GAL4, zinc finger, Zn2Cys6, binuclear cluster; HET: DNA; 3.20A {Saccharomyces cerevisiae} SCOP: g.38.1.1 h.1.3.1
Probab=49.64  E-value=31  Score=18.92  Aligned_cols=24  Identities=17%  Similarity=0.213  Sum_probs=19.5

Q ss_pred             hHHHHHHHHHHHHHHHhcCCCCCC
Q psy17052         23 CDEMERKLRYLEKEIKKDGIPMMD   46 (68)
Q Consensus        23 cde~er~lr~l~~~i~k~~i~~~~   46 (68)
                      .+.++.+|..|+..+.+.++....
T Consensus        50 ~~~Le~rl~~le~~l~~~~~~~~~   73 (96)
T 1pyi_A           50 VFFLEDRLAVMMRVLKEYGVDPTK   73 (96)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCCC
T ss_pred             HHHHHHHHHHHHHHHHHhCCCccc
Confidence            567899999999999998875443


No 4  
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus}
Probab=42.43  E-value=28  Score=18.20  Aligned_cols=22  Identities=32%  Similarity=0.650  Sum_probs=18.8

Q ss_pred             cchHHHHHHHHHHHHHHHhcCC
Q psy17052         21 RRCDEMERKLRYLEKEIKKDGI   42 (68)
Q Consensus        21 rRcde~er~lr~l~~~i~k~~i   42 (68)
                      ..|+++|+.+.=|...++.+|.
T Consensus        25 ~~c~~~eQEieRL~~LLkqHgl   46 (48)
T 3vmx_A           25 FSCSEKEQEIERLNKLLKQNGL   46 (48)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTC
T ss_pred             HHccHHHHHHHHHHHHHHHcCC
Confidence            4799999999999999988874


No 5  
>3pp5_A BRK1, protein brick1; triple coiled-coil, precursor of the SCAR-WAVE complex, ABI, structural protein; 1.50A {Dictyostelium discoideum}
Probab=39.67  E-value=20  Score=20.23  Aligned_cols=18  Identities=28%  Similarity=0.578  Sum_probs=15.2

Q ss_pred             cchHHHHHHHHHHHHHHH
Q psy17052         21 RRCDEMERKLRYLEKEIK   38 (68)
Q Consensus        21 rRcde~er~lr~l~~~i~   38 (68)
                      .|+..+||+|.||+..+.
T Consensus        52 ~kL~~lE~~L~iLEAkls   69 (73)
T 3pp5_A           52 EKLTILDRQVDYLEATFK   69 (73)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHh
Confidence            567889999999998875


No 6  
>3p8c_E Probable protein brick1; actin polymerization, protein binding; 2.29A {Homo sapiens}
Probab=35.28  E-value=20  Score=20.37  Aligned_cols=19  Identities=26%  Similarity=0.688  Sum_probs=16.0

Q ss_pred             cchHHHHHHHHHHHHHHHh
Q psy17052         21 RRCDEMERKLRYLEKEIKK   39 (68)
Q Consensus        21 rRcde~er~lr~l~~~i~k   39 (68)
                      .|+..+||+|.||+..+.+
T Consensus        52 ~KL~~LEr~L~iLEAklss   70 (75)
T 3p8c_E           52 EKLTALERRIEYIEARVTK   70 (75)
T ss_dssp             HHHHHHHHHHHHHHHHHSC
T ss_pred             HHHHHHHHHHHHHHHHHhc
Confidence            4677899999999998875


No 7  
>4abx_A DNA repair protein RECN; DNA binding protein, ATP binding protein, double break repair, coiled-coil; HET: DNA; 2.04A {Deinococcus radiodurans}
Probab=33.79  E-value=26  Score=21.84  Aligned_cols=23  Identities=30%  Similarity=0.293  Sum_probs=20.8

Q ss_pred             cchHHHHHHHHHHHHHHHhcCCC
Q psy17052         21 RRCDEMERKLRYLEKEIKKDGIP   43 (68)
Q Consensus        21 rRcde~er~lr~l~~~i~k~~i~   43 (68)
                      .|+++++.+|.-|....+|||..
T Consensus       122 ~rL~~ie~RL~~l~~L~RKyg~~  144 (175)
T 4abx_A          122 EALDRVEARLSALSKLKNKYGPT  144 (175)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCSS
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCC
Confidence            57899999999999999999854


No 8  
>2yru_A Steroid receptor RNA activator 1; SRAP, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=31.52  E-value=38  Score=20.34  Aligned_cols=22  Identities=23%  Similarity=0.643  Sum_probs=19.1

Q ss_pred             cc-hHHHHHHHHHHHHHHHhcCC
Q psy17052         21 RR-CDEMERKLRYLEKEIKKDGI   42 (68)
Q Consensus        21 rR-cde~er~lr~l~~~i~k~~i   42 (68)
                      || +|+++++|..|..-+....+
T Consensus        35 k~~~~D~~KRL~~LfdkLn~~~L   57 (118)
T 2yru_A           35 KQVCDDISRRLALLREQWAGGKL   57 (118)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCS
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCC
Confidence            44 89999999999999998655


No 9  
>3ljm_A Coil Ser L9C; de novo design, three stranded coiled coil, APO, de novo Pro; 1.36A {Synthetic} PDB: 2jgo_A 1cos_A 3h5g_A 3h5f_A 3pbj_A 2x6p_C 1coi_A
Probab=30.78  E-value=43  Score=15.62  Aligned_cols=18  Identities=39%  Similarity=0.839  Sum_probs=14.6

Q ss_pred             cchHHHHHHHHHHHHHHH
Q psy17052         21 RRCDEMERKLRYLEKEIK   38 (68)
Q Consensus        21 rRcde~er~lr~l~~~i~   38 (68)
                      ++|..+|.+|.-++.-+.
T Consensus         8 kkcaalesklqalekkle   25 (31)
T 3ljm_A            8 KKCAALESKLQALEKKLE   25 (31)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            678899999988887665


No 10 
>2akf_A Coronin-1A; coiled coil, protein binding; 1.20A {Synthetic}
Probab=26.96  E-value=58  Score=15.38  Aligned_cols=20  Identities=25%  Similarity=0.409  Sum_probs=15.9

Q ss_pred             hcchHHHHHHHHHHHHHHHh
Q psy17052         20 VRRCDEMERKLRYLEKEIKK   39 (68)
Q Consensus        20 irRcde~er~lr~l~~~i~k   39 (68)
                      |-|++|--|+|.-+.+++.+
T Consensus         1 isrlee~~r~l~~ivq~lq~   20 (32)
T 2akf_A            1 VSRLEEDVRNLNAIVQKLQE   20 (32)
T ss_dssp             CCHHHHHHHHHHHHHHHHHH
T ss_pred             CchHHHHHHHHHHHHHHHHH
Confidence            45788888888888888876


No 11 
>3ci9_A Heat shock factor-binding protein 1; triple helix, nucleus, transcription; 1.80A {Homo sapiens}
Probab=25.27  E-value=13  Score=19.36  Aligned_cols=17  Identities=35%  Similarity=0.618  Sum_probs=11.0

Q ss_pred             hcchHHHHHHHHHHHHH
Q psy17052         20 VRRCDEMERKLRYLEKE   36 (68)
Q Consensus        20 irRcde~er~lr~l~~~   36 (68)
                      +.|.|+|..+|.-|+.-
T Consensus        30 ~~riDdM~~RIDdLE~s   46 (48)
T 3ci9_A           30 IGRIDDMSSRIDDLEKN   46 (48)
T ss_dssp             HHHHHHHHHHHHTTC--
T ss_pred             HHHHHHHHhHHHHHHhh
Confidence            56778888887766543


No 12 
>2cly_C ATP synthase coupling factor 6, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} SCOP: f.45.1.1 PDB: 1vzs_A 2wss_V*
Probab=24.59  E-value=22  Score=20.30  Aligned_cols=19  Identities=26%  Similarity=0.651  Sum_probs=12.6

Q ss_pred             CCCCCCcchhhhhhhhcch
Q psy17052          5 LNPDVNAFQRKFVNEVRRC   23 (68)
Q Consensus         5 LN~~v~~fqR~f~~~irRc   23 (68)
                      +|..+-|.|..|+..||-.
T Consensus         1 ~~k~~DPIQqLFldKIREY   19 (77)
T 2cly_C            1 FNKELDPVQKLFVDKIREY   19 (77)
T ss_dssp             ----CCGGGHHHHHHHHHH
T ss_pred             CCcccchHHHHHHHHHHHH
Confidence            4677889999999888754


No 13 
>2wh0_Q Pkcev3, protein kinase C epsilon type, NPKC-epsilon; tandem binding, phosphoprotein, signaling protein, 14-3-3, cytoplasm, acetylation; HET: SEP; 2.25A {Homo sapiens}
Probab=23.97  E-value=42  Score=15.65  Aligned_cols=16  Identities=31%  Similarity=0.673  Sum_probs=12.1

Q ss_pred             CCCCCcchHHHHHHhh
Q psy17052         51 PEAPQPREMIDLEASL   66 (68)
Q Consensus        51 ~~~p~~~~id~l~~~l   66 (68)
                      |.+|+..+|.+|+..+
T Consensus         7 ptspcdqeikelenni   22 (31)
T 2wh0_Q            7 PTSPCDQEIKELENNI   22 (31)
T ss_pred             CCCchHHHHHHHHHHH
Confidence            4567778899998765


No 14 
>3a98_B Engulfment and cell motility protein 1; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} PDB: 2vsz_A
Probab=22.97  E-value=51  Score=21.45  Aligned_cols=29  Identities=31%  Similarity=0.342  Sum_probs=22.9

Q ss_pred             hhhhhhhcchHHHHHHHHHHHHHHHhcCCCCCC
Q psy17052         14 RKFVNEVRRCDEMERKLRYLEKEIKKDGIPMMD   46 (68)
Q Consensus        14 R~f~~~irRcde~er~lr~l~~~i~k~~i~~~~   46 (68)
                      .-..++|.++-+|+-+||.|.-    .|+.++.
T Consensus       156 ~et~~~v~~Ll~m~lklrLLdl----e~v~ip~  184 (203)
T 3a98_B          156 DLTRNDLDTLLSMEIKLRLLDL----ENIQIPD  184 (203)
T ss_dssp             HHHHHHHHHHHHHHHHHHTGGG----TTCCCCS
T ss_pred             HHHHHHHHHHHHHHHHHHhhcc----cCCcCCC
Confidence            3456889999999999999876    5677665


Done!